Skip to content
forked from IEDB/ARC

Antigen Receptor Classifier

License

Notifications You must be signed in to change notification settings

beckyjackson/ARC

 
 

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

95 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

Build Status

ARC (Antigen Receptor Classifier)

Authors: Austin Crinklaw, Swapnil Mahajan

Requirements:

  • Linux OS
  • HMMER3
  • NCBI Blast+
  • Python 3+
    • Python packages: Pandas, BioPython

Installation:

We provide a Dockerfile for ease of use.

ARC can also be downloaded through PyPI using the following pip command.

pip install bio-arc

Testing Installation:

A quick check for proper dependencies and successful installation can be performed by navigating to your pip package install directory (which can be located by executing pip show bio-arc) and running the following command:

python3 -m arc_test

Passing all unit-tests means that your system is configured properly and ready to classify some protein sequences.

Usage:

Input

  • A fasta format file with one or more protein sequences.
>1WBZ_A_alpha I H2-Kb
MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA
>1WBZ_B_b2m I H2-Kb
MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM

Commands

  • Using Fasta file as an input:
python -m ARC classify -i /path/to/input.fasta -o /path/to/output.csv

Output

  • Output file has 4 columns in CSV format.
  • First column named 'ID' is the description provoded in the fasta for each sequence.
  • Second column named 'class' is the assigned molecule class for each sequence.
    • e.g. MHC-I, MHC-II, BCR or TCR.
  • The third column named 'chain_type' is the assigned chain type for each sequence.
    • e.g. alpha, beta, heavy, lambda, kappa, scFv, TscFv or construct. These will also be labelled as V for variable domain or C for constant domain.
  • The fourth column named 'calc_mhc_allele' is the MHC allele identified using groove domain similarity to MRO alleles.
ID class chain_type calc_mhc_allele
1WBY_A_alpha I H2-Db MHC-I alpha V
1WBY_B_b2m I H2-Db
1HQR_A_alpha II HLA-DRA01:01/DRB501:01 MHC-II alpha C HLA-DRA*01:01
1HQR_B_beta II HLA-DRA01:01/DRB501:01 MHC-II beta C HLA-DRB5*01:01
2CMR_H_heavy BCR heavy V
2CMR_L_light BCR kappa C
4RFO_L_light BCR lambda V
3UZE_A_heavy BCR scFv
1FYT_D_alpha TCR alpha V
1FYT_E_beta TCR beta C
3TF7_C_alpha TCR TscFv

How it works:

  • BCR and TCR chains are identified using HMMs. A given protein sequence is searched against HMMs built using BCR and TCR chain sequences from IMGT. HMMER is used to align an input sequence to the HMMs.
  • MHC class I (alpha1-alpha2 domains) and MHC class I alpha and beta chain HMMs are downloaded from Pfam website. An input protein sequence is searched against these HMMs. A HMMER bit score threshold of 25 was used to identify MHC chain sequences.
  • To identify MHC alleles, groove domains (G-domains) are assigned based on the MRO repository.
  • IgNAR sequences are identified through querying against a custom blast database.

References:

Several methods for HMMER result parsing were sourced from ANARCI.

Dunbar J and Deane CM. ANARCI: Antigen receptor numbering and receptor classification. Bioinformatics (2016)

About

Antigen Receptor Classifier

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages

No packages published

Languages

  • Python 99.5%
  • Dockerfile 0.5%