pub struct Scroll<V> {
+Scroll in ori::core::views - Rust pub struct Scroll<V> {
pub content: Pod<V>,
pub axis: Axis,
pub transition: Styled<Transition>,
@@ -19,31 +19,48 @@
border_radius: Styled<BorderRadius>The radius of the scrollbar.
§color: Styled<Color>The color of the scrollbar.
§knob_color: Styled<Color>The color of the scrollbar knob.
-Implementations§
Trait Implementations§
source§impl<T, V> View<T> for Scroll<V>where
- V: View<T>,
Implementations§
source§impl<V> Scroll<V>
sourcepub fn axis(self, axis: impl Into<Axis>) -> Scroll<V>
Set self.axis.
+The axis of the scroll.
+sourcepub fn transition(self, transition: impl Into<Styled<Transition>>) -> Scroll<V>
Set self.transition.
+The transition of the scrollbar.
+sourcepub fn inset(self, inset: impl Into<Styled<f32>>) -> Scroll<V>
Set self.inset.
+The inset of the scrollbar.
+sourcepub fn width(self, width: impl Into<Styled<f32>>) -> Scroll<V>
Set self.width.
+The width of the scrollbar.
+sourcepub fn border_radius(
+ self,
+ border_radius: impl Into<Styled<BorderRadius>>,
+) -> Scroll<V>
Set self.border_radius.
+The radius of the scrollbar.
+Trait Implementations§
source§impl<T, V> View<T> for Scroll<V>where
+ V: View<T>,
§type State = (ScrollState, State<T, V>)
The state of the view, see top-level documentation for more information.source§fn build(
&mut self,
cx: &mut BuildCx<'_, '_>,
data: &mut T,
-) -> <Scroll<V> as View<T>>::State
Build the view state, see top-level documentation for more information.source§fn rebuild(
+) -> <Scroll<V> as View<T>>::State
Build the view state, see top-level documentation for more information.source§fn rebuild(
&mut self,
_: &mut <Scroll<V> as View<T>>::State,
cx: &mut RebuildCx<'_, '_>,
data: &mut T,
old: &Scroll<V>,
-)
Rebuild the view state, see top-level documentation for more information.source§fn event(
&mut self,
_: &mut <Scroll<V> as View<T>>::State,
cx: &mut EventCx<'_, '_>,
data: &mut T,
event: &Event,
-)
Handle an event, see top-level documentation for more information.source§fn layout(
&mut self,
_: &mut <Scroll<V> as View<T>>::State,
cx: &mut LayoutCx<'_, '_>,
data: &mut T,
space: Space,
-) -> Size
Layout the view, see top-level documentation for more information.source§fn draw(
&mut self,
_: &mut <Scroll<V> as View<T>>::State,
cx: &mut DrawCx<'_, '_>,
diff --git a/ori/core/views/struct.ScrollStyle.html b/ori/core/views/struct.ScrollStyle.html
index 94a86c3ed..88dd5d1c8 100644
--- a/ori/core/views/struct.ScrollStyle.html
+++ b/ori/core/views/struct.ScrollStyle.html
@@ -6,12 +6,12 @@
pub color: Color,
pub knob_color: Color,
}Expand description
The derived style for Scroll.
-Fields§
§transition: TransitionThe style of Scroll::transition.
-§inset: f32The style of Scroll::inset.
-§width: f32The style of Scroll::width.
-§border_radius: BorderRadiusThe style of Scroll::border_radius.
-§color: ColorThe style of Scroll::color.
-§knob_color: ColorThe style of Scroll::knob_color.
+
Fields§
§transition: TransitionThe style of Scroll::transition.
+§inset: f32The style of Scroll::inset.
+§width: f32The style of Scroll::width.
+§border_radius: BorderRadiusThe style of Scroll::border_radius.
+§color: ColorThe style of Scroll::color.
+§knob_color: ColorThe style of Scroll::knob_color.
Implementations§
source§impl ScrollStyle
sourcepub const TRANSITION: Style<Transition> = _
The style key of [Scroll.transition::TRANSITION].
sourcepub const WIDTH: Style<f32> = _
The style key of [Scroll.width::WIDTH].
diff --git a/ori/prelude/struct.Scroll.html b/ori/prelude/struct.Scroll.html
index d834f6100..aa54a5fa1 100644
--- a/ori/prelude/struct.Scroll.html
+++ b/ori/prelude/struct.Scroll.html
@@ -1,4 +1,4 @@
-Scroll in ori::prelude - Rust pub struct Scroll<V> {
+Scroll in ori::prelude - Rust pub struct Scroll<V> {
pub content: Pod<V>,
pub axis: Axis,
pub transition: Styled<Transition>,
@@ -19,31 +19,48 @@
border_radius: Styled<BorderRadius>The radius of the scrollbar.
§color: Styled<Color>The color of the scrollbar.
§knob_color: Styled<Color>The color of the scrollbar knob.
-Implementations§
Trait Implementations§
source§impl<T, V> View<T> for Scroll<V>where
- V: View<T>,
Implementations§
source§impl<V> Scroll<V>
sourcepub fn axis(self, axis: impl Into<Axis>) -> Scroll<V>
Set self.axis.
+The axis of the scroll.
+sourcepub fn transition(self, transition: impl Into<Styled<Transition>>) -> Scroll<V>
Set self.transition.
+The transition of the scrollbar.
+sourcepub fn inset(self, inset: impl Into<Styled<f32>>) -> Scroll<V>
Set self.inset.
+The inset of the scrollbar.
+sourcepub fn width(self, width: impl Into<Styled<f32>>) -> Scroll<V>
Set self.width.
+The width of the scrollbar.
+sourcepub fn border_radius(
+ self,
+ border_radius: impl Into<Styled<BorderRadius>>,
+) -> Scroll<V>
Set self.border_radius.
+The radius of the scrollbar.
+Trait Implementations§
source§impl<T, V> View<T> for Scroll<V>where
+ V: View<T>,
§type State = (ScrollState, State<T, V>)
The state of the view, see top-level documentation for more information.source§fn build(
&mut self,
cx: &mut BuildCx<'_, '_>,
data: &mut T,
-) -> <Scroll<V> as View<T>>::State
Build the view state, see top-level documentation for more information.source§fn rebuild(
+) -> <Scroll<V> as View<T>>::State
Build the view state, see top-level documentation for more information.source§fn rebuild(
&mut self,
_: &mut <Scroll<V> as View<T>>::State,
cx: &mut RebuildCx<'_, '_>,
data: &mut T,
old: &Scroll<V>,
-)
Rebuild the view state, see top-level documentation for more information.source§fn event(
&mut self,
_: &mut <Scroll<V> as View<T>>::State,
cx: &mut EventCx<'_, '_>,
data: &mut T,
event: &Event,
-)
Handle an event, see top-level documentation for more information.source§fn layout(
&mut self,
_: &mut <Scroll<V> as View<T>>::State,
cx: &mut LayoutCx<'_, '_>,
data: &mut T,
space: Space,
-) -> Size
Layout the view, see top-level documentation for more information.source§fn draw(
&mut self,
_: &mut <Scroll<V> as View<T>>::State,
cx: &mut DrawCx<'_, '_>,
diff --git a/ori/prelude/struct.ScrollStyle.html b/ori/prelude/struct.ScrollStyle.html
index 893a96697..fe053421d 100644
--- a/ori/prelude/struct.ScrollStyle.html
+++ b/ori/prelude/struct.ScrollStyle.html
@@ -6,12 +6,12 @@
pub color: Color,
pub knob_color: Color,
}Expand description
The derived style for Scroll.
-Fields§
§transition: TransitionThe style of Scroll::transition.
-§inset: f32The style of Scroll::inset.
-§width: f32The style of Scroll::width.
-§border_radius: BorderRadiusThe style of Scroll::border_radius.
-§color: ColorThe style of Scroll::color.
-§knob_color: ColorThe style of Scroll::knob_color.
+
Fields§
§transition: TransitionThe style of Scroll::transition.
+§inset: f32The style of Scroll::inset.
+§width: f32The style of Scroll::width.
+§border_radius: BorderRadiusThe style of Scroll::border_radius.
+§color: ColorThe style of Scroll::color.
+§knob_color: ColorThe style of Scroll::knob_color.
Implementations§
source§impl ScrollStyle
sourcepub const TRANSITION: Style<Transition> = _
The style key of [Scroll.transition::TRANSITION].
sourcepub const WIDTH: Style<f32> = _
The style key of [Scroll.width::WIDTH].
diff --git a/ori/prelude/trait.View.html b/ori/prelude/trait.View.html
index c72c4a73c..4f1d3511a 100644
--- a/ori/prelude/trait.View.html
+++ b/ori/prelude/trait.View.html
@@ -216,7 +216,7 @@
V: View,source§impl<T, V> View<T> for RebuildHandler<T, V>where
- V: View<T>,
source§impl<T, V> View<T> for Transform<V>where
diff --git a/ori_core/rebuild/derive.Rebuild.html b/ori_core/rebuild/derive.Rebuild.html
index 6e83496af..59286fa7f 100644
--- a/ori_core/rebuild/derive.Rebuild.html
+++ b/ori_core/rebuild/derive.Rebuild.html
@@ -1,4 +1,4 @@
-Rebuild in ori_core::rebuild - Rust #[derive(Rebuild)]
+Rebuild in ori_core::rebuild - Rust #[derive(Rebuild)]
{
// Attributes available to this derive:
#[styled]
diff --git a/ori_core/text/macro.include_font.html b/ori_core/text/macro.include_font.html
index 69117fdd1..155d3b1f5 100644
--- a/ori_core/text/macro.include_font.html
+++ b/ori_core/text/macro.include_font.html
@@ -1,3 +1,3 @@
-include_font in ori_core::text - Rust Macro ori_core::text::include_font
include_font!() { /* proc-macro */ }
Expand description
Load a font from a file or directory.
+include_font in ori_core::text - Rust Macro ori_core::text::include_font
source · include_font!() { /* proc-macro */ }
Expand description
Load a font from a file or directory.
The path is relative to the Cargo.toml file.
\ No newline at end of file
diff --git a/ori_core/views/struct.Scroll.html b/ori_core/views/struct.Scroll.html
index 5f44ff078..301467969 100644
--- a/ori_core/views/struct.Scroll.html
+++ b/ori_core/views/struct.Scroll.html
@@ -1,4 +1,4 @@
-Scroll in ori_core::views - Rust pub struct Scroll<V> {
+Scroll in ori_core::views - Rust pub struct Scroll<V> {
pub content: Pod<V>,
pub axis: Axis,
pub transition: Styled<Transition>,
@@ -19,26 +19,43 @@
border_radius: Styled<BorderRadius>The radius of the scrollbar.
§color: Styled<Color>The color of the scrollbar.
§knob_color: Styled<Color>The color of the scrollbar knob.
-Implementations§
Trait Implementations§
source§impl<T, V: View<T>> View<T> for Scroll<V>
§type State = (ScrollState, State<T, V>)
The state of the view, see top-level documentation for more information.Implementations§
source§impl<V> Scroll<V>
sourcepub fn transition(self, transition: impl Into<Styled<Transition>>) -> Self
Set self.transition.
+The transition of the scrollbar.
+sourcepub fn inset(self, inset: impl Into<Styled<f32>>) -> Self
Set self.inset.
+The inset of the scrollbar.
+sourcepub fn width(self, width: impl Into<Styled<f32>>) -> Self
Set self.width.
+The width of the scrollbar.
+sourcepub fn border_radius(
+ self,
+ border_radius: impl Into<Styled<BorderRadius>>,
+) -> Self
Set self.border_radius.
+The radius of the scrollbar.
+sourcepub fn color(self, color: impl Into<Styled<Color>>) -> Self
Set self.color.
+The color of the scrollbar.
+sourcepub fn knob_color(self, knob_color: impl Into<Styled<Color>>) -> Self
Set self.knob_color.
+The color of the scrollbar knob.
+Trait Implementations§
source§impl<T, V: View<T>> View<T> for Scroll<V>
§type State = (ScrollState, State<T, V>)
The state of the view, see top-level documentation for more information.source§fn build(&mut self, cx: &mut BuildCx<'_, '_>, data: &mut T) -> Self::State
Build the view state, see top-level documentation for more information.source§fn rebuild(
&mut self,
(state, content): &mut Self::State,
cx: &mut RebuildCx<'_, '_>,
data: &mut T,
old: &Self,
-)
Rebuild the view state, see top-level documentation for more information.source§fn event(
&mut self,
(state, content): &mut Self::State,
cx: &mut EventCx<'_, '_>,
data: &mut T,
event: &Event,
-)
Handle an event, see top-level documentation for more information.source§fn layout(
&mut self,
(_state, content): &mut Self::State,
cx: &mut LayoutCx<'_, '_>,
data: &mut T,
space: Space,
-) -> Size
Layout the view, see top-level documentation for more information.source§fn draw(
&mut self,
(state, content): &mut Self::State,
cx: &mut DrawCx<'_, '_>,
diff --git a/ori_core/views/struct.ScrollStyle.html b/ori_core/views/struct.ScrollStyle.html
index b1d3e03cc..c0fc83c5c 100644
--- a/ori_core/views/struct.ScrollStyle.html
+++ b/ori_core/views/struct.ScrollStyle.html
@@ -6,12 +6,12 @@
pub color: Color,
pub knob_color: Color,
}Expand description
The derived style for Scroll.
-Fields§
§transition: TransitionThe style of Scroll::transition.
-§inset: f32The style of Scroll::inset.
-§width: f32The style of Scroll::width.
-§border_radius: BorderRadiusThe style of Scroll::border_radius.
-§color: ColorThe style of Scroll::color.
-§knob_color: ColorThe style of Scroll::knob_color.
+
Fields§
§transition: TransitionThe style of Scroll::transition.
+§inset: f32The style of Scroll::inset.
+§width: f32The style of Scroll::width.
+§border_radius: BorderRadiusThe style of Scroll::border_radius.
+§color: ColorThe style of Scroll::color.
+§knob_color: ColorThe style of Scroll::knob_color.
Implementations§
source§impl ScrollStyle
sourcepub const TRANSITION: Style<Transition> = _
The style key of [Scroll.transition::TRANSITION].
sourcepub const WIDTH: Style<f32> = _
The style key of [Scroll.width::WIDTH].
diff --git a/search-index.js b/search-index.js
index a33426969..fc9524568 100644
--- a/search-index.js
+++ b/search-index.js
@@ -1,7 +1,7 @@
var searchIndex = new Map(JSON.parse('[\
-["ori",{"t":"CCCXCXFFGKGPPRFPPKPPPPPIPFNNNNOONNNNNNMNNNNNNNNMONNNNNNCCCCCQQQCCCCQCCCCQQCQGPGFFPFPPPFPPFFGGPPFPPPGPPPPFPPPPPFFPGPPPPGPPPPFPGGOONNNOONNNNNNNNNNNNNNOOOONNNNNNNNNNNNNNNNNNNNNNONONNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNONNHHHHHONNNNNNNNNNNNNNNOOONNNHHHHHHHHNOHHOONNNNNNNNNOOOONNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOFKMMFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFFFFFFNNNNNNNNNNNNNNNNNNNNNNPPPPPPPPPPPPPPPPPPPPPPFPGPPPPPPPPPPPPPPPPPPPPPPPGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFPPKPPPPPPGPPPPPPPPPPFPFPPPPPPPPPPPFPPPPPPPPPPPPPPPPPPPPPPPPPGFFPFPFPFPFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFPFPFPPPPPPONNNNNNNNNNNNOOONNNNNNNNNNNNNNNNNNNNNOOOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOONNNNNNNNNNNNMNOOOOOOOOOOOOOOOOONOONNNNNNNNNNNNNNNNNNNNNNNNOOOOOPFPFFGFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFGFGPPPPSPPGFFFFFFFPPPPPPFPNNONNNNONNNOOOOOONHOOONNNOOOOOOOOOKFFFKFFFKKCNNQQCNNMQMQQCMQNQMCNQQCNXCNCMQMNMMMNMCQQCQQNQQKFFMHHMFFFFHHHHFKFFFFFFKFKMHHMNMNNNNNNNKFFKNNNNFFSFFFFFFKFFFFFFMFFFFKNNNNMMMNMNMNMMNHHNHKYMPFPGFFPOOHOOOHOOOOOHOFPPPPPPPPPPFGGGGFFPPPPPPPPPPPPPGFFGPPPNNNNNNNNNNNNNONNNNNNNNNNNONNNOONNNNQNNNNNNNONOOONNNNNNNNNNNNOOPGPFOHOHTTIKITTTTTTTTTTFFFFRRFKFFKFNNHMNNNNNNNNNNNNNNNNNNNNNNNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNMMNNNMMMMMNNNNNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMMMNNNNHMMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFFFFFFFPGFFFFFFFFFFFFFIFFFFPFPFFFFFFFFFFFFFFFFFFOOHOOOOOOOOOOOOHOOOOOOHOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOHHHHOOHHOHHOOOOOOOOOOOOOOOHOHHOOOOOOOOOOOOOOOOOOOOOOOOOOOHOHOOHOHOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOHHHQHHHQHHOOOOOOOOOOOOHOOOOOOOOOOOOHHHHHHHOHHHOHHOOOOHHHOHOHHHHHOOOOOHOOOOOHHHHOHHOOOOOHOOOOOOHHOOOQHOHHHHHOHOOOOOOOOHHHHHOHHQHHHQHHHOOOOHHHHHHHOOOOOOHQPPPPPPPPPPGPPPPPPPPPPPPPPPPPPPPPFPPPPPPPPPPPPPPPFFGFGPPNNNNNNNNNNOOOONNNNNNNNNNNNOOONNNNOOOOOOOOOOOONNNNNNNNOOKTFTFTFKFFFKTKTNNNNNNNNNNNCNNNNNNNNNNNNNNNNNNNNNQQNNNNNNNNNNNCNNNNNNNNNNNNNNNMNQMNNNNNNNNQQCMNQNQMNCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQQNNNNNCNXNNNNNNNNNNNNNNNNNNNCNNNNCMNQNNNNNNNMNNNNNNNMMNNNMNNNMCQQCNNNNNNNQQNNNNNNNNNNNNNNNNNQQNKFFNNNNNNNNNNNNNNNNNNNNNNNNMNNHHNMNNNNNNNNFFFFNNNNNNNNNNHNNHHNNNNNHFNNNNNNNNNNNNNNNNNNNNNNKFFFFFFKFKMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNNNNNNNNNNNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKFFKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFSTTTTTFFFFTFFTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKFFFFFFMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFFFKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNMNMNNMNNNNNNNNNNNNNNNNNNNNNNNNMNNMNMNNNHHNNNNNNNNNNNNNNNNNNHPTTTTTTPFPPGFFPPPPFPKPFFGKPFGPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTPPPPPFPGFFTIPPYFFPPFFPTTTTTTTTTTTPFPPPPPPPFFPPPGFFFPPGPPFFFFFPPFPPPFFFPPPPPPPPGFPPTTTPPPFPPPPPPPFFPPTTPGPPPPPPPPPPPPGFFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTSTTTTTTTTTTTTTTTTTPPGPPFFPPFGGGGFFPPTPPPPPPPPPPPPPPPTTTTTTTTFFFPPPPPGPTPPPGPPPPPPPPPPFPPPPPTTTTTTTPPFPPTIPPTTTFFPTPPFPPPTTTTTPPPPPPPPPPPPPPPPPPPPPPPPPPPTTTTPFPPPTTTTTFFPPPPFFPPFPPPPFFFFPGFPFPFPFPFPPPPPPPPPPTTPPKYFFFPPPPTPPPPPTTTTTTPTTTTTTTTTPFPPFPPPPPPFPGPFPFFPPPFPPPPPPFPPPFRRPFGGFPGYFPFPPPPTTTTTTTTTPPPFPGFFFFGFFFTFFFPTTPPPPPPPPPFPPKKFPTTTTTTTTPPFFPPPGFFPFPTTPTTTPTTTTTTTFPPPPONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOHNNNNNNOOOOOOOOONNNNNNNOOONONNHNNNOOHNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNOOOOONHNNNNOOOOOOOOOOONONNNNONNNNNNOOOOOOOOOOOOOONNNNNOOOOOOOOOOOOOONNNNNNOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNOONHNOHNONNNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNOOOONONNNHNNNNHNONNNNNHNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHNNNNNNNNOOOOOOOOOOOOOOOOOHNOHNNNHNNHNNNNNNNNNNOOOOOOOOOOOOOOOOOOOOOONNNNNONONNOONNNNQNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOXNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNOHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOMNHNNNNNOONNNNNNNNHONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNONNOOOOOONNOOOOOONNOOOOOONNOOOOOOONNOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHNNNNOHNNNNNNNNOHHNHNHQHHHNHNHQHHNONOONOONNNNNNNNNOOOONNONNQNOQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNONNNNQNONNOONOHONOONNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNHNOOMNNNNNNOONNNNNOONNOOOOOONHNNNNNNNNNNNNNOONNONNNOONNHNHNNHNNOHONNNOONNHNHNNHNNONNXOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNHNHNHNHNHNHNHNHHHNOHHNNNOOONOHHHNOHNONNONNNHHHHHNOOOOOHNNONOOHNNNNNNNOOOOONNNNNNNONNNNNNNNNNNNNNNNNNNNNHNNNNNNNNNONNONNMMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOMNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHNHNNHNOOHNHNNNNNNNNONHNNONNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNOONNNHNNNNNNNNNNNNOOOOOONOHNOONONNNNNNOONCNOQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOHONHNNNOOOOQHNNONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHNOONHNOHNOQHNNNNNOONNHNNNOOOOOOOOHHHHNNNNOHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNONNNNNNNNNNNOHHQHHHQHHNQONNNXHNNNNNOOOOOONNNNNNONNNNNNNNNNNHHHHHHHNNOOOOOOOOOOOOOOHQPFPGFFPOOHOOOHOOOOOHO","n":["app","core","log","main","prelude","reloadable","App","AppBuilder","AppCommand","AppDelegate","AppRequest","CloseWindow","CloseWindow","Data","DelegateCx","DragWindow","DragWindow","IntoUiBuilder","OpenWindow","OpenWindow","Quit","Quit","RequestRedraw","UiBuilder","UpdateWindow","WindowRenderState","borrow","borrow","borrow_mut","borrow_mut","canvas","clear_color","deref","deref","deref_mut","deref_mut","drop","drop","event","from","from","idle","init","init","init","into","into","into_ui_builder","logical_size","try_from","try_from","try_into","try_into","type_id","type_id","canvas","clipboard","command","context","event","format_text","hstack","hwrap","image","layout","rebuild","style","style","text","transition","view","views","vstack","vwrap","window","zstack","AntiAlias","Bevel","BlendMode","BorderRadius","BorderWidth","Butt","Canvas","Clear","Close","Close","Color","Cubic","Cubic","Curve","CurveIter","CurveSegment","CurveVerb","Destination","DestinationOver","DisplayHex","EvenOdd","Fast","Fill","FillRule","Full","Layer","Line","Line","Mask","Miter","Move","Move","NonZero","None","Paint","Pattern","Pattern","Primitive","Quad","Quad","Round","Round","Shader","Solid","Source","SourceOver","Square","Stroke","Stroke","StrokeCap","StrokeJoin","a","anti_alias","as_ref","as_str","as_str_with_alpha","b","blend","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom_left","bottom_right","cap","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","color","count","curve","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","eq","fill","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","g","hash","hash","hex","hsl","hsla","hsv","hsva","image","init","init","init","init","init","init","init","into","into","into","into","into","into","into","into_iter","join","left","miter","new","new","next","okhsl","okhsla","okhsv","okhsva","oklab","oklaba","oklch","oklcha","points","r","rgb","rgba","right","shader","size_hint","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_smolstr","to_string","top","top_left","top_right","transform","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","width","curve","curve","fill","mask","paint","paint","primitives","stroke","transform","view","Clipboard","ClipboardBackend","get_text","set_text","Command","CommandProxy","CommandReceiver","CommandWaker","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","clone","clone_into","clone_to_uninit","deref","deref","deref","deref_mut","deref_mut","deref_mut","drop","drop","drop","fmt","fmt","fmt","from","from","from","from","get","init","init","init","into","into","into","is","name","new","new","to_any","to_owned","try_from","try_from","try_from","try_into","try_into","try_into","try_recv","type_id","type_id","type_id","wake","BaseCx","BuildCx","Contexts","DrawCx","EventCx","LayoutCx","RebuildCx","borrow","borrow_mut","contains","default","deref","deref_mut","drop","fmt","from","get","get_mut","get_or_default","init","insert","into","is_empty","len","new","remove","try_from","try_into","type_id","A","Accept","Again","Alphanumeric","Alt","AltGraph","Animate","Apostrophe","B","Back","Backslash","Backspace","Backspace","Backtick","BracketLeft","BracketRight","C","Cancel","CapsLock","CapsLock","Character","Clear","CloseRequested","CloseRequested","Code","CodeInput","Comma","Command","Compose","Control","Convert","Copy","Cut","D","Dead","Delete","Delete","Down","Down","E","Eisu","End","End","Enter","Enter","Equal","Escape","Escape","Event","Execute","F","F1","F1","F10","F10","F11","F11","F12","F12","F13","F14","F15","F16","F17","F18","F19","F2","F2","F20","F21","F22","F23","F24","F3","F3","F4","F4","F5","F5","F6","F6","F7","F7","F8","F8","F9","F9","Find","Fn","FnLock","Forward","G","H","HangulMode","HanjaMode","Hankaku","Help","Hiragana","HiraganaKatakana","Home","Home","Hyper","I","Ime","Insert","Insert","IsKey","J","JunjaMode","K","KanaMode","KanjiMode","Katakana","Key","Key0","Key1","Key2","Key3","Key4","Key5","Key6","Key7","Key8","Key9","KeyPressed","KeyPressed","KeyReleased","KeyReleased","L","LAlt","LCtrl","LMeta","LShift","Left","Left","M","Meta","Minus","Modifiers","N","NumLock","NumLock","NumStar","Numpad0","Numpad1","Numpad2","Numpad3","Numpad4","Numpad5","Numpad6","Numpad7","Numpad8","Numpad9","O","Other","P","PageDown","PageDown","PageUp","PageUp","Paste","Pause","Period","Play","PointerButton","PointerId","PointerLeft","PointerLeft","PointerMoved","PointerMoved","PointerPressed","PointerPressed","PointerReleased","PointerReleased","PointerScrolled","PointerScrolled","Primary","PrintScreen","Q","R","RAlt","RCtrl","RMeta","RShift","Redo","Right","Right","Romaji","S","ScrollLock","ScrollLock","Secondary","Select","Semicolon","Shift","Slash","Space","Space","Super","Symbol","SymbolLock","T","Tab","Tab","Tertiary","U","Undo","Unidentified","Up","Up","Update","V","W","WindowMaximized","WindowMaximized","WindowResized","WindowResized","WindowScaled","WindowScaled","X","Y","Z","Zenkaku","ZenkakuHankaku","alt","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","button","button","clicked","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","code","code","compose","ctrl","default","delta","delta","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","hash","hash","hash","hash","height","id","id","id","id","id","init","init","init","init","init","init","into","into","into","into","into","into","is","is_key","key","key","maximized","meta","modifiers","modifiers","modifiers","modifiers","modifiers","modifiers","position","position","position","position","scale_factor","selection","shift","size","text","text","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","width","window","window","window","window","Backend","Image","Image","ImageData","ImageId","Texture","TextureId","WeakImage","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","default","default","deref","deref","deref","deref_mut","deref_mut","deref_mut","drop","drop","drop","eq","eq","eq","fmt","fmt","fmt","from","from","from","from","from","from_index","hash","hash","id","init","init","init","into","into","into","new","strong_count","to_index","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_into","try_into","try_into","type_id","type_id","type_id","weak_count","Affine","Align","Alignment","Axis","Center","Center","End","End","FILL","Fill","Horizontal","Justify","JustifyIterator","Matrix","Padding","Point","Rect","Size","Space","SpaceAround","SpaceBetween","SpaceEvenly","Start","Start","Stretch","Vector","Vertical","borrow","borrow_mut","bottom","deref","deref_mut","drop","from","height","init","into","into_iter","left","matrix","max","max","min","min","next","pt","right","top","translation","try_from","try_into","type_id","width","x","x","x","x","y","y","y","y","Callsite","Dispatch","Event","Id","Instrument","Level","Metadata","Span","Subscriber","Value","callsite","clone_span","current_span","debug","debug_span","dispatcher","downcast_raw","drop_span","enabled","enabled","enter","error","error_span","event","event","event","event_enabled","event_enabled","exit","field","in_current_span","info","info_span","instrument","instrument","instrument","level_filters","max_level_hint","metadata","metadata","metadata","new_span","on_register_dispatch","record","record","record_follows_from","register_callsite","set_interest","span","span","span_enabled","subscriber","trace","trace_span","try_close","warn","warn_span","Callsite","DefaultCallsite","Identifier","metadata","rebuild_interest_cache","register","set_interest","DefaultGuard","Dispatch","SetGlobalDefaultError","WeakDispatch","get_default","set_default","set_global_default","with_default","Event","AsField","DebugValue","DisplayValue","Empty","Field","FieldSet","Iter","Value","ValueSet","Visit","as_field","debug","display","record","record_bool","record_debug","record_error","record_f64","record_i128","record_i64","record_str","record_u128","record_u64","Instrument","Instrumented","WithDispatch","WithSubscriber","in_current_span","instrument","with_current_subscriber","with_subscriber","LevelFilter","ParseLevelFilterError","STATIC_MAX_LEVEL","Kind","Level","LevelFilter","Metadata","ParseLevelError","ParseLevelFilterError","AsId","Attributes","Entered","EnteredSpan","Id","Record","Span","as_id","DefaultGuard","Interest","NoSubscriber","SetGlobalDefaultError","Subscriber","clone_span","current_span","downcast_raw","drop_span","enabled","enter","event","event_enabled","exit","max_level_hint","new_span","on_register_dispatch","record","record_follows_from","register_callsite","set_default","set_global_default","try_close","with_default","Rebuild","Rebuild","rebuild","Computed","Style","Style","Styled","Styles","Theme","Value","accent","background","comp","contrast","danger","info","key","outline","primary","secondary","success","surface","val","warning","AtlasGlyph","Bundle","Center","Condensed","Cursive","Data","End","Expanded","ExtraCondensed","ExtraExpanded","Fantasy","FontAtlas","FontFamily","FontSource","FontStretch","FontStyle","FontWeight","Fonts","Italic","Monospace","Name","None","Normal","Normal","Oblique","Path","SansSerif","SemiCondensed","SemiExpanded","Serif","Start","TextAlign","TextAttributes","TextBuffer","TextWrap","UltraCondensed","UltraExpanded","Word","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","curve_cache","default","deref","deref","deref","deref_mut","deref_mut","deref_mut","drop","drop","drop","eq","family","fmt","fmt","fmt","font_atlas","font_system","from","from","from","image","include_font","init","init","init","insert","into","into","into","layout","new","stretch","style","swash_cache","to_cosmic_text","to_owned","to_owned","try_from","try_from","try_from","try_into","try_into","try_into","type_id","type_id","type_id","uv","weight","Ease","Easing","Linear","Transition","duration","ease","easing","linear","ACTIVE","ANIMATE","AnyState","AnyView","BoxedView","DRAW","FOCUSABLE","FOCUSED","HAS","HAS_ACTIVE","HAS_FOCUSED","HAS_HOT","HOT","IS","LAYOUT","Pod","PodSeq","SeqState","State","State","State","Update","View","ViewFlags","ViewId","ViewSeq","ViewState","all","all","any","as_any","as_u64","bitand","bitand","bitand_assign","bitand_assign","bitor","bitor","bitor_assign","bitor_assign","bits","bits","bits","bits","bitxor","bitxor","bitxor_assign","bitxor_assign","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","build","build","clone","clone","clone","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmp","complement","complement","contains","contains","default","default","default","deref","deref","deref","deref_mut","deref_mut","deref_mut","difference","difference","draw","draw_nth","drop","drop","drop","dyn_build","dyn_draw","dyn_event","dyn_layout","dyn_rebuild","empty","empty","eq","eq","eq","event","event_nth","extend","extend","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from_bits","from_bits","from_bits_retain","from_bits_retain","from_bits_retain","from_bits_retain","from_bits_truncate","from_bits_truncate","from_iter","from_iter","from_name","from_name","hash","hash","hash","init","init","init","insert","insert","intersection","intersection","intersects","intersects","into","into","into","into_iter","into_iter","is_all","is_all","is_empty","is_empty","iter","iter","iter_names","iter_names","layout","layout_nth","len","new","not","not","partial_cmp","pod","rebuild","rebuild","rebuild_nth","remove","remove","set","set","sub","sub","sub_assign","sub_assign","symmetric_difference","symmetric_difference","to_owned","to_owned","to_owned","to_smolstr","to_string","toggle","toggle","try_from","try_from","try_from","try_into","try_into","try_into","type_id","type_id","type_id","union","union","Aligned","Animate","Aspect","BuildHandler","Button","ButtonStyle","Checkbox","CheckboxStyle","Click","ClickEvent","Clickable","Collapsing","CollapsingStyle","ColorPicker","ColorPickerStyle","Constrain","Container","ContainerStyle","DrawHandler","EventHandler","Flex","Flexible","Focus","Lens","Memo","Opaque","Pad","Painter","Press","RebuildHandler","Release","Scroll","ScrollStyle","Slider","SliderStyle","Stack","Suspense","Text","TextInput","TextInputStyle","TextStyle","Tooltip","TooltipStyle","Transform","Trigger","WithState","WithStyle","Wrap","ZStack","after","after","align","align","align","align","align","align","align","align","align","alignment","alpha_color","alpha_color","amount","animate","animate","aspect","axis","axis","axis","axis","background","background","background","background","background","background","background","background","background","background","background","before","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","bottom","bottom_left","bottom_right","button","button","callback","center","checkbox","checked","circle","collapsing","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color_picker","column_gap","constrain","container","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","default_open","delay","delay","descendants","draw","ellipse","event","expand","fancy","fancy","flex","flex","focus","font_family","font_family","font_family","font_family","font_family","font_family","font_size","font_size","font_size","font_size","font_size","font_size","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_style","font_style","font_style","font_style","font_style","font_style","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","gap","header","height","hscroll","hstack","hstack","hstack_any","hstack_vec","hwrap","hwrap","hwrap_any","hwrap_vec","icon_color","icon_color","icon_size","icon_size","inset","inset","is_tight","justify","justify","justify_cross","knob_color","knob_color","left","length","length","lightness_color","lightness_color","line_height","line_height","line_height","line_height","line_height","line_height","mask","mask","max_height","max_size","max_width","memo","min_height","min_size","min_width","multiline","on_build","on_click","on_draw","on_draw","on_event","on_event_before","on_input","on_input","on_input","on_open","on_press","on_rebuild","on_release","on_submit","opaque","open","pad","pad_bottom","pad_left","pad_right","pad_top","padding","padding","padding","padding","padding","painter","placeholder","placeholder_color","placeholder_color","range","rebuild","rect","right","rotate","rotate_degrees","row_gap","scale","size","size","size","size","size","size","slider","slider_width","slider_width","space","stroke","stroke","style","suspense","text","text","text","text","text","text_input","tight","tooltip","top","top_left","top_right","transform","transform","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition_active","transition_focused","transition_hot","translate","trigger","value","vscroll","vstack","vstack","vstack_any","vstack_vec","vwrap","vwrap","vwrap_any","vwrap_vec","width","width","width","width","width","with_data","with_data_default","with_state","with_state_default","with_style","without_data","without_state","wrap","wrap","wrap","wrap","wrap","wrap","zstack","zstack","Alias","AllScroll","Arrow","Cell","ColResize","Color","Content","ContextMenu","Copy","Crosshair","Cursor","Cursor","Decorated","Default","EResize","EwResize","Fixed","Grab","Grabbing","Help","Icon","Ime","Maximized","Move","NResize","NeResize","NeswResize","NoDrop","NotAllowed","NsResize","NwResize","NwseResize","Pointer","Pointer","Progress","Resizable","RowResize","SResize","Scale","SeResize","Size","SwResize","Text","Title","VerticalText","Visible","WResize","Wait","Window","WindowId","WindowSizing","WindowSnapshot","WindowUpdate","ZoomIn","ZoomOut","borrow","borrow","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","color","color","decorated","decorated","deref","deref","deref_mut","deref_mut","difference","drop","drop","eq","fmt","fmt","from","from","hovering","icon","icon","init","init","into","into","maximized","maximized","position","resizable","resizable","scale","scale","size","size","sizing","title","title","to_owned","to_owned","try_from","try_from","try_into","try_into","type_id","type_id","visible","visible","Callsite","DEBUG","Dispatch","ERROR","Event","INFO","Id","Instrument","Level","Metadata","Span","Subscriber","TRACE","Value","WARN","as_str","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","callsite","callsite","child_of","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_span","clone_span","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmp","current","current_span","current_span","debug","debug_span","default","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","dispatcher","downcast_raw","downcast_ref","downcast_ref","downcast_ref","downcast_ref","downcast_ref","downgrade","drop","drop","drop","drop","drop","drop","drop_span","drop_span","enabled","enabled","enabled","enter","enter","enter","entered","eq","eq","eq","eq","eq","error","error_span","event","event","event","event","event_enabled","event_enabled","exit","exit","field","field","fields","file","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","follows_from","from","from","from","from","from","from","from_non_zero_u64","from_str","from_u64","ge","ge","gt","gt","has_field","hash","hash","hash","id","in_current_span","in_scope","info","info_span","init","init","init","init","init","instrument","instrument","instrument","into","into","into","into","into","into_non_zero_u64","into_u64","is","is","is","is","is","is_disabled","is_event","is_none","is_span","le","le","level","level_filters","line","lt","lt","max_level_hint","metadata","metadata","metadata","metadata","module_path","name","new","new","new","new_disabled","new_root","new_span","new_span","none","none","on_register_dispatch","or_current","partial_cmp","partial_cmp","record","record","record","record","record_all","record_follows_from","record_follows_from","register_callsite","register_callsite","set_interest","span","span","span_enabled","subscriber","target","to_owned","to_owned","to_owned","to_owned","to_smolstr","to_string","trace","trace_span","try_close","try_close","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","warn","warn_span","with_subscriber","Callsite","DefaultCallsite","Identifier","borrow","borrow","borrow_mut","borrow_mut","clone","clone_into","clone_to_uninit","deref","deref","deref_mut","deref_mut","drop","drop","eq","fmt","fmt","from","from","hash","init","init","interest","into","into","metadata","metadata","new","rebuild_interest_cache","register","register","set_interest","set_interest","to_owned","try_from","try_from","try_into","try_into","type_id","type_id","DefaultGuard","Dispatch","SetGlobalDefaultError","WeakDispatch","borrow","borrow_mut","clone","clone_into","clone_to_uninit","deref","deref_mut","drop","fmt","from","get_default","init","into","set_default","set_global_default","to_owned","try_from","try_into","type_id","upgrade","with_default","Event","borrow","borrow_mut","child_of","deref","deref_mut","dispatch","drop","fields","fmt","from","init","into","is_contextual","is_root","metadata","new","new_child_of","parent","record","try_from","try_into","type_id","AsField","DebugValue","DisplayValue","Empty","Field","FieldSet","Iter","Value","ValueSet","Visit","as_field","as_field","as_field","as_ref","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","callsite","callsite","clone","clone","clone","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","contains","debug","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","display","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","field","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","hash","init","init","init","init","init","init","init","into","into","into","into","into","into","into","into_iter","into_iter","is_empty","is_empty","iter","len","len","name","new","next","par_bridge","record","record","record","record","record","record_bool","record_debug","record_error","record_f64","record_i128","record_i64","record_str","record_u128","record_u64","to_owned","to_owned","to_owned","to_smolstr","to_smolstr","to_smolstr","to_smolstr","to_string","to_string","to_string","to_string","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","Instrument","Instrumented","WithDispatch","WithSubscriber","borrow","borrow","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","deref","deref","deref_mut","deref_mut","dispatcher","drop","drop","drop","fmt","fmt","from","from","in_current_span","init","init","inner","inner","inner_mut","inner_mut","inner_pin_mut","inner_pin_mut","inner_pin_ref","inner_pin_ref","instrument","into","into","into_future","into_future","into_inner","into_inner","poll","poll","span","span_mut","to_owned","to_owned","try_from","try_from","try_into","try_into","type_id","type_id","with_current_subscriber","with_subscriber","LevelFilter","ParseLevelFilterError","STATIC_MAX_LEVEL","DEBUG","ERROR","EVENT","HINT","INFO","Kind","Level","LevelFilter","Metadata","OFF","ParseLevelError","ParseLevelFilterError","SPAN","TRACE","WARN","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmp","current","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","eq","eq","eq","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from_level","from_str","ge","ge","gt","gt","hash","hint","init","init","init","init","into","into","into","into","into_level","is_event","is_hint","is_span","le","le","lt","lt","partial_cmp","partial_cmp","to_owned","to_owned","to_owned","to_smolstr","to_smolstr","to_smolstr","to_string","to_string","to_string","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","AsId","Attributes","Entered","EnteredSpan","Id","Record","Span","as_id","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","child_of","contains","contains","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","drop","drop","exit","fields","fmt","fmt","fmt","fmt","from","from","from","from","id","init","init","init","init","into","into","into","into","is_contextual","is_empty","is_empty","is_root","len","metadata","new","new","new_root","parent","record","record","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","values","DefaultGuard","Interest","NoSubscriber","SetGlobalDefaultError","Subscriber","always","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_span","clone_to_uninit","clone_to_uninit","clone_to_uninit","current_span","default","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","downcast_raw","drop","drop","drop","drop","drop","drop_span","enabled","enabled","enter","enter","event","event","event_enabled","exit","exit","fmt","fmt","fmt","fmt","fmt","from","from","from","from","init","init","init","init","into","into","into","into","is_always","is_never","is_sometimes","max_level_hint","never","new","new_span","new_span","on_register_dispatch","record","record","record_follows_from","record_follows_from","register_callsite","register_callsite","set_default","set_global_default","sometimes","to_owned","to_owned","to_smolstr","to_string","try_close","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","with_default","A","ACCENT","ACCENT_LOW","ALIGN","ALIGN","ALIGN","ALPHA_COLOR","Accept","Affine","Again","Alias","Align","Aligned","Alignment","AllScroll","Alphanumeric","Alt","AltGraph","Animate","Animate","AnyView","Apostrophe","App","AppBuilder","AppCommand","AppDelegate","Arrow","Aspect","Axis","B","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BLACK","BLACK","BLUE","BOLD","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BOTTOM","BOTTOM_LEFT","BOTTOM_RIGHT","Back","Backslash","Backspace","Backspace","Backtick","BaseCx","Bevel","BlendMode","BorderRadius","BorderWidth","Bottom","BoxedView","BracketLeft","BracketRight","Build","BuildCx","BuildHandler","Bundle","Butt","Button","ButtonStyle","C","CENTER","COLOR","COLOR","COLOR","COLOR","COLOR","COLOR","COLOR","CONTRAST","CONTRAST_LOW","CYAN","Cancel","Canvas","CapsLock","CapsLock","Cell","Center","Center","Center","Character","Checkbox","CheckboxStyle","Clear","Clear","Click","ClickEvent","Clickable","Clipboard","CloseRequested","CloseRequested","CloseWindow","Code","CodeInput","ColResize","Collapsing","CollapsingStyle","Color","ColorPicker","ColorPickerStyle","Comma","Command","CommandProxy","Compose","Computed","Condensed","Constrain","Container","ContainerStyle","Content","ContextMenu","Control","Convert","Copy","Copy","Crosshair","Cursive","Cursor","Curve","Cut","D","DANGER","DANGER_LOW","DELAY","Data","Dead","Default","DelegateCx","Delete","Delete","Destination","DestinationOver","Down","Down","DragWindow","DrawCx","DrawHandler","E","EResize","EXTRA_BOLD","EXTRA_LIGHT","Ease","Easing","Eisu","End","End","End","End","End","Enter","Enter","Equal","Escape","Escape","EvenOdd","Event","EventCx","EventHandler","EwResize","Execute","Expanded","ExtraCondensed","ExtraExpanded","F","F1","F1","F10","F10","F11","F11","F12","F12","F13","F14","F15","F16","F17","F18","F19","F2","F2","F20","F21","F22","F23","F24","F3","F3","F4","F4","F5","F5","F6","F6","F7","F7","F8","F8","F9","F9","FANCY","FILL","FILL","FILL","FONT_FAMILY","FONT_FAMILY","FONT_FAMILY","FONT_SIZE","FONT_SIZE","FONT_SIZE","FONT_STRETCH","FONT_STRETCH","FONT_STRETCH","FONT_STYLE","FONT_STYLE","FONT_STYLE","FONT_WEIGHT","FONT_WEIGHT","FONT_WEIGHT","Fantasy","Fill","FillRule","Find","Fixed","Flex","Flexible","Fn","FnLock","Focus","FontFamily","FontSource","FontStretch","FontStyle","FontWeight","Fonts","Forward","G","GREEN","Grab","Grabbing","H","HangulMode","HanjaMode","Hankaku","Help","Help","Hiragana","HiraganaKatakana","Home","Home","Horizontal","Hyper","I","ICON_COLOR","ICON_SIZE","IDENTITY","IDENTITY","INFINITY","INFO","INFO_LOW","INSET","Image","ImageData","ImageId","Insert","Insert","Italic","J","JunjaMode","Justify","K","KNOB_COLOR","KanaMode","KanjiMode","Katakana","Key","Key0","Key1","Key2","Key3","Key4","Key5","Key6","Key7","Key8","Key9","KeyPressed","KeyPressed","KeyReleased","L","LAlt","LCtrl","LEFT","LENGTH","LIGHT","LIGHTNESS_COLOR","LINE_HEIGHT","LINE_HEIGHT","LINE_HEIGHT","LMeta","LShift","LayoutCx","Left","Left","Left","Lens","Linear","M","MAGENTA","MASK","MEDIUM","Matrix","Memo","Meta","Middle","Minus","Miter","Modifiers","Monospace","Move","N","NEG_X","NEG_X","NEG_Y","NEG_Y","NORMAL","NResize","Name","NeResize","NeswResize","NoDrop","NonZero","None","Normal","Normal","NotAllowed","NsResize","NumLock","NumLock","NumStar","Numpad0","Numpad1","Numpad2","Numpad3","Numpad4","Numpad5","Numpad6","Numpad7","Numpad8","Numpad9","NwResize","NwseResize","O","ONE","ONE","OUTLINE","OUTLINE_LOW","Oblique","Opaque","OpenWindow","Other","P","PADDING","PADDING","PLACEHOLDER_COLOR","PRIMARY","PRIMARY_LOW","Pad","Padding","PageDown","PageDown","PageUp","PageUp","Paint","Painter","Paste","Path","Pattern","Pattern","Pause","Period","Play","Pod","PodSeq","Point","Pointer","Pointer","PointerButton","PointerId","PointerLeft","PointerMoved","PointerMoved","PointerPressed","PointerPressed","PointerReleased","PointerReleased","PointerScrolled","PointerScrolled","Press","Primary","PrintScreen","Progress","Q","Quit","R","RAlt","RCtrl","RED","RIGHT","RMeta","RShift","Rebuild","Rebuild","RebuildCx","RebuildHandler","Rect","Redo","Release","Right","Right","Right","Romaji","Round","Round","RowResize","S","SECONDARY","SECONDARY_LOW","SEMI_BOLD","SIZE","SIZE","SLIDER_WIDTH","SResize","STROKE","SUCCESS","SUCCESS_LOW","SURFACE","SURFACE_HIGH","SURFACE_HIGHER","SURFACE_HIGHEST","SURFACE_LOW","SURFACE_LOWER","SansSerif","Scroll","ScrollLock","ScrollLock","ScrollStyle","SeResize","Secondary","Select","SemiCondensed","SemiExpanded","Semicolon","SeqState","Serif","Shader","Shift","Size","Slash","Slider","SliderStyle","Solid","Source","SourceOver","Space","Space","Space","SpaceAround","SpaceBetween","SpaceEvenly","Square","Stack","Start","Start","Start","State","State","State","Stretch","Stroke","StrokeCap","StrokeJoin","Style","Style","Styled","Styled","Styles","Super","Suspense","SwResize","Symbol","SymbolLock","T","THIN","TOP","TOP_LEFT","TOP_RIGHT","TRANSITION","TRANSITION","TRANSITION","TRANSITION","TRANSPARENT","Tab","Tab","Tertiary","Text","Text","TextAlign","TextBuffer","TextInput","TextInputStyle","TextStyle","TextWrap","Theme","Tooltip","TooltipStyle","Top","Transform","Transition","Trigger","U","UNBOUNDED","UNBOUNDED","UltraCondensed","UltraExpanded","Undo","Unidentified","Up","Up","Update","V","Value","Vector","Vertical","VerticalText","View","ViewSeq","ViewState","W","WARNING","WARNING_LOW","WHITE","WIDTH","WIDTH","WRAP","WRAP","WRAP","WResize","Wait","Window","WindowId","WindowMaximized","WindowResized","WindowScaled","WindowSizing","WithState","WithStyle","Word","Wrap","X","X","X","Y","Y","Y","YELLOW","Z","ZERO","ZERO","ZERO","ZERO","ZERO","ZERO","ZERO","ZStack","Zenkaku","ZenkakuHankaku","ZoomIn","ZoomOut","a","a8","accent","active_changed","add","add","add","add","add","add","add","add","add","add","add","add","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_context","add_window","after","after","after","after","align","align","align","align","align","align","align","align","align","align","align","align","align","align","align","alignment","all","all","all","all","all","all","alpha_color","alpha_color","alpha_color","alt","amount","amount","angle","angle_between","animate","animate","animate","animate","animate","anti_alias","any","any","any","any","any_horizontal","any_vertical","area","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_build_cx","as_build_cx","as_char","as_fontdb","as_layout_cx","as_mut","as_rebuild_cx","as_ref","as_u64","aspect","axis","axis","axis","axis","axis","axis","axis","b","b8","background","background","background","background","background","background","background","background","background","background","background","background","background","background","background","background","before","before","bitand","bitand","bitand_assign","bitand_assign","blend","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom","bottom","bottom","bottom_center","bottom_left","bottom_left","bottom_left","bottom_right","bottom_right","bottom_right","bounds","bounds","buffer_size","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","button","button","button","button","button","callback","canvas","cap","ceil","ceil","ceil","center","center","center_left","center_right","center_size","checkbox","checked","checked","child","child","child","child","child","circle","circle","clamp","clamp","clamp","clamp","clear","clear","clicked","clipboard","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","close","close_requested","close_window","cmd","cmd","cmd","cmd_async","cmd_async","cmd_silent","code","collapsing","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color_picker","column_gap","column_gap","comp","complete","compute_id","conic_to","constrain","constrain","contain","container","contains","contains","contains_context","contains_property","contains_property","contains_property","contains_property","contains_property","contains_property","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","context","context_mut","context_or_default","contexts","contexts_mut","contrast","cross","ctrl","cubic_to","cursor","curve_cache","danger","dark","darken","data","data_mut","debug","decorated","decorated","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default_open","default_open","delay","delay","delegate","delta","delta","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","desaturate","descendants","descendants","desktop","determinant","distance","div","div","div","div","div","div","div","div","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","dot","downgrade","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw_buffer","draw_canvas","draw_canvas","draw_nth","draw_nth","draw_window","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","duration","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","ease","ease","easing","ellipse","ellipse","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","error","evaluate","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event_nth","event_nth","expand","expand","extend","fade","fallback","fancy","fancy","fancy","fill","fill","fill_rect","filter","finite_or_zero","fit","fit_content","flags","flex","flex","floor","floor","floor","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","focus","focused_changed","font","font_atlas","font_family","font_family","font_family","font_family","font_family","font_family","font_family","font_family","font_size","font_size","font_size","font_size","font_size","font_size","font_size","font_size","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_style","font_style","font_style","font_style","font_style","font_style","font_style","font_style","font_system","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","fonts","fract","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from_angle","from_angle","from_hash","from_linux_scancode","from_raw","from_scale","from_size","from_u16","from_u64","g","g8","gap","gap","gap","get","get","get","get","get_context","get_context_mut","get_or","get_or","get_or_else","get_or_else","get_pixel","get_pointer","get_pointer_mut","get_property","get_property","get_property","get_property","get_property","get_property","get_property_mut","get_property_mut","get_property_mut","get_property_mut","get_property_mut","get_property_mut","get_window","get_window_mut","grayscale","had_active","had_focused","had_hot","handle_commands","has_active","has_active","has_active","has_active","has_active","has_active","has_active","has_active_changed","has_focused","has_focused","has_focused","has_focused","has_focused","has_focused","has_focused_changed","has_hot","has_hot","has_hot","has_hot","has_hot","has_hot","has_hot_changed","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hat","header","height","height","height","height","height","height","hex","hex","horizontal","horizontal","horizontal_any","horizontal_vec","hot_changed","hoverable","hoverable","hovering","hscroll","hsl","hsl","hsla","hsla","hstack","hstack","hstack_any","hstack_vec","hsv","hsv","hsva","hsva","hwrap","hwrap","hwrap_any","hwrap_vec","icon","icon","icon_color","icon_color","icon_color","icon_size","icon_size","icon_size","id","id","id","id","id","id","id","id","id","id","id","id","id","idle","idle","image","ime","include","include_font","inflate","info","info","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","insert","insert_context","insert_property","insert_property","insert_property","insert_property","insert_property","insert_property","insert_style","insert_style_keys","insert_value","inset","inset","intersection","intersects","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into_iter","inverse","inverse","is","is","is_active","is_active","is_active","is_active","is_active","is_active","is_closed","is_cmd","is_desktop","is_empty","is_empty","is_empty","is_empty","is_finite","is_finite","is_finite","is_focusable","is_focused","is_focused","is_focused","is_focused","is_focused","is_focused","is_hot","is_hot","is_hot","is_hot","is_hot","is_hot","is_hovered","is_infinite","is_infinite","is_infinite","is_key","is_key_pressed","is_key_released","is_mobile","is_nan","is_pointer_held","is_pressed","is_tight","is_translucent","is_transparent","is_valid","is_visible","is_web","iter","join","justify","justify","justify","justify","justify_cross","justify_cross","key","key","keyboard_key","knob_color","knob_color","last_point","layer","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout_nth","layout_nth","left","left","left","left","len","len","len","len","len","length","length","length","length","length_squared","lerp","light","lighten","lightness_color","lightness_color","lightness_color","line_height","line_height","line_height","line_height","line_height","line_height","line_height","line_height","line_to","linear","linear","load_font","local","loosen","loosen_height","loosen_width","luminocity","major","mark_animated","mark_drawn","mark_layed_out","marker","mask","mask","mask","masked","masked","matrix","max","max","max","max","max","max_element","max_element","max_height","max_height","max_size","max_size","max_size","max_width","max_width","maximized","maximized","memo","meta","min","min","min","min","min","min_element","min_element","min_height","min_height","min_size","min_size","min_size","min_width","min_width","minor","miter","mix","mix_rgb","mobile","modifiers","modifiers","modifiers","modifiers","modifiers","modifiers_changed","modify","move_pointer","move_to","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","multiline","multiline","multiply_alpha","name","needs_animate","needs_draw","needs_layout","neg","neg","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","normalize","offset","offset","okhsl","okhsl","okhsla","okhsla","okhsv","okhsv","okhsva","okhsva","oklab","oklab","oklaba","oklaba","oklch","oklch","oklcha","oklcha","on_build","on_click","on_draw","on_draw","on_draw","on_event","on_event_before","on_input","on_input","on_input","on_input","on_input","on_input","on_open","on_open","on_press","on_rebuild","on_release","on_submit","on_submit","opaque","open","open","open_window","open_window","outline","overlay","overlay","pack","pad","pad_bottom","pad_left","pad_right","pad_top","padding","padding","padding","padding","padding","padding","painter","physical_size","placeholder","placeholder","placeholder_color","placeholder_color","placeholder_color","pod","pointer_button","pointer_left","pointer_moved","pointer_scrolled","pointers","pointers_mut","points","position","position","position","position","position","premultiplied","prepare","prepare_buffer","prepare_text","prepare_text_raw","press","press_pointer","primary","primitives","propagate","property_or","property_or","property_or","property_or","property_or","property_or","property_or_default","property_or_default","property_or_default","property_or_default","property_or_default","property_or_default","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","proxy","pt","push","push","push_oval","push_rect","push_rect_with_borders","push_rect_with_radius","quad","quad_to","quit","r","r8","range","range","raw","raw_mut","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild_nth","rebuild_nth","rect","rect","rect","rect","rect","rect","rect","rect","release","release_pointer","rem","rem","rem","rem","rem","rem","rem","rem","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","remove_context","remove_pointer","remove_property","remove_property","remove_property","remove_property","remove_property","remove_property","remove_window","request_animate","request_draw","request_layout","resizable","resizable","rgb","rgb","rgba","rgba","rgba8","right","right","right","right","rotate","rotate","rotate_degrees","rotated","rotated","round","round","round","round","round","row_gap","row_gap","saturate","scale","scale","scale","scale","scaled","scaled","secondary","set","set_active","set_active","set_active","set_active","set_align","set_bounds","set_cursor","set_cursor","set_cursor","set_cursor","set_filter","set_focusable","set_focused","set_focused","set_focused","set_focused","set_hot","set_hot","set_hot","set_hot","set_ime","set_ime","set_metrics","set_pixel","set_size","set_text","set_transform","set_wrap","shader","shift","shrink","shrink","signum","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","sizing","sizing","slider","slider_width","slider_width","slider_width","snapshot","space","spawn_async","spawn_async","step","stroke","stroke","stroke","stroke","stroke","stroke_curve","style","style","style","style","styled","styled","styled","styled","styled","styled","styled","styled","styled","styled","styles","styles","styles","styles","styles","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","success","surface","suspense","swash_cache","take_requests","text","text","text","text","text","text","text","text","text","text_input","text_raw","theme","tight","title","title","to_cosmic_text","to_cosmic_text","to_fontdb","to_fontdb","to_fontdb","to_hex","to_hsl","to_hsla","to_hsv","to_hsva","to_okhsl","to_okhsla","to_okhsv","to_okhsva","to_oklab","to_oklaba","to_oklch","to_oklcha","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_point","to_point","to_rgba8","to_size","to_size","to_smolstr","to_smolstr","to_smolstr","to_smolstr","to_smolstr","to_srgb","to_string","to_string","to_string","to_string","to_string","to_vector","to_vector","tooltip","top","top","top","top","top_center","top_left","top_left","top_left","top_right","top_right","top_right","trace","transform","transform","transform","transform","transform","transform","transform","transform","transformed","transformed","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition_active","transition_focused","transition_hot","translate","translate","translate","translated","translated","translation","trigger","trigger","trigger","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_hex","try_intersection","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","unbounded","union","unpack","update","update_hovered","updates","val","value","value","vec","vec","vec_horizontal","vec_vertical","verbs","vertical","vertical","vertical_any","vertical_vec","view_at","visible","visible","vscroll","vstack","vstack","vstack_any","vstack_vec","vwrap","vwrap","vwrap_any","vwrap_vec","wake","warn","warning","was_active","was_focused","was_hot","web","width","width","width","width","width","width","width","width","width","width","width","width","window","window","window","window","window","window","window","window_event","window_maximized","window_mut","window_mut","window_mut","window_mut","window_mut","window_resized","window_scaled","with","with","with_data","with_data_default","with_state","with_state_default","with_style","without_data","without_state","wrap","wrap","wrap","wrap","wrap","wrap","wrap","wrap","x","x","x","x","y","y","y","y","zstack","zstack","Computed","Style","Style","Styled","Styles","Theme","Value","accent","background","comp","contrast","danger","info","key","outline","primary","secondary","success","surface","val","warning"],"q":[[0,"ori"],[6,"ori::app"],[55,"ori::core"],[76,"ori::core::canvas"],[300,"ori::core::canvas::Primitive"],[310,"ori::core::clipboard"],[314,"ori::core::command"],[367,"ori::core::context"],[396,"ori::core::event"],[772,"ori::core::image"],[844,"ori::core::layout"],[905,"ori::core::log"],[962,"ori::core::log::callsite"],[969,"ori::core::log::dispatcher"],[977,"ori::core::log::event"],[978,"ori::core::log::field"],[1001,"ori::core::log::instrument"],[1009,"ori::core::log::level_filters"],[1012,"ori::core::log::metadata"],[1018,"ori::core::log::span"],[1026,"ori::core::log::subscriber"],[1050,"ori::core::rebuild"],[1053,"ori::core::style"],[1074,"ori::core::text"],[1174,"ori::core::transition"],[1182,"ori::core::view"],[1376,"ori::core::views"],[1750,"ori::core::window"],[1860,"ori::log"],[2088,"ori::log::callsite"],[2130,"ori::log::dispatcher"],[2155,"ori::log::event"],[2178,"ori::log::field"],[2335,"ori::log::instrument"],[2393,"ori::log::level_filters"],[2396,"ori::log::metadata"],[2506,"ori::log::span"],[2584,"ori::log::subscriber"],[2685,"ori::prelude"],[7043,"ori::prelude::style"],[7064,"ori_app::delegate"],[7065,"ori_core::event::event"],[7066,"ori_app"],[7067,"core::ops::function"],[7068,"alloc::boxed"],[7069,"core::result"],[7070,"core::any"],[7071,"ori_core::canvas::color"],[7072,"ori_core::canvas::canvas"],[7073,"ori_core::canvas::curve"],[7074,"core::fmt"],[7075,"ori_core::layout::rect"],[7076,"core::hash"],[7077,"alloc::sync"],[7078,"core::convert"],[7079,"core::option"],[7080,"smol_str"],[7081,"alloc::string"],[7082,"ori_core::clipboard"],[7083,"ori_core::command"],[7084,"core::marker"],[7085,"ori_core::context::contexts"],[7086,"core::default"],[7087,"ori_core::event::ime"],[7088,"ori_core::event::keyboard"],[7089,"ori_core::event::pointer"],[7090,"ori_core::event::window"],[7091,"ori_core::layout::size"],[7092,"ori_core::image::image"],[7093,"ori_core::image::texture"],[7094,"ori_core::layout::justify"],[7095,"tracing_core::subscriber"],[7096,"tracing_core::span"],[7097,"tracing_core::metadata"],[7098,"tracing_core::event"],[7099,"tracing::instrument"],[7100,"tracing::span"],[7101,"tracing_core::callsite"],[7102,"tracing_core::dispatcher"],[7103,"tracing_core::field"],[7104,"tracing::field"],[7105,"core::error"],[7106,"ori_core::rebuild"],[7107,"ori_core::context::rebuild"],[7108,"ori_core::style::style"],[7109,"ori_core::text::atlas"],[7110,"ori_core::text::attributes"],[7111,"cosmic_text::font::system"],[7112,"cosmic_text::swash"],[7113,"cosmic_text::glyph_cache"],[7114,"cosmic_text::attrs"],[7115,"ori_core::transition"],[7116,"ori_core::view::state"],[7117,"ori_core::view::any"],[7118,"ori_core::view::sequence"],[7119,"ori_core::context::build"],[7120,"alloc::vec"],[7121,"ori_core::view::view"],[7122,"core::cmp"],[7123,"ori_core::context::draw"],[7124,"ori_core::context::event"],[7125,"ori_core::context::layout"],[7126,"ori_core::layout::space"],[7127,"core::iter::traits::collect"],[7128,"bitflags::iter"],[7129,"ori_core::view::pod"],[7130,"ori_core::views::aligned"],[7131,"ori_core::layout::alignment"],[7132,"ori_core::views::animate"],[7133,"ori_core::views::container"],[7134,"ori_core::views::button"],[7135,"ori_core::views::checkbox"],[7136,"ori_core::views::painter"],[7137,"ori_core::views::collapsing"],[7138,"ori_core::views::color_picker"],[7139,"ori_core::views::constrain"],[7140,"ori_core::views::flex"],[7141,"ori_core::views::focus"],[7142,"ori_core::views::scroll"],[7143,"ori_core::views::stack"],[7144,"ori_core::views::wrap"],[7145,"ori_core::views::memorize"],[7146,"ori_core::views::build_handler"],[7147,"ori_core::views::clickable"],[7148,"ori_core::views::draw_handler"],[7149,"ori_core::views::event_handler"],[7150,"ori_core::views::rebuild_handler"],[7151,"ori_core::views::opaque"],[7152,"ori_core::views::pad"],[7153,"ori_core::layout::padding"],[7154,"ori_core::views::transform"],[7155,"ori_core::layout::vector"],[7156,"ori_core::views::slider"],[7157,"ori_core::views::suspense"],[7158,"core::future::future"],[7159,"ori_core::views::text"],[7160,"ori_core::views::text_input"],[7161,"ori_core::views::tooltip"],[7162,"ori_core::layout::affine"],[7163,"ori_core::views::trigger"],[7164,"ori_core::views::with_state"],[7165,"ori_core::views::with_style"],[7166,"ori_core::views::zstack"],[7167,"ori_core::window::window"],[7168,"core::num::nonzero"],[7169,"core::clone"],[7170,"core::borrow"],[7171,"rayon::iter::par_bridge"],[7172,"core::pin"],[7173,"core::task::wake"],[7174,"core::task::poll"],[7175,"ori_core::layout::point"],[7176,"ori_app::app"],[7177,"ori_core::canvas::border"],[7178,"ori_core::event::modifiers"],[7179,"ori_core::layout::axis"],[7180,"fontdb"],[7181,"ori_core::text::buffer"],[7182,"cosmic_text::buffer"],[7183,"ori_app::builder"],[7184,"ori_core::views::aspect"],[7185,"ori_core::context::base"],[7186,"ori_core::canvas::stroke"],[7187,"ori_core::image::data"],[7188,"ori_core::layout::matrix"],[7189,"ori_core::style::palette"],[7190,"ori_core::text::source"],[7191,"ori_core::window::cursor"],[7192,"ori_core::window::pointer"],[7193,"ori_core::text::fonts"],[7194,"std::path"],[7195,"std::io::error"],[7196,"ori_app::command"],[7197,"core::iter::traits::iterator"],[7198,"core::ops::range"],[7199,"ori_app::request"],[7200,"cosmic_text::layout"],[7201,"ttf_parser::tables::os2"],[7202,"ori_macro"],[7203,"ori_core"],[7204,"ori_core::layout"],[7205,"tracing_core"],[7206,"tracing"],[7207,"tracing_attributes"],[7208,"tracing::level_filters"],[7209,"tracing::subscriber"]],"i":[0,0,0,0,0,0,0,0,0,0,0,272,278,10,0,272,278,0,272,278,272,278,278,0,278,0,251,278,251,278,251,251,251,278,251,278,251,278,5,251,278,5,251,5,278,251,278,10,251,251,278,251,278,251,278,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,224,0,0,0,223,0,222,20,21,0,20,21,0,0,0,0,222,222,0,28,17,19,0,17,19,20,21,0,224,20,21,28,17,0,0,221,0,20,21,223,224,0,221,222,222,223,0,19,0,0,26,140,15,15,15,26,140,33,17,18,19,15,20,21,33,17,18,19,15,20,21,202,201,201,225,17,18,19,15,20,21,17,18,19,15,20,21,17,17,18,19,15,15,20,20,21,21,220,19,18,33,17,18,19,15,15,20,21,33,17,18,19,15,20,21,33,17,18,19,15,20,21,17,18,19,15,20,21,18,17,18,19,15,15,20,21,33,17,18,18,19,15,20,21,26,17,20,0,0,0,0,0,220,33,17,18,19,15,20,21,33,17,18,19,15,20,21,33,225,202,225,18,15,33,0,0,0,0,0,0,0,0,20,26,0,0,202,140,33,17,18,19,15,20,21,15,15,202,201,201,220,33,17,18,19,15,20,21,33,17,18,19,15,20,21,33,17,18,19,15,20,21,225,285,286,285,287,285,286,287,286,287,287,0,0,38,38,0,0,0,0,40,41,39,40,41,39,39,39,39,40,41,39,40,41,39,40,41,39,40,41,39,40,41,39,39,40,40,41,39,40,41,39,40,40,40,39,40,39,40,41,39,40,41,39,41,40,41,39,39,0,0,0,0,0,0,0,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,56,55,55,55,55,55,7,56,56,215,56,55,56,56,56,56,56,55,55,56,55,55,0,7,0,55,56,7,55,55,55,55,55,56,55,55,56,55,56,56,55,55,56,55,56,56,55,56,0,55,56,55,56,55,56,55,56,55,56,55,55,55,55,55,55,55,55,56,55,55,55,55,55,55,56,55,56,55,56,55,56,55,56,55,56,55,56,55,55,55,215,56,56,55,55,55,55,55,55,55,56,55,56,0,55,56,0,56,55,56,55,55,55,0,56,56,56,56,56,56,56,56,56,56,0,7,0,7,56,56,56,56,56,55,56,56,55,56,0,56,55,56,56,56,56,56,56,56,56,56,56,56,56,56,215,56,55,56,55,56,55,55,56,55,0,0,0,7,0,7,0,7,0,7,0,7,215,55,56,56,56,56,56,56,55,55,56,55,56,55,56,215,55,56,55,56,55,56,55,55,55,56,55,56,215,56,55,55,55,56,7,56,56,0,7,0,7,0,7,56,56,56,55,55,203,48,49,50,51,52,53,48,49,50,51,52,53,229,230,230,48,49,50,51,52,53,48,49,50,51,52,53,48,49,50,51,51,52,52,53,53,227,49,48,203,48,228,231,48,49,50,51,52,53,48,49,50,51,52,53,48,49,50,51,52,53,48,50,51,52,53,48,49,50,51,52,53,48,49,50,51,52,53,48,50,51,53,51,228,50,229,230,231,48,49,50,51,52,53,48,49,50,51,52,53,54,49,227,49,53,203,227,49,228,229,230,231,228,229,230,231,52,48,203,51,48,227,48,49,50,51,52,53,48,49,50,51,52,53,48,49,50,51,52,53,48,49,50,51,52,53,51,232,51,52,53,60,0,60,0,0,0,0,0,58,59,60,58,59,60,58,59,60,58,59,60,58,59,59,60,59,60,58,59,60,58,59,60,58,59,60,58,59,60,58,59,60,58,59,60,60,60,59,58,59,58,58,59,60,58,59,60,59,58,59,58,59,60,58,59,60,58,59,60,58,59,60,58,0,0,0,0,199,234,199,234,0,199,204,0,0,0,0,0,0,0,0,234,234,234,199,234,199,0,204,64,64,158,64,64,64,64,57,64,64,64,158,167,24,127,24,127,64,0,158,158,167,64,64,64,57,134,235,197,160,134,235,197,160,0,0,0,0,0,0,0,0,0,0,0,65,65,0,0,0,65,65,65,0,65,0,0,0,65,0,65,0,65,0,70,0,0,0,70,0,0,65,0,74,0,65,65,77,65,65,65,74,0,0,0,0,0,0,65,0,0,0,0,0,74,0,0,74,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,86,0,0,77,79,79,79,79,79,79,79,79,79,0,0,0,0,70,70,96,96,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,98,0,0,0,0,0,65,65,65,65,65,65,65,65,65,65,65,65,65,65,65,0,0,65,0,0,0,99,101,0,101,0,0,0,101,236,236,0,236,236,236,0,236,236,236,236,236,0,236,0,241,200,238,206,241,200,238,238,238,206,0,0,0,0,0,0,0,239,206,206,240,238,239,239,241,206,238,238,206,200,0,0,0,0,238,238,240,105,103,104,105,103,104,103,104,103,104,103,103,104,249,104,105,103,104,105,103,104,105,103,104,104,104,105,103,104,249,249,105,103,104,105,0,105,103,104,105,105,103,104,103,105,104,104,249,104,103,104,105,103,104,105,103,104,105,103,104,103,104,242,0,242,0,111,0,111,0,113,112,0,0,0,112,113,113,113,113,113,113,113,113,112,0,0,0,0,117,121,0,0,0,0,0,0,112,113,0,114,115,112,113,112,113,112,113,112,113,112,112,113,113,112,113,112,113,112,113,115,112,113,115,117,121,112,113,115,112,113,115,112,112,113,113,115,115,115,112,113,112,113,112,113,115,112,113,115,112,113,115,112,113,121,117,112,113,115,114,114,114,114,114,112,113,112,113,115,121,117,112,113,112,112,112,112,112,113,113,113,113,113,115,115,112,113,115,112,113,112,112,113,113,112,113,112,113,112,113,112,113,115,112,113,115,112,113,112,113,112,113,112,113,115,112,113,112,113,112,113,112,113,112,113,121,117,117,115,112,113,115,0,117,121,117,112,113,112,113,112,113,112,113,112,113,112,113,115,115,115,112,113,112,113,115,112,113,115,112,113,115,112,113,0,0,0,0,0,0,0,0,247,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,247,0,247,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,151,154,0,147,164,256,165,257,166,261,148,133,142,262,248,0,135,214,146,161,147,148,0,138,258,141,254,136,260,161,255,166,261,154,137,253,138,258,141,254,142,262,136,260,161,255,166,261,137,253,138,258,141,254,136,260,146,259,161,255,166,261,137,253,138,258,141,254,142,262,136,260,161,255,166,261,0,0,0,0,152,152,0,0,138,0,0,137,253,138,258,142,146,259,161,255,164,256,165,257,166,261,0,148,0,0,151,153,154,156,155,168,170,133,214,137,152,141,143,136,144,157,146,147,166,159,148,171,141,166,261,152,139,0,152,0,137,253,0,144,0,164,256,165,257,166,261,164,256,165,257,166,261,164,256,165,257,166,261,164,256,165,257,166,261,164,256,165,257,166,261,147,141,0,0,0,0,0,0,0,0,0,0,141,254,141,254,146,259,248,147,148,148,146,259,0,161,255,142,262,164,256,165,257,166,261,136,260,0,0,0,0,0,0,0,165,0,0,0,153,0,0,142,161,165,141,0,0,0,165,0,141,0,0,0,0,0,137,253,157,166,261,0,165,165,257,161,155,0,0,0,0,148,0,0,138,258,142,262,139,0,142,262,143,138,258,170,0,0,164,165,166,0,0,144,0,0,0,0,0,159,0,137,253,138,258,141,254,146,259,0,0,0,0,0,161,0,0,0,0,0,0,0,0,0,0,146,259,161,255,0,0,0,0,0,0,0,164,256,165,257,166,261,0,0,243,243,243,243,243,172,246,243,243,243,0,172,172,243,243,243,246,243,243,243,172,172,172,243,243,243,243,243,243,243,243,243,0,243,243,172,243,243,172,243,172,243,243,172,243,172,243,243,0,0,0,0,0,243,243,172,173,172,173,172,173,172,173,172,173,174,173,174,173,172,173,172,173,173,172,173,172,172,173,172,173,244,174,173,172,173,172,173,174,173,244,174,173,174,173,174,173,174,174,173,172,173,172,173,172,173,172,173,174,173,0,175,0,175,0,175,0,0,0,0,0,0,175,0,175,175,72,68,76,175,66,72,68,76,175,66,0,68,72,72,76,175,66,72,76,175,66,65,76,72,76,175,175,66,175,72,65,76,0,0,76,72,68,76,175,66,72,68,76,175,66,0,65,65,65,65,65,76,76,72,72,68,76,175,66,65,76,65,76,0,65,72,76,72,72,68,175,175,66,0,0,0,65,76,0,65,0,65,76,0,72,68,68,77,77,72,68,76,175,175,66,72,72,68,76,76,175,66,66,175,66,175,175,175,175,72,72,175,66,72,70,72,0,0,72,68,76,175,66,0,70,0,72,68,76,175,66,66,66,65,65,65,65,76,72,68,72,68,175,175,68,0,68,175,175,65,0,74,72,0,68,68,72,68,76,72,72,65,76,72,76,65,72,175,175,77,65,72,76,72,65,76,65,76,74,0,0,0,0,68,72,76,175,66,175,175,0,0,65,76,72,68,76,175,66,72,68,76,175,66,72,68,76,175,66,0,0,72,0,0,0,176,185,176,185,176,176,176,176,185,176,185,176,185,176,176,185,176,185,176,176,185,185,176,185,74,185,185,0,0,185,74,185,176,176,185,176,185,176,185,0,0,0,0,178,178,178,178,178,178,178,178,178,178,0,178,178,0,0,178,178,178,178,178,0,0,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,0,0,0,0,0,0,0,0,0,0,86,78,78,78,181,177,78,188,186,89,87,181,177,78,188,186,89,87,177,78,78,89,87,78,89,87,78,89,87,181,0,181,177,78,188,186,89,87,181,177,78,188,186,89,87,0,181,177,78,188,186,89,87,181,78,188,181,181,181,177,177,78,78,188,186,89,89,87,181,177,78,188,186,89,87,78,181,177,78,188,186,89,87,181,177,78,188,186,89,87,181,186,181,177,181,181,177,78,181,186,186,77,177,188,89,87,79,79,79,79,79,79,79,79,79,78,89,87,181,177,78,89,181,177,78,89,181,177,78,188,186,89,87,181,177,78,188,186,89,87,181,177,78,188,186,89,87,0,0,0,0,97,71,97,71,97,71,97,71,97,71,97,71,97,71,97,97,71,71,97,71,97,71,70,97,71,97,71,97,71,97,71,97,71,70,97,71,97,71,97,71,97,71,71,71,97,71,97,71,97,71,97,71,96,96,0,0,0,73,73,184,184,73,0,0,0,0,73,0,0,184,73,73,184,73,195,183,184,73,195,183,184,73,195,184,73,195,184,73,73,195,73,73,184,73,195,183,184,73,195,183,184,73,195,183,184,73,73,184,73,73,195,195,183,183,184,73,73,73,195,183,73,73,73,73,73,73,73,184,184,73,195,183,184,73,195,183,73,184,184,184,73,73,73,73,73,73,184,73,195,73,195,183,73,195,183,184,73,195,183,184,73,195,183,184,73,195,183,0,0,0,0,0,0,0,98,179,180,75,80,179,180,75,80,75,75,80,179,180,180,75,80,179,180,75,80,179,179,180,180,75,80,180,75,179,180,75,80,179,180,75,80,180,179,180,75,80,179,180,75,80,75,75,80,75,80,75,75,80,75,75,75,80,179,180,75,80,179,180,75,80,179,180,75,80,75,0,0,0,0,0,81,84,83,81,196,84,83,81,196,81,196,81,196,65,81,196,196,65,196,84,83,81,196,84,83,81,196,65,84,83,83,81,196,65,65,196,65,196,65,196,65,65,196,84,84,83,81,196,84,83,81,196,84,83,81,196,84,83,81,196,81,81,81,65,81,196,65,196,65,65,196,65,196,65,196,0,0,81,81,196,84,84,65,84,83,81,196,84,83,81,196,84,83,81,196,0,56,236,236,256,257,261,262,55,0,55,243,0,0,0,243,55,55,55,0,7,0,56,0,0,0,0,243,0,0,56,236,258,254,260,255,261,26,237,26,237,253,258,254,262,260,255,261,253,258,254,260,259,255,261,253,258,254,262,260,255,261,134,134,134,215,56,55,56,56,0,224,0,0,0,200,0,56,56,0,0,0,241,223,0,0,56,134,253,258,259,255,256,257,261,236,236,26,55,0,55,56,243,199,234,200,55,0,0,222,55,247,0,0,0,0,7,272,0,55,243,0,0,0,0,0,56,7,0,55,101,238,0,0,0,246,243,55,55,55,243,243,206,0,0,55,56,236,236,261,241,55,243,0,55,56,222,222,55,56,272,0,0,56,243,237,237,242,0,55,55,56,199,234,200,55,56,56,55,56,28,0,0,0,243,55,238,238,238,56,55,56,55,56,55,56,55,56,55,55,55,55,55,55,55,55,56,55,55,55,55,55,55,56,55,56,55,56,55,56,55,56,55,56,55,56,253,0,57,127,256,257,261,256,257,261,256,257,261,256,257,261,256,257,261,206,199,0,55,246,0,0,55,55,0,0,0,0,0,0,0,215,56,26,243,243,56,55,55,55,55,243,55,55,55,56,204,55,56,254,254,167,235,57,236,236,259,0,0,0,55,56,239,56,55,0,56,259,55,55,55,0,56,56,56,56,56,56,56,56,56,56,0,7,7,56,56,56,134,255,237,262,256,257,261,56,56,0,55,56,200,0,242,56,26,260,237,0,0,55,200,56,224,0,206,243,56,197,160,197,160,237,243,206,243,243,243,28,240,238,239,243,243,55,56,56,56,56,56,56,56,56,56,56,56,56,243,243,56,197,160,236,236,239,0,272,215,56,253,261,257,236,236,0,0,55,56,55,56,0,0,55,241,0,221,55,56,55,0,0,0,0,243,0,0,7,0,7,0,7,0,7,0,7,247,215,55,243,56,272,56,56,56,26,134,56,56,0,0,0,0,0,55,247,55,56,200,55,223,224,243,56,236,236,237,258,262,262,243,258,236,236,236,236,236,236,236,236,206,0,55,56,0,243,215,55,238,238,56,0,206,0,55,0,56,0,0,221,222,222,0,55,56,234,234,234,223,0,199,234,200,0,117,121,199,0,0,0,0,101,0,0,0,55,0,243,55,55,56,237,134,134,134,253,258,254,259,26,55,56,215,0,243,0,0,0,0,0,0,0,0,0,200,0,0,0,56,57,127,238,238,55,55,55,56,7,56,101,0,204,243,0,0,0,56,236,236,26,259,255,256,257,261,243,243,0,0,7,7,7,0,0,0,240,0,56,197,160,56,197,160,26,56,201,202,197,24,57,127,160,0,55,55,243,243,26,26,236,125,26,197,197,197,24,24,57,57,57,127,160,160,26,197,197,197,24,24,57,57,57,127,160,160,198,198,151,154,151,154,0,134,199,147,164,165,148,147,164,256,165,257,166,261,148,133,201,202,158,197,57,160,142,142,262,203,144,248,160,160,0,118,125,100,135,140,0,203,147,148,147,147,24,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,125,100,55,206,100,208,125,208,210,214,161,147,148,146,161,147,148,26,26,0,138,141,136,161,236,138,258,141,254,136,260,161,255,166,261,154,154,24,127,24,127,140,137,138,141,142,136,161,137,253,138,258,141,254,142,262,136,260,161,255,166,261,137,138,141,136,161,137,253,138,258,141,254,136,260,146,259,161,255,166,261,137,138,141,142,136,161,137,253,138,258,141,254,142,262,136,260,161,255,166,261,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,0,24,202,158,24,0,24,201,0,24,201,29,208,249,117,121,198,211,135,151,153,154,145,149,156,155,162,168,169,170,61,132,212,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,0,152,229,230,152,152,124,225,197,57,160,0,24,24,24,24,0,138,138,118,124,125,126,100,0,29,197,24,57,160,216,29,230,217,219,201,202,220,221,222,140,28,216,26,29,223,224,225,226,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,241,242,111,132,212,243,244,245,246,174,247,248,219,201,202,220,221,222,140,28,216,26,29,223,224,225,226,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,241,242,111,132,212,243,244,245,246,174,247,248,219,219,201,201,202,202,220,221,222,222,140,28,28,216,26,26,29,223,223,224,224,225,225,226,227,55,55,56,56,203,203,210,210,215,215,228,229,230,231,232,232,233,63,63,61,167,167,134,134,204,204,199,199,234,234,235,235,158,158,197,197,24,24,57,57,127,127,160,160,236,236,102,101,206,237,237,238,238,239,239,200,200,240,240,241,242,242,111,111,132,132,212,212,243,243,244,245,245,246,246,174,247,247,248,248,29,198,6,217,226,7,217,226,226,227,0,61,174,137,138,142,161,164,165,220,174,137,253,138,258,142,146,259,161,255,164,256,165,257,166,261,0,148,148,0,111,233,29,0,127,24,0,29,24,217,118,124,125,126,100,119,152,151,153,154,156,155,168,170,133,214,137,152,141,143,136,144,157,146,147,166,159,148,171,217,217,217,217,217,236,160,203,29,119,249,236,236,26,233,233,0,174,174,211,218,201,202,140,216,26,29,225,203,233,61,167,134,235,158,197,24,57,127,160,236,102,206,237,238,239,200,240,249,242,111,119,243,245,246,174,142,248,165,141,141,166,261,211,228,231,198,211,272,6,6,218,217,118,118,124,124,125,125,126,126,100,100,219,250,250,213,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,233,63,61,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,132,212,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,198,211,272,6,6,218,217,118,118,124,124,125,125,126,126,100,100,219,250,250,213,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,132,212,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,26,152,152,0,235,197,197,197,197,57,57,57,160,160,197,197,197,57,57,57,160,160,160,61,121,118,125,100,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,139,146,161,147,164,165,166,159,148,171,139,249,124,216,117,212,198,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,111,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,0,111,111,0,29,201,202,220,221,222,140,28,216,26,29,223,224,225,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,206,237,238,239,200,240,242,111,132,212,243,244,245,246,247,0,242,5,121,198,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,152,117,212,0,127,102,26,162,137,137,253,124,216,124,233,57,127,174,119,0,144,197,57,160,218,201,202,220,221,222,140,28,216,26,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,197,24,57,57,127,160,160,236,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,245,246,174,247,248,0,125,211,249,164,165,164,256,165,257,166,261,164,165,164,256,165,257,166,261,164,165,164,256,165,257,166,261,164,165,164,256,165,257,166,261,249,164,165,164,256,165,257,166,261,217,197,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,201,201,201,202,202,202,202,202,202,220,220,221,222,140,140,140,140,28,216,26,26,26,29,29,223,224,225,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,61,167,134,134,134,204,199,234,235,158,158,158,158,158,158,197,197,197,197,197,197,24,24,24,57,57,57,57,57,57,127,127,160,160,160,160,160,160,236,102,102,102,102,102,102,102,102,102,102,102,102,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,206,206,206,206,237,238,239,200,240,208,249,241,241,241,241,241,241,242,111,132,132,132,212,212,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,164,256,165,257,166,261,159,148,171,235,160,210,56,208,235,127,215,210,26,26,147,148,147,218,102,101,111,217,217,102,101,102,101,233,174,174,118,124,125,126,100,119,118,124,125,126,100,119,198,198,26,125,125,125,198,118,124,125,126,100,213,119,125,118,124,125,126,100,119,125,118,124,125,126,100,119,125,220,221,222,140,28,26,29,223,224,225,55,56,203,210,215,228,229,230,231,232,233,63,61,167,204,199,234,235,197,24,57,127,160,206,237,238,239,200,240,242,132,212,243,245,247,160,141,0,233,24,174,143,57,0,26,147,148,148,148,125,124,216,244,0,0,26,0,26,0,0,0,0,0,26,0,26,0,0,0,0,174,174,141,141,254,141,141,254,118,124,125,126,100,61,119,244,174,228,229,230,231,198,5,220,119,24,0,24,236,0,198,198,211,272,6,5,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,102,217,118,124,125,126,100,119,102,102,102,146,259,24,24,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,29,167,235,55,56,118,124,125,126,100,119,29,7,0,29,212,147,148,197,57,127,119,118,124,125,126,100,119,118,124,125,126,100,119,174,197,57,127,227,7,7,0,197,174,244,248,26,26,29,124,0,29,225,147,148,147,148,148,148,0,227,198,146,259,29,216,121,118,125,100,135,151,153,154,145,149,156,155,162,168,169,170,61,234,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,117,212,0,24,202,158,117,29,212,147,148,160,161,161,255,160,197,236,26,142,142,262,164,165,164,256,165,257,166,261,29,0,111,249,125,127,127,127,26,204,119,119,119,152,136,136,260,124,216,167,197,57,160,24,127,201,57,0,143,0,24,143,0,143,174,174,0,203,197,57,160,24,127,201,57,0,143,0,24,143,0,143,204,225,26,26,0,227,228,229,230,231,198,61,174,29,26,26,167,167,167,235,235,235,197,197,197,57,57,57,160,160,167,197,197,197,57,57,57,160,160,165,165,61,243,119,119,119,197,160,211,218,217,118,124,125,126,100,219,135,151,153,154,145,149,156,155,162,168,169,170,201,202,216,29,226,233,61,134,235,158,197,24,57,127,160,102,208,249,132,212,119,244,245,174,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,160,158,24,0,26,0,26,0,26,0,26,0,26,0,26,0,26,0,26,0,0,0,153,153,0,0,142,161,165,142,161,165,141,141,0,0,0,165,165,0,141,141,272,6,236,124,216,204,0,0,0,0,0,137,137,253,157,166,261,0,174,165,165,165,165,257,0,198,198,198,198,174,174,29,228,229,230,231,244,61,119,249,126,126,244,174,236,216,119,118,124,125,126,100,119,118,124,125,126,100,119,118,124,125,126,100,119,217,0,147,148,29,29,29,29,124,29,6,26,26,161,161,208,208,99,117,121,198,6,125,135,151,153,154,145,149,156,155,162,168,169,170,61,132,212,133,133,214,214,137,137,253,138,138,258,152,152,141,141,254,142,142,262,143,143,136,136,260,144,144,157,157,139,139,146,146,259,161,161,255,147,147,164,256,165,257,166,166,261,159,159,148,148,171,155,117,212,0,124,125,100,216,29,208,119,244,174,197,197,197,57,57,57,160,160,197,197,197,57,57,57,160,160,217,174,118,124,125,126,100,119,198,119,119,119,174,174,0,26,0,26,26,0,24,202,158,0,167,0,124,216,167,197,24,57,160,148,148,26,0,167,174,174,124,216,236,218,118,125,100,119,208,208,118,125,100,119,233,119,118,125,100,119,118,125,100,119,125,119,208,233,119,208,119,208,140,203,24,127,160,0,124,125,100,233,158,24,208,119,174,138,142,139,174,138,258,142,262,139,174,174,0,142,142,262,174,143,217,226,111,124,216,138,138,258,29,0,211,170,0,253,258,254,262,260,259,255,256,257,261,118,124,125,126,100,197,197,197,197,24,24,57,57,57,127,160,160,197,197,197,24,24,57,57,57,127,160,160,236,236,0,249,198,0,124,164,165,227,164,165,166,0,0,124,211,144,174,174,200,240,237,238,239,26,26,26,26,26,26,26,26,26,26,26,26,26,219,201,202,220,221,222,140,28,216,26,29,223,224,225,226,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,241,242,111,132,212,243,244,245,246,174,247,248,57,160,26,197,160,26,197,57,160,245,26,26,197,57,160,245,197,57,0,0,24,202,158,24,0,24,201,0,24,201,0,0,124,125,29,24,119,220,159,124,216,0,137,138,141,137,253,138,258,141,254,146,259,0,0,0,0,167,119,124,216,167,0,124,216,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,26,24,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,253,138,258,247,152,141,254,142,262,143,136,260,248,144,157,139,146,259,161,255,147,164,256,165,257,166,261,159,148,171,143,24,204,119,198,174,0,161,161,147,148,147,147,29,147,148,148,148,216,174,174,0,0,0,0,0,0,0,0,0,226,0,236,125,125,125,0,0,233,24,174,143,161,225,57,146,259,161,255,211,118,124,125,126,100,232,198,198,118,124,125,126,100,198,198,147,148,0,0,0,0,0,0,0,164,165,164,256,165,257,166,261,134,235,197,160,134,235,197,160,0,0,101,0,101,0,0,0,101,236,236,0,236,236,236,0,236,236,236,236,236,0,236],"f":"``````````````````````````{{{b{c}}}{{b{e}}}{}{}}0{{{b{dc}}}{{b{de}}}{}{}}0``{f{{b{c}}}{}}0{f{{b{dc}}}{}}0{fh}0{{{b{dj}}{b{d{l{c}}}}{b{dc}}{b{n}}}A`{}}{cc{}}0{{{b{dj}}{b{d{l{c}}}}{b{dc}}}h{}}{{}f}10{ce{}{}}0{{{Ad{}{{Ab{c}}}}}{{Ah{Af}}}{}}`{c{{Aj{e}}}{}{}}000{{{b{c}}}Al{}}0``````````````````````````````````````````````````````````````````````````{{{b{An}}}{{b{B`}}}}00``=======<<<<<<<````{{{b{Bb}}}Bb}{{{b{Bd}}}Bd}{{{b{Bf}}}Bf}{{{b{An}}}An}{{{b{Bh}}}Bh}{{{b{Bj}}}Bj}{{{b{c}}{b{de}}}h{}{}}00000{{{b{c}}}h{}}000000000`{{{b{Bf}}}f}`{f{{b{c}}}{}}000{{{b{An}}}b}111{f{{b{dc}}}{}}000000{fh}000000{{{b{Bb}}{b{Bb}}}A`}{{{b{Bd}}{b{Bd}}}A`}{{{b{Bf}}{b{Bf}}}A`}{{{b{An}}{b{An}}}A`}{{{b{Bh}}{b{Bh}}}A`}{{{b{Bj}}{b{Bj}}}A`}`{{{b{Bb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Bd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Bf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{An}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Bh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Bj}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}00{C`Bd}1111`{{{b{Bb}}{b{dc}}}hCb}{{{b{Bh}}{b{dc}}}hCb}{{{b{B`}}}Cd}{{CfCfCf}Cd}{{CfCfCfCf}Cd}10`{{}f}000000{ce{}{}}0000000```{{cCh}Bd{{Cn{{Cl{Cj}}}}}}{{D`D`D`D`}An}{{{b{dDb}}}Dd}65656565{{{b{Bh}}}f}`76``{{{b{Db}}}{{Df{f{Dd{f}}}}}}{{{b{c}}}e{}{}}00000{{{b{c}}}Dh{}}{{{b{c}}}Dj{}}````{c{{Aj{e}}}{}{}}0000000000000{{{b{c}}}Al{}}000000`````````````{{{b{dDl}}}Dj}{{{b{dDl}}{b{B`}}}h}````{{{b{c}}}{{b{e}}}{}{}}00{{{b{dc}}}{{b{de}}}{}{}}00{{{b{Dn}}}Dn}{{{b{c}}{b{de}}}h{}{}}{{{b{c}}}h{}}{f{{b{c}}}{}}00{f{{b{dc}}}{}}00{fh}00{{{b{E`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Eb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Dn}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}00{{{Cl{Ed}}}Dn}{{{b{E`}}}{{Dd{{b{c}}}}}Ef}{{}f}00{ce{}{}}00{{{b{E`}}}A`}{{{b{E`}}}{{b{B`}}}}{cE`{EfEh}}{cDn{EdEhEj}}{E`{{Ah{Ef}}}}{{{b{c}}}e{}{}}{c{{Aj{e}}}{}{}}00000{{{b{Eb}}}{{Dd{E`}}}}{{{b{c}}}Al{}}00{{{b{Dn}}}h}```````{{{b{c}}}{{b{e}}}{}{}}{{{b{dc}}}{{b{de}}}{}{}}{{{b{El}}}A`}{{}El}{f{{b{c}}}{}}{f{{b{dc}}}{}}{fh}{{{b{El}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}{{{b{El}}}{{Dd{{b{c}}}}}Ef}{{{b{dEl}}}{{Dd{{b{dc}}}}}Ef}{{{b{dEl}}}{{b{dc}}}{EfEn}}{{}f}{{{b{dEl}}c}{{Dd{c}}}Ef}{ce{}{}}<{{{b{El}}}f}<{{{b{dEl}}}{{Dd{c}}}Ef}{c{{Aj{e}}}{}{}}0{{{b{c}}}Al{}}`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{b{c}}}{{b{e}}}{}{}}00000{{{b{dc}}}{{b{de}}}{}{}}00000```{{{b{F`}}}F`}{{{b{Fb}}}Fb}{{{b{Fd}}}Fd}{{{b{Ff}}}Ff}{{{b{Fh}}}Fh}{{{b{Fj}}}Fj}{{{b{c}}{b{de}}}h{}{}}00000{{{b{c}}}h{}}00000000````{{}F`}``{f{{b{c}}}{}}00000{f{{b{dc}}}{}}00000{fh}00000{{{b{F`}}{b{F`}}}A`}{{{b{Fd}}{b{Fd}}}A`}{{{b{Ff}}{b{Ff}}}A`}{{{b{Fh}}{b{Fh}}}A`}{{{b{Fj}}{b{Fj}}}A`}{{{b{F`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ff}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fj}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}00000{{{b{F`}}{b{dc}}}hCb}{{{b{Fd}}{b{dc}}}hCb}{{{b{Ff}}{b{dc}}}hCb}{{{b{Fj}}{b{dc}}}hCb}``````{{}f}00000{ce{}{}}00000{{{b{Fl}}Fn{Dd{G`}}}A`}{{{b{Fb}}c}A`Fl}`````````````````{{{b{Ff}}}Gb}``{{{b{c}}}e{}{}}00000{c{{Aj{e}}}{}{}}00000000000{{{b{c}}}Al{}}00000`````````````{{{b{c}}}{{b{e}}}{}{}}00{{{b{dc}}}{{b{de}}}{}{}}00{{{b{Gd}}}Gd}{{{b{Gf}}}Gf}{{{b{Gh}}}Gh}{{{b{c}}{b{de}}}h{}{}}00{{{b{c}}}h{}}000{{}Gf}{{}Gh}{f{{b{c}}}{}}00{f{{b{dc}}}{}}00{fh}00{{{b{Gd}}{b{Gd}}}A`}{{{b{Gf}}{b{Gf}}}A`}{{{b{Gh}}{b{Gh}}}A`}{{{b{Gd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gh}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}0{GjGh}{GfGh}2{GlGf}{{{b{Gd}}{b{dc}}}hCb}{{{b{Gf}}{b{dc}}}hCb}{{{b{Gd}}}Gn}{{}f}00{ce{}{}}00{{}Gf}{{{b{Gd}}}f}{GfGl}{{{b{c}}}e{}{}}00{c{{Aj{e}}}{}{}}00000{{{b{c}}}Al{}}004```````````````````````````{{{b{c}}}{{b{e}}}{}{}}{{{b{dc}}}{{b{de}}}{}{}}`{f{{b{c}}}{}}{f{{b{dc}}}{}}{fh}{cc{}}`=<<``````{{{b{dH`}}}Dd}{CfCf}```998````````````````````{{{b{Hb}}{b{Hd}}}Hd}{{{b{Hb}}}Hf}```{{{b{Hb}}Al}{{Dd{h}}}}{{{b{Hb}}Hd}h}{{{b{Hb}}{b{Hh}}}A`}`{{{b{Hb}}{b{Hd}}}h}```{{{b{Hb}}{b{Hj}}}h}`{{{b{Hb}}{b{Hj}}}A`}`2`{Hl{{Hn{Hl}}}}```{{HlI`}{{Hn{Hl}}}}``{{{b{Hb}}}{{Dd{Ib}}}}`{{{b{Id}}}{{b{Hh}}}}`{{{b{Hb}}{b{If}}}Hd}{{{b{Hb}}{b{Ih}}}h}{{{b{Ij}}{b{Il}}{b{dIn}}}h}{{{b{Hb}}{b{Hd}}{b{J`}}}h}{{{b{Hb}}{b{Hd}}{b{Hd}}}h}{{{b{Hb}}{b{Hh}}}Jb}{{{b{Id}}Jb}h}``````{{{b{Hb}}Hd}A`}`````8{{}h}{{{b{Id}}}h}3````{ec{}{{Af{{b{Ih}}}{{Jd{c}}}}}}{{{b{Ih}}}Jf}{Ih{{Aj{hJh}}}}{{{b{Ih}}e}c{}{{Jj{}{{Jd{c}}}}}}```````````{{{b{Jl}}{b{Hh}}}{{Dd{Il}}}}{c{{Jn{c}}}K`}{c{{Kb{c}}}Kd}>{{{b{dIn}}{b{Il}}A`}h}{{{b{dIn}}{b{Il}}{b{K`}}}h}{{{b{dIn}}{b{Il}}{b{Kf}}}h}{{{b{dIn}}{b{Il}}Kh}h}{{{b{dIn}}{b{Il}}Kj}h}{{{b{dIn}}{b{Il}}Kl}h}{{{b{dIn}}{b{Il}}{b{B`}}}h}{{{b{dIn}}{b{Il}}Kn}h}{{{b{dIn}}{b{Il}}Gl}h}````{Hl{{Hn{Hl}}}}{{HlI`}{{Hn{Hl}}}}{L`{{Lb{L`}}}}{{L`c}{{Lb{L`}}}{{Cn{Ih}}}}````````````````{{{b{Ld}}}{{Dd{{b{Hd}}}}}}`````{{{b{Hb}}{b{Hd}}}Hd}{{{b{Hb}}}Hf}{{{b{Hb}}Al}{{Dd{h}}}}{{{b{Hb}}Hd}h}{{{b{Hb}}{b{Hh}}}A`}{{{b{Hb}}{b{Hd}}}h}{{{b{Hb}}{b{Hj}}}h}{{{b{Hb}}{b{Hj}}}A`}2{{{b{Hb}}}{{Dd{Ib}}}}{{{b{Hb}}{b{If}}}Hd}{{{b{Hb}}{b{Ih}}}h}{{{b{Hb}}{b{Hd}}{b{J`}}}h}{{{b{Hb}}{b{Hd}}{b{Hd}}}h}{{{b{Hb}}{b{Hh}}}Jb}{cJf{HbEhEj}}{c{{Aj{hJh}}}{HbEhEj}}{{{b{Hb}}Hd}A`}{{cg}e{HbEhEj}{}{{Jj{}{{Jd{e}}}}}}``{{{b{Lf}}{b{dLh}}{b{Lf}}}h}`````````{e{{Lj{c}}}{}{{Ed{{b{Ll}}}{{Jd{c}}}}EhEj}}```{{{b{B`}}}{{Lj{c}}}{}}`````{e{{Lj{c}}}{}{{Cn{c}}}}```````````````````````````````````````{{{b{c}}}{{b{e}}}{}{}}00{{{b{dc}}}{{b{de}}}{}{}}00{{{b{Ln}}}Ln}{{{b{M`}}}M`}{{{b{c}}{b{de}}}h{}{}}0{{{b{c}}}h{}}00`{{}M`}{f{{b{c}}}{}}00{f{{b{dc}}}{}}00{fh}00{{{b{M`}}{b{M`}}}A`}`{{{b{Mb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ln}}{b{dBl}}}{{Aj{hBn}}}}{{{b{M`}}{b{dBl}}}{{Aj{hBn}}}}``{cc{}}00{{{b{Mb}}}{{b{Gj}}}}`{{}f}00{{{b{dMb}}{b{dMd}}{b{dMf}}Mh}{{Dd{Ln}}}}{ce{}{}}00`{MjMb}```{{{b{M`}}}Ml}{{{b{c}}}e{}{}}0{c{{Aj{e}}}{}{}}00000{{{b{c}}}Al{}}00```````{CfMn}`0```````````````````````````{{}N`}{{}Nb}{e{{Ah{Nd}}}{}{{Nd{c}}}}{{{b{Nd}}}{{b{Ef}}}}{{{b{Nf}}}Gl}{{N`N`}N`}{{NbNb}Nb}{{{b{dN`}}N`}h}{{{b{dNb}}Nb}h}3210{{{b{N`}}}D`}0{{{b{Nb}}}D`}05432{{{b{c}}}{{b{e}}}{}{}}00{{{b{dc}}}{{b{de}}}{}{}}00{{{b{d{Nj{}{{Nh{c}}}}}}{b{dNl}}{b{de}}}{{Df{c{O`{Nn}}}}}{}{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dNl}}{b{de}}}c{}Od}{{{b{N`}}}N`}{{{b{Nb}}}Nb}{{{b{Nf}}}Nf}{{{b{c}}{b{de}}}h{}{}}00{{{b{c}}}h{}}00000{{{b{Nf}}{b{Nf}}}Of}{N`N`}{NbNb}{{{b{N`}}N`}A`}{{{b{Nb}}Nb}A`}{{}N`}{{}Nb}{{}Nf}{f{{b{c}}}{}}00{f{{b{dc}}}{}}00{{N`N`}N`}{{NbNb}Nb}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOh}}{b{de}}}h{}Od}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOh}}{b{de}}}h{}{}}{fh}00{{{b{dNd}}{b{dNl}}{b{dc}}}{{Ah{Ef}}}{}}{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOh}}{b{dc}}}h{}}{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dLh}}{b{dc}}{b{Nd}}}h{}}>={{{b{N`}}{b{N`}}}A`}{{{b{Nb}}{b{Nb}}}A`}{{{b{Nf}}{b{Nf}}}A`}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOj}}{b{de}}{b{n}}}h{}Od}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOj}}{b{de}}{b{n}}}h{}{}}{{{b{dN`}}c}h{{A@b{}{{A@`{N`}}}}}}{{{b{dNb}}c}h{{A@b{}{{A@`{Nb}}}}}}{{{b{N`}}{b{dBl}}}{{Aj{hBn}}}}0000{{{b{Nb}}{b{dBl}}}{{Aj{hBn}}}}0000{{{b{Nf}}{b{dBl}}}{{Aj{hBn}}}}0{cc{}}00{D`{{Dd{N`}}}}{D`{{Dd{Nb}}}}{D`N`}0{D`Nb}010{cN`{{A@b{}{{A@`{N`}}}}}}{cNb{{A@b{}{{A@`{Nb}}}}}}{{{b{B`}}}{{Dd{N`}}}}{{{b{B`}}}{{Dd{Nb}}}}{{{b{N`}}{b{dc}}}hCb}{{{b{Nb}}{b{dc}}}hCb}{{{b{Nf}}{b{dc}}}hCb}{{}f}00{{{b{dN`}}N`}h}{{{b{dNb}}Nb}h}{{N`N`}N`}{{NbNb}Nb}{{{b{N`}}N`}A`}{{{b{Nb}}Nb}A`}{ce{}{}}00{N`}{Nb}{{{b{N`}}}A`}{{{b{Nb}}}A`}10{{{b{N`}}}{{A@d{N`}}}}{{{b{Nb}}}{{A@d{Nb}}}}{{{b{N`}}}{{A@f{N`}}}}{{{b{Nb}}}{{A@f{Nb}}}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOl}}{b{de}}On}Gb{}Od}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOl}}{b{de}}On}Gb{}{}}{{{b{{Nj{}{{Nh{c}}}}}}}f{}}{{}Nf}{N`N`}{NbNb}{{{b{Nf}}{b{Nf}}}{{Dd{Of}}}}{c{{A@h{c}}}{}}{{{b{d{Nj{}{{Nh{c}}}}}}{b{dc}}{b{dNl}}{b{de}}{b{{Nj{}{{Nh{c}}}}}}}h{}{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dLh}}{b{de}}{b{{Ob{}{{Nh{c}}}}}}}h{}Od}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dLh}}{b{de}}{b{{Nj{}{{Nh{c}}}}}}}h{}{}}{{{b{dN`}}N`}h}{{{b{dNb}}Nb}h}{{{b{dN`}}N`A`}h}{{{b{dNb}}NbA`}h}{{N`N`}N`}{{NbNb}Nb}5410{{{b{c}}}e{}{}}00{{{b{c}}}Dh{}}{{{b{c}}}Dj{}}87{c{{Aj{e}}}{}{}}00000{{{b{c}}}Al{}}0065```````````````````````````````````````````````````{{ce}{{A@j{e}}}{{Cn{A@l}}}{}}````````````{i{{A@n{egc}}}{}{}{}{{Af{{b{dc}}{b{dOj}}{b{de}}{b{n}}}{{Jd{{Dd{g}}}}}}}}``````{{ce}{{AA`{e}}}{{Cn{{Lj{Cd}}}}}{}}`````````````````````````````````````````````````````{c{{A@j{c}}}{}}00{c{{AAb{c}}}{}}``1{A`AAd}`{{Cfc}{{AAf{e}}}{{Cn{AAh}}}{}}{{ce}{{AAj{gce}}}{}{}{}}```````````````{{}{{AAl{c}}}{}}`{{ce}{{AAn{e}}}{{Cn{On}}}{}}{c{{AA`{c}}}{}}```````````````````````````{{Gbc}{{AAf{e}}}{{Cn{AAh}}}{}}`{c{{AB`{c}}}{}}``0`{{ei}{{ABb{cgi}}}{}{{Af{{b{dc}}{b{dAf}}}}}{}{{Ob{g}}}}````````````````````````````````{{Cfc}{{AAn{c}}}{}}{c{{ABd{c}}}{}}{c{{ABf{c}}}{}}`{{}{{ABf{{O`{{Ah{Nd}}}}}}}}{{}{{ABf{{O`{c}}}}}{}}{c{{ABh{c}}}{}}`{{}{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABh{{O`{c}}}}}{}}````````````{c{{A@j{c}}}{}}````````````8{{ce}{{AAn{e}}}{{Cn{Gb}}}{}}9{{gk}{{ABj{cie}}}{}ABl{{Jj{{b{dc}}}{{Jd{e}}}}}{{Ob{c}}}{{Jj{{b{dc}}}{{Jd{i}}}}}}:1:`{{cg}{{ABn{ec}}}{}{}{{Af{{b{dNl}}{b{de}}}}}}{{eg}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{cg}{{ACb{ec}}}{}{}{{Af{{b{dOh}}{b{de}}}}}}`{{cg}{{ACd{ec}}}{}{}{{Af{{b{dOj}}{b{de}}{b{n}}}}}}0````2{{cg}{{ACf{ec}}}{}{}{{Af{{b{dLh}}{b{de}}}}}}3`{c{{ACh{c}}}Ob}`{{ce}{{ACj{e}}}{{Cn{ACl}}}{}}{{Cfc}{{ACj{c}}}{}}000`````{e{{AAf{c}}}{}{{Af{{b{dOh}}{b{dc}}}}}}`````{{Gbc}{{AAf{e}}}{{Cn{AAh}}}{}}<{{Cfc}{{ACn{c}}}{}}0`{{ce}{{ACn{e}}}{{Cn{AD`}}}{}}=`````{Cf{{ADb{c}}}{}}``````{c{{ADd{hc}}}{ADfEh}}{cADh{{Cn{Dh}}}}````{{}{{ADj{c}}}{}}`{{ce}{{ADl{c}}}{}{{Cn{Dh}}}}{c{{A@j{c}}}{}}00{{ADnc}{{ACn{c}}}{}}`{{MnA`g}{{A@n{ceCf}}}{}{}{{Af{{b{dOj}}{b{dc}}Cf}{{Jd{e}}}}}}````````{{Mng}{{A@n{ceCf}}}{}{}{{Af{{b{dOj}}{b{dc}}Cf}{{Jd{e}}}}}}009{c{{AE`{c}}}{}}`{c{{ABd{c}}}{}}{c{{ABf{c}}}{}}`{{}{{ABf{{O`{{Ah{Nd}}}}}}}}{{}{{ABf{{O`{c}}}}}{}}{c{{ABh{c}}}{}}`{{}{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABh{{O`{c}}}}}{}}{{Cfc}{{AAn{c}}}{}}````{{ei}{{`{{Ob{k}}}}}{}{{Af{}{{Jd{c}}}}}{{Ob{c}}}{{Af{{b{dc}}}{{Jd{g}}}}}{}}{g{{`{{Ob{i}}}}}En{{Ob{c}}}{{Af{{b{dc}}}{{Jd{e}}}}}{}}{{ek}{{AEb{gci}}}{}{{Af{}{{Jd{c}}}}}{}{{Ob{{Df{gc}}}}}{{Af{{b{dg}}{b{dc}}}{{Jd{i}}}}}}{i{{AEb{ceg}}}{}En{{Ob{{Df{ce}}}}}{{Af{{b{dc}}{b{de}}}{{Jd{g}}}}}}{{cg}{{AEd{g}}}{{Cn{Ll}}}{}{{Ob{e}}}}{e{{`{{Ob{{Df{gc}}}}}}}{}{{Ob{c}}}{}}{e{{`{{Ob{{Df{cg}}}}}}}{}{{Ob{c}}}{}}``````{c{{AEf{c}}}{}}````````````````````````````````````````````````````````{{{b{c}}}{{b{e}}}{}{}}0{{{b{dc}}}{{b{de}}}{}{}}0{{{b{AEh}}}AEh}{{{b{AEj}}}AEj}{{{b{c}}{b{de}}}h{}{}}0{{{b{c}}}h{}}0````{f{{b{c}}}{}}0{f{{b{dc}}}{}}0{{{b{AEj}}{b{AEl}}}{{O`{AEh}}}}{fh}0{{{b{AEh}}{b{AEh}}}A`}{{{b{AEh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AEj}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}0```{{}f}0{ce{}{}}0````````````{{{b{c}}}e{}{}}0{c{{Aj{e}}}{}{}}000{{{b{c}}}Al{}}0`````````````````{{{b{AEn}}}{{b{B`}}}}{{{b{c}}}{{b{e}}}{}{}}0000{{{b{dc}}}{{b{de}}}{}{}}0000`{{{b{Hh}}}AF`}{{c{b{Hh}}{b{AFb}}}I`{{Cn{{Dd{Hd}}}}}}{{{b{I`}}}I`}{{{b{Ih}}}Ih}{{{b{AEn}}}AEn}{{{b{Hd}}}Hd}{{{b{c}}{b{de}}}h{}{}}000{{{b{Hb}}{b{Hd}}}Hd}{{{b{Ih}}{b{Hd}}}Hd}{{{b{c}}}h{}}0000{{{b{AEn}}{b{AEn}}}Of}{{}I`}{{{b{Hb}}}Hf}{{{b{Ih}}}Hf}``{{}Ih}{f{{b{c}}}{}}0000{f{{b{dc}}}{}}0000`{{{b{Hb}}Al}{{Dd{h}}}}{{{b{Hb}}}{{Dd{{b{c}}}}}Ef}000{{{b{Ih}}}{{Dd{{b{c}}}}}Ef}{{{b{Ih}}}AFd}{{{b{dI`}}}h}{fh}0000{{{b{Hb}}Hd}h}{{{b{Ih}}Hd}h}{{{b{Hb}}{b{Hh}}}A`}{{{b{Ih}}{b{Hh}}}A`}`{{{b{Hb}}{b{Hd}}}h}{{{b{I`}}}AFf}{{{b{Ih}}{b{Hd}}}h}{I`AFh}{{{b{I`}}{b{I`}}}A`}{{{b{Hh}}{b{Hh}}}A`}{{{b{AEn}}{b{Ib}}}A`}{{{b{AEn}}{b{AEn}}}A`}{{{b{Hd}}{b{Hd}}}A`}```{{{b{Hb}}{b{Hj}}}h}{{{b{Ih}}{b{Hj}}}h}`{{{b{Hb}}{b{Hj}}}A`}`;9`{{{b{I`}}{b{c}}}{{Dd{Il}}}{JlOd}}{{{b{Hh}}}{{b{AFj}}}}{{{b{Hh}}}{{Dd{{b{B`}}}}}}{{{b{Ij}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{I`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Hh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ih}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AEn}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Hd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{I`}}c}{{b{I`}}}{{Cn{{Dd{Hd}}}}}}{cc{}}00{cIh{HbEhEj}}11{{{AFl{Gl}}}Hd}{{{b{B`}}}{{Aj{AEnAFn}}}}{GlHd}{{{b{AEn}}{b{Ib}}}A`}{{{b{AEn}}{b{AEn}}}A`}10{{{b{I`}}{b{c}}}A`{JlOd}}{{{b{I`}}{b{dc}}}hCb}{{{b{AEn}}{b{dc}}}hCb}{{{b{Hd}}{b{dc}}}hCb}{{{b{I`}}}{{Dd{Hd}}}}{Hl{{Hn{Hl}}}}{{{b{I`}}e}c{}{{Jj{}{{Jd{c}}}}}}``{{}f}0000`{{HlI`}{{Hn{Hl}}}}`{ce{}{}}0000{{{b{Hd}}}{{AFl{Gl}}}}{{{b{Hd}}}Gl}{{{b{Hb}}}A`}000{{{b{Ih}}}A`}{{{b{I`}}}A`}{{{b{Hh}}}A`}10{{{b{AEn}}{b{AEn}}}A`}{{{b{AEn}}{b{Ib}}}A`}{{{b{Hh}}}{{b{AEn}}}}`{{{b{Hh}}}{{Dd{Mj}}}}23{{{b{Hb}}}{{Dd{Ib}}}}`{{{b{Id}}}{{b{Hh}}}}{{{b{I`}}}{{Dd{{b{Hh}}}}}}`{{{b{Hh}}}{{Dd{{b{B`}}}}}}{{{b{Hh}}}{{b{B`}}}}{{{b{Hh}}{b{AFb}}}I`}{{{b{B`}}{b{B`}}AEn{Dd{{b{B`}}}}{Dd{Mj}}{Dd{{b{B`}}}}AFjAG`}Hh}{cIh{HbEhEj}}{{{b{Hh}}}I`}3{{{b{Hb}}{b{If}}}Hd}{{{b{Ih}}{b{If}}}Hd}{{}I`}{{}Ih}{{{b{Hb}}{b{Ih}}}h}{I`I`}{{{b{AEn}}{b{AEn}}}{{Dd{Of}}}}{{{b{AEn}}{b{Ib}}}{{Dd{Of}}}}{{{b{Ij}}{b{Il}}{b{dIn}}}h}{{{b{Hb}}{b{Hd}}{b{J`}}}h}{{{b{I`}}{b{c}}e}{{b{I`}}}{JlOd}Ij}{{{b{Ih}}{b{Hd}}{b{J`}}}h}{{{b{I`}}{b{AFb}}}{{b{I`}}}}{{{b{Hb}}{b{Hd}}{b{Hd}}}h}{{{b{Ih}}{b{Hd}}{b{Hd}}}h}{{{b{Hb}}{b{Hh}}}Jb}{{{b{Ih}}{b{Hh}}}Jb}{{{b{Id}}Jb}h}````{{{b{Hh}}}{{b{B`}}}}{{{b{c}}}e{}{}}000{{{b{c}}}Dh{}}{{{b{c}}}Dj{}}``{{{b{Hb}}Hd}A`}{{{b{Ih}}Hd}A`}{c{{Aj{e}}}{}{}}000000000{{{b{c}}}Al{}}0000``{{{b{I`}}e}{{Dd{c}}}{}{{Jj{{Df{{b{Hd}}{b{Ih}}}}}{{Jd{c}}}}}}```{{{b{c}}}{{b{e}}}{}{}}0{{{b{dc}}}{{b{de}}}{}{}}0{{{b{AF`}}}AF`}{{{b{c}}{b{de}}}h{}{}}{{{b{c}}}h{}}{f{{b{c}}}{}}0{f{{b{dc}}}{}}0{fh}0{{{b{AF`}}{b{AF`}}}A`}{{{b{AF`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AGb}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}0{{{b{AF`}}{b{dc}}}hCb}{{}f}0{{{b{AGb}}}Jb}{ce{}{}}0{{{b{Id}}}{{b{Hh}}}}{{{b{AGb}}}{{b{Hh}}}}{{{b{Hh}}}AGb}{{}h}{{{b{Id}}}h}6{{{b{Id}}Jb}h}{{{b{AGb}}Jb}h}{{{b{c}}}e{}{}}{c{{Aj{e}}}{}{}}000{{{b{c}}}Al{}}0````{{{b{c}}}{{b{e}}}{}{}}{{{b{dc}}}{{b{de}}}{}{}}{{{b{AFd}}}AFd}{{{b{c}}{b{de}}}h{}{}}{{{b{c}}}h{}}{f{{b{c}}}{}}{f{{b{dc}}}{}}{fh}{{{b{AFd}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}{ec{}{{Af{{b{Ih}}}{{Jd{c}}}}}}{{}f}{ce{}{}}{{{b{Ih}}}Jf}{Ih{{Aj{hJh}}}}{{{b{c}}}e{}{}}{c{{Aj{e}}}{}{}}0{{{b{c}}}Al{}}{{{b{AFd}}}{{Dd{Ih}}}}{{{b{Ih}}e}c{}{{Jj{}{{Jd{c}}}}}}`{{{b{c}}}{{b{e}}}{}{}}{{{b{dc}}}{{b{de}}}{}{}}{{c{b{Hh}}{b{AFb}}}h{{Cn{{Dd{Hd}}}}}}{f{{b{c}}}{}}{f{{b{dc}}}{}}{{{b{Hh}}{b{AFb}}}h}{fh}{{{b{Hj}}}AGd}{{{b{Hj}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}{{}f}{ce{}{}}{{{b{Hj}}}A`}0{{{b{Hj}}}{{b{Hh}}}}{{{b{Hh}}{b{AFb}}}Hj}{{c{b{Hh}}{b{AFb}}}Hj{{Cn{{Dd{Hd}}}}}}{{{b{Hj}}}{{Dd{{b{Hd}}}}}}{{{b{Hj}}{b{dIn}}}h}{c{{Aj{e}}}{}{}}0{{{b{c}}}Al{}}``````````{{{b{Jl}}{b{Hh}}}{{Dd{Il}}}}{{{b{{b{Il}}}}{b{Hh}}}{{Dd{Il}}}}{{{b{Il}}{b{Hh}}}{{Dd{Il}}}}{{{b{Il}}}{{b{B`}}}}{{{b{c}}}{{b{e}}}{}{}}000000{{{b{dc}}}{{b{de}}}{}{}}000000{{{b{AFb}}}AF`}{{{b{Il}}}AF`}{{{b{Il}}}Il}{{{b{{Kb{c}}}}}{{Kb{c}}}{AGfKd}}{{{b{{Jn{c}}}}}{{Jn{c}}}{AGfK`}}{{{b{c}}{b{de}}}h{}{}}00{{{b{c}}}h{}}00{{{b{AFj}}{b{Il}}}A`}{c{{Jn{c}}}K`}{f{{b{c}}}{}}000000{f{{b{dc}}}{}}000000{c{{Kb{c}}}Kd}{fh}000000{{{b{AFj}}{b{AFj}}}A`}{{{b{Il}}{b{Il}}}A`}{{{b{AGh}}{b{AGh}}}A`}{{{b{AFj}}{b{c}}}{{Dd{Il}}}{{AGj{B`}}Od}}{{{b{AFj}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AFb}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Il}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AGh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AGd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{{Kb{c}}}}{b{dBl}}}{{Aj{hBn}}}Kd}0{{{b{{Jn{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{cc{}}000000{{{b{Il}}{b{dc}}}hCb}{{}f}000000{ce{}{}}000000{{{b{AFj}}}}1{{{b{AFj}}}A`}{{{b{AFb}}}A`}{{{b{AFj}}}AGd}{{{b{AFj}}}f}{{{b{AFb}}}f}{{{b{Il}}}{{b{B`}}}}{{{b{{AGl{{b{B`}}}}}}AF`}AFj}{{{b{dAGd}}}{{Dd{Il}}}}{c{{AGn{e}}}{}{}}{{{b{Ij}}{b{Il}}{b{dIn}}}h}{{{b{AFb}}{b{dIn}}}h}{{{b{AGh}}{b{Il}}{b{dIn}}}h}{{{b{{Kb{c}}}}{b{Il}}{b{dIn}}}hKd}{{{b{{Jn{c}}}}{b{Il}}{b{dIn}}}hK`}{{{b{dIn}}{b{Il}}A`}h}{{{b{dIn}}{b{Il}}{b{K`}}}h}{{{b{dIn}}{b{Il}}{b{Kf}}}h}{{{b{dIn}}{b{Il}}Kh}h}{{{b{dIn}}{b{Il}}Kj}h}{{{b{dIn}}{b{Il}}Kl}h}{{{b{dIn}}{b{Il}}{b{B`}}}h}{{{b{dIn}}{b{Il}}Kn}h}{{{b{dIn}}{b{Il}}Gl}h}{{{b{c}}}e{}{}}00{{{b{c}}}Dh{}}000{{{b{c}}}Dj{}}000{c{{Aj{e}}}{}{}}0000000000000{{{b{c}}}Al{}}000000````{{{b{c}}}{{b{e}}}{}{}}0{{{b{dc}}}{{b{de}}}{}{}}0{{{b{{Lb{c}}}}}{{Lb{c}}}AGf}{{{b{{Hn{c}}}}}{{Hn{c}}}AGf}{{{b{c}}{b{de}}}h{}{}}0{{{b{c}}}h{}}0{f{{b{c}}}{}}0{f{{b{dc}}}{}}0{{{b{{Lb{c}}}}}{{b{Ih}}}{}}{fh}{{{b{d{Hn{c}}}}}h{}}1{{{b{{Lb{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{{{b{{Hn{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{cc{}}0{Hl{{Hn{Hl}}}}{{}f}0{{{b{{Lb{c}}}}}{{b{c}}}{}}{{{b{{Hn{c}}}}}{{b{c}}}{}}{{{b{d{Lb{c}}}}}{{b{dc}}}{}}{{{b{d{Hn{c}}}}}{{b{dc}}}{}}{{{AH`{{b{d{Lb{c}}}}}}}{{AH`{{b{dc}}}}}{}}{{{AH`{{b{d{Hn{c}}}}}}}{{AH`{{b{dc}}}}}{}}{{{AH`{{b{{Lb{c}}}}}}}{{AH`{{b{c}}}}}{}}{{{AH`{{b{{Hn{c}}}}}}}{{AH`{{b{c}}}}}{}}{{HlI`}{{Hn{Hl}}}}{ce{}{}}0{c{}{}}0{{{Lb{c}}}c{}}{{{Hn{c}}}c{}}{{{AH`{{b{d{Lb{c}}}}}}{b{dAHb}}}AHdADf}{{{AH`{{b{d{Hn{c}}}}}}{b{dAHb}}}AHdADf}{{{b{{Hn{c}}}}}{{b{I`}}}{}}{{{b{d{Hn{c}}}}}{{b{dI`}}}{}}{{{b{c}}}e{}{}}0{c{{Aj{e}}}{}{}}000{{{b{c}}}Al{}}0{L`{{Lb{L`}}}}{{L`c}{{Lb{L`}}}{{Cn{Ih}}}}``````````````````{{{b{c}}}{{b{e}}}{}{}}000{{{b{dc}}}{{b{de}}}{}{}}000{{{b{AG`}}}AG`}{{{b{Ib}}}Ib}{{{b{AHf}}}AHf}{{{b{c}}{b{de}}}h{}{}}00{{{b{c}}}h{}}000{{{b{Ib}}{b{Ib}}}Of}{{}Ib}{f{{b{c}}}{}}000{f{{b{dc}}}{}}000{fh}000{{{b{AG`}}{b{AG`}}}A`}{{{b{Ib}}{b{AEn}}}A`}{{{b{Ib}}{b{Ib}}}A`}{{{b{AG`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ib}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AHf}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AFn}}{b{dBl}}}{{Aj{hBn}}}}0{cc{}}0{{{Dd{AEn}}}Ib}{AEnIb}220{{{b{B`}}}{{Aj{Ib}}}}8998{{{b{Ib}}{b{dc}}}hCb}{AG`AG`}{{}f}000{ce{}{}}000{Ib{{Dd{AEn}}}}{{{b{AG`}}}A`}00>??>{{{b{Ib}}{b{AEn}}}{{Dd{Of}}}}{{{b{Ib}}{b{Ib}}}{{Dd{Of}}}}{{{b{c}}}e{}{}}00{{{b{c}}}Dh{}}00{{{b{c}}}Dj{}}00{c{{Aj{e}}}{}{}}0000000{{{b{c}}}Al{}}000```````{{{b{Ld}}}{{Dd{{b{Hd}}}}}}{{{b{c}}}{{b{e}}}{}{}}000{{{b{dc}}}{{b{de}}}{}{}}000{{Hd{b{Hh}}{b{AFb}}}If}{{{b{If}}{b{Il}}}A`}{{{b{J`}}{b{Il}}}A`}{f{{b{c}}}{}}0{{{b{AFh}}}{{b{I`}}}}11{f{{b{dc}}}{}}000{fh}{{{b{dAFf}}}h}{{{b{dAFh}}}h}222{AFhI`}{{{b{If}}}{{b{AFj}}}}{{{b{AFf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AFh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{If}}{b{dBl}}}{{Aj{hBn}}}}{{{b{J`}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}000{{{b{AFh}}}{{Dd{Hd}}}}{{}f}000{ce{}{}}000{{{b{If}}}A`}0{{{b{J`}}}A`}1{{{b{J`}}}f}{{{b{If}}}{{b{Hh}}}}{{{b{Hh}}{b{AFb}}}If}{{{b{AFb}}}J`}1{{{b{If}}}{{Dd{{b{Hd}}}}}}{{{b{If}}{b{dIn}}}h}{{{b{J`}}{b{dIn}}}h}{c{{Aj{e}}}{}{}}0000000{{{b{c}}}Al{}}000{{{b{If}}}{{b{AFb}}}}`````{{}Jb}{{{b{c}}}{{b{e}}}{}{}}000{{{b{dc}}}{{b{de}}}{}{}}000{{{b{Jb}}}Jb}{{{b{AHh}}}AHh}{{{b{c}}{b{de}}}h{}{}}0{{{b{Hb}}{b{Hd}}}Hd}{{{b{c}}}h{}}00{{{b{Hb}}}Hf}{{}AHh}{f{{b{c}}}{}}000{f{{b{dc}}}{}}000{{{b{Hb}}Al}{{Dd{h}}}}{fh}{{{b{dJf}}}h}111{{{b{Hb}}Hd}h}{{{b{Hb}}{b{Hh}}}A`}{{{b{AHh}}{b{Hh}}}A`}{{{b{Hb}}{b{Hd}}}h}{{{b{AHh}}{b{Hd}}}h}{{{b{Hb}}{b{Hj}}}h}{{{b{AHh}}{b{Hj}}}h}{{{b{Hb}}{b{Hj}}}A`}43{{{b{Jh}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Jf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Jb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AHh}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}000{{}f}000{ce{}{}}000{{{b{Jb}}}A`}00{{{b{Hb}}}{{Dd{Ib}}}}{{}Jb}{{}AHh}{{{b{Hb}}{b{If}}}Hd}{{{b{AHh}}{b{If}}}Hd}{{{b{Hb}}{b{Ih}}}h}{{{b{Hb}}{b{Hd}}{b{J`}}}h}{{{b{AHh}}{b{Hd}}{b{J`}}}h}{{{b{Hb}}{b{Hd}}{b{Hd}}}h}{{{b{AHh}}{b{Hd}}{b{Hd}}}h}{{{b{Hb}}{b{Hh}}}Jb}{{{b{AHh}}{b{Hh}}}Jb}{cJf{HbEhEj}}{c{{Aj{hJh}}}{HbEhEj}}<{{{b{c}}}e{}{}}0{{{b{c}}}Dh{}}{{{b{c}}}Dj{}}{{{b{Hb}}Hd}A`}{c{{Aj{e}}}{}{}}0000000{{{b{c}}}Al{}}000{{cg}e{HbEhEj}{}{{Jj{}{{Jd{e}}}}}}`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{b{Cd}}}D`}`{{{b{Oj}}}A`}{{CdCd}}{{AHjCf}}{{AHjGb}}{{AHjAD`}}{{C`AD`}}{{C`Gb}}{{GbCf}}{{GbAD`}}{{GbGb}}{{OnGb}}{{AD`AD`}}{{AD`Cf}}{{{b{dCd}}Cd}h}{{{b{dAHj}}Gb}h}{{{b{dAHj}}Cf}h}{{{b{dAHj}}AD`}h}{{{b{dC`}}Gb}h}{{{b{dC`}}AD`}h}{{{b{dGb}}Gb}h}{{{b{dGb}}Cf}h}{{{b{dGb}}AD`}h}{{{b{dOn}}Gb}h}{{{b{dAD`}}Cf}h}{{{b{dAD`}}AD`}h}{{{b{d{AHl{c}}}}e}h{}Ef}{{{b{d{AHl{c}}}}{b{dc}}{Ah{Af}}AEl}h{}}{{{ABn{ce}}g}{{ABn{ce}}}{}{}{{Af{{b{dNl}}{b{dc}}}}}}{{{ACd{ce}}g}{{ACd{ce}}}{}{}{{Af{{b{dOj}}{b{dc}}{b{n}}}}}}``{{ce}{{A@j{e}}}{{Cn{A@l}}}{}}{{A@lGbGb}AD`}{{AHnCfCf}Cf}{{{ABf{c}}e}{{ABf{c}}}{}{{Cn{AHn}}}}{{ADhc}ADh{{Cn{{Lj{AI`}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AI`}}}}}}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{AHn}}}}`````````{CfAIb}{CfAId}{CfACl}{CfAHj}{CfGb}{CfAD`}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cd}}}}}}```{{{AB`{c}}Cf}{{AB`{c}}}{}}`{AD`Cf}{{AD`AD`}Cf}{i{{A@n{egc}}}{}{}{}{{Af{{b{dc}}{b{dOj}}{b{de}}{b{n}}}{{Jd{{Dd{g}}}}}}}}{{{b{dNl}}}h}{{{b{dOj}}}h}{{{b{dLh}}}h}``{e{{Ah{Nd}}}{}{{Nd{c}}}}{{{b{AIf}}}A`}{AIh{{ABf{{O`{{Ah{Nd}}}}}}}}{AIh{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABf{{O`{{Ah{Nd}}}}}}}}0{C`Cf}{{{b{Nd}}}{{b{Ef}}}}{{{b{c}}}{{b{Ef}}}{}}0000000000000000000000000000000000{{{b{dOj}}}Nl}{{{b{dLh}}}Nl}{Fn{{Dd{AIj}}}}{{{b{AIl}}}AIn}{{{b{dLh}}}Ol}{{{b{dAJ`}}}{{b{dAJb}}}}{{{b{dOj}}}Lh}{{{b{AJ`}}}{{b{AJb}}}}{{{b{AJd}}}Gl}`{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{AIh}}}}{{{ABf{c}}e}{{ABf{c}}}{}{{Cn{AIh}}}}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{AIh}}}}`````{{{b{Cd}}}D`}{{ce}{{AA`{e}}}{{Cn{{Lj{Cd}}}}}{}}{{AAdc}AAd{{Cn{{Lj{Cd}}}}}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{Cd}}}}}}{{{AA`{c}}e}{{AA`{c}}}{}{{Cn{{Lj{Cd}}}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{Cd}}}}}}```````````{{{ACd{ce}}g}{{ACd{ce}}}{}{}{{Af{{b{dOj}}{b{dc}}{b{n}}}}}}`{{C`C`}}{{OnOn}}{{{b{dC`}}C`}h}{{{b{dOn}}On}h}`{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{Cd}}}}}}98{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cd}}}}}}87``````````````{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{AIb}}}}}}{{AAdc}AAd{{Cn{{Lj{AIb}}}}}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{AIb}}}}}}{{{AA`{c}}e}{{AA`{c}}}{}{{Cn{{Lj{AIb}}}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{AIb}}}}}}``````````````{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{AId}}}}}}{{AAdc}AAd{{Cn{{Lj{AId}}}}}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{AId}}}}}}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cf}}}}}}{{{AA`{c}}e}{{AA`{c}}}{}{{Cn{{Lj{AId}}}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{AId}}}}}}``````````````{{{b{c}}}{{b{e}}}{}{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{dc}}}{{b{de}}}{}{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{c{{A@j{c}}}{}}{C`Cf}``{C`AHj}20`20`{{{b{Cj}}}C`}{{{b{AJ`}}}Gb}{{{b{AJb}}}Gb}{{{b{d{Nj{}{{Nh{c}}}}}}{b{dNl}}{b{de}}}{{Df{c{O`{Nn}}}}}{}{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dNl}}{b{de}}}c{}Od}{{}{{AJf{c}}}{}}{{{AJf{c}}Dn}{{AHl{c}}}{}}{{{b{d{A@n{ceg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{dNl}}{b{dc}}}{}{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{dNl}}{b{de}}}{}Ob{}}{{{b{d{ACf{ce}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{dNl}}{b{dc}}}{}{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{dGj}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{A@h{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AJh{e}}}}{b{dNl}}{b{dc}}}{{AJj{ce}}}{}{{Nj{c}}}}{{{b{d{A@j{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AJl{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{dAAd}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{AC`{ceg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AAj{ceg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}{{Ob{c}}}}{{{b{d{AAl{c}}}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{AAn{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AB`{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ACj{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AAf{c}}}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{ABd{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ADb{c}}}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{ABf{e}}}}{b{dNl}}{b{dc}}}{}{}{{Nj{c}}}}{{{b{dADh}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{ADj{c}}}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{ADl{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ACn{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ABh{e}}}}{b{dNl}}{b{dc}}}{}{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{dNl}}{b{dc}}}{}{}{{Nj{c}}}}{c{{AAb{c}}}{}}{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{{Dd{AJn}}}}}}````{{{b{dOh}}}{{b{dAK`}}}}`{AHjAHj}{GbGb}{AD`AD`}{c{{A@j{c}}}{}}{C`AHj}00{{AHjGb}C`}{A`AAd}{{AAdc}AAd{{Cn{A`}}}}`{{{b{dNl}}}Nl}{{{b{dOh}}}Oh}{{{b{dOj}}}Oj}{{{b{dOl}}}Ol}{{{b{dLh}}}Lh}{{Cfc}{{AAf{e}}}{{Cn{AAh}}}{}}{{AHjCf}Cj}{{AHjAHjAHj}AHj}{{C`c}C`{{Cn{C`}}}}{{GbGbGb}Gb}{{AD`AD`AD`}AD`}{{{b{dAK`}}}h}{{{b{dCj}}}h}`{{{b{dAKb}}}{{b{dAKd}}}}{{{b{{AKf{c}}}}}{{AKf{c}}}Od}{{{b{AIb}}}AIb}{{{b{AId}}}AId}{{{b{AKh}}}AKh}{{{b{AKj}}}AKj}{{{b{AKl}}}AKl}{{{b{AAh}}}AAh}{{{b{Ch}}}Ch}{{{b{AK`}}}AK`}{{{b{Cd}}}Cd}{{{b{Cj}}}Cj}{{{b{AKn}}}AKn}{{{b{AL`}}}AL`}{{{b{ALb}}}ALb}{{{b{ALd}}}ALd}{{{b{ALf}}}ALf}{{{b{Fn}}}Fn}{{{b{G`}}}G`}{{{b{AIf}}}AIf}{{{b{AJd}}}AJd}{{{b{AJn}}}AJn}{{{b{ALh}}}ALh}{{{b{ALj}}}ALj}{{{b{ALl}}}ALl}{{{b{ALn}}}ALn}{{{b{AM`}}}AM`}{{{b{AMb}}}AMb}{{{b{Gn}}}Gn}{{{b{Gj}}}Gj}{{{b{ADn}}}ADn}{{{b{A@l}}}A@l}{{{b{AIh}}}AIh}{{{b{AHn}}}AHn}{{{b{AMd}}}AMd}{{{b{AMf}}}AMf}{{{b{ACl}}}ACl}{{{b{AHj}}}AHj}{{{b{C`}}}C`}{{{b{Gb}}}Gb}{{{b{On}}}On}{{{b{AD`}}}AD`}{{{b{AMh}}}AMh}{{{b{Ll}}}Ll}{{{b{{Lj{c}}}}}{{Lj{c}}}AGf}{{{b{AIl}}}AIl}{{{b{AMj}}}AMj}{{{b{AMl}}}AMl}{{{b{AMn}}}AMn}{{{b{AI`}}}AI`}{{{b{AN`}}}AN`}{{{b{ANb}}}ANb}{{{b{ANd}}}ANd}{{{b{Mn}}}Mn}{{{b{{A@h{c}}}}}{{A@h{c}}}AGf}{{{b{{AJh{c}}}}}{{AJh{c}}}AGf}{{{b{ANf}}}ANf}{{{b{ANh}}}ANh}{{{b{ANj}}}ANj}{{{b{ANl}}}ANl}{{{b{AEl}}}AEl}{{{b{ANn}}}ANn}{{{b{AO`}}}AO`}{{{b{c}}{b{de}}}h{}{}}0000000000000000000000000000000000000000000000000000000000000{{{b{c}}}h{}}00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{dCj}}}h}{{{b{d{AHl{c}}}}{b{dc}}ANj}A`{}}{{{b{d{l{c}}}}ANj}h{}}{{{b{dAKb}}c}h{EfEh}}{{{b{ALd}}c}h{EfEh}}{{{b{n}}}{{Dd{{b{c}}}}}Ef}{{{b{AKb}}e}h{EfEh}{{ADf{}{{Jd{c}}}}Eh}}{{{b{ALd}}e}h{EfEh}{{ADf{}{{Jd{c}}}}Eh}}{{{b{ALd}}E`}h}`{{ce}{{AAj{gce}}}{}{}{}}{{{b{dGj}}Cd}h}{{AElc}AEl{{Cn{{Dd{Cd}}}}}}{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{Cd}}}}}}{{AAdc}AAd{{Cn{{Lj{Cd}}}}}}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{Cd}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{Cd}}}}}}{{ADhc}ADh{{Cn{{Lj{Cd}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{Cd}}}}}}`````````````````{{}{{AAl{c}}}{}}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{Cf}}}}`{e{{Lj{c}}}{}{{Ed{{b{Ll}}}{{Jd{c}}}}EhEj}}{{{b{Mn}}CfA`}A`}{{{b{AMb}}}Gn}{{{b{dCj}}AHjAHjCf}h}{{ce}{{AAn{e}}}{{Cn{On}}}{}}{{OnOn}On}{{C`AHj}AHj}{c{{AA`{c}}}{}}{{{b{Cj}}AHjCh}A`}{{C`AHj}A`}{{{b{AKb}}}A`}{{{b{Nl}}}A`}{{{b{Oh}}}A`}{{{b{Oj}}}A`}{{{b{Ol}}}A`}{{{b{Lh}}}A`}{{{b{Nn}}}A`}{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{{A@h{e}}}}}}``````````````````````{{{b{AKb}}}{{b{c}}}Ef}{{{b{dAKb}}}{{b{dc}}}Ef}{{{b{dAKb}}}{{b{dc}}}{EfEn}}{{{b{AKb}}}{{b{El}}}}{{{b{dAKb}}}{{b{dEl}}}}`{{AD`AD`}Cf}`{{{b{dCj}}AHjAHjAHj}h}{{{b{Nn}}}{{Dd{ANf}}}}``{{}AMh}{{CdCf}Cd}{{{b{AMb}}}{{b{{AGl{D`}}}}}}{{{b{dAMb}}}{{b{d{AGl{D`}}}}}}`{{AElA`}AEl}`{{}{{AJf{c}}}{}}{{}AKd}{{}AIb}{{}AId}{{}AAh}{{}AK`}{{}Cd}{{}Cj}{{}ALb}{{}AIf}{{}AMb}{{}Gj}{{}ADn}{{}A@l}{{}AMf}{{}ACl}{{}AHj}{{}C`}{{}Gb}{{}On}{{}AD`}{{}AMh}{{}Ll}{{}AIl}{{}AMj}{{}AMl}{{}AMn}{{}AI`}{{}AN`}{{}AOb}{{}ANd}{{}Mn}{{}Nn}{{}ANf}{{}ANj}{{}ANl}{{}AEl}{{}{{AAl{c}}}{}}{{}AO`}{{}{{ADj{c}}}{}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{A`}}}}```{{{AJf{c}}e}{{AJf{c}}}{}{{j{c}}}}``{f{{b{c}}}{}}00{{{b{{l{c}}}}}b{}}1111{{{b{Nl}}}b}{{{b{Oh}}}b}33{{{b{Oj}}}b}4{{{b{Ol}}}b}5{{{b{Lh}}}b}66{{{b{{AOd{ce}}}}}b{}{{Ob{c}}Od}}7{{{b{{AJj{ce}}}}}b{}{{Nj{c}}}}888888888888888888888888888888888888888{{{b{AMb}}}b}9{{{b{Gj}}}b}:::::::::::::::::::::::::::{{{b{{A@h{c}}}}}b{}};{{{b{{AJh{c}}}}}b{}}<<<<<<<<<<<<<<<<<<<<<<<<{{{b{{ACj{c}}}}}b{}}================{f{{b{dc}}}{}}000{{{b{d{l{c}}}}}{{b{d}}}{}}11{{{b{dNl}}}{{b{d}}}}22{{{b{dOh}}}{{b{d}}}}{{{b{dOj}}}{{b{d}}}}44{{{b{dOl}}}{{b{d}}}}5{{{b{dLh}}}{{b{d}}}}6{{{b{d{AOd{ce}}}}}{{b{d}}}{}{{Ob{c}}Od}}7{{{b{d{AJj{ce}}}}}{{b{d}}}{}{{Nj{c}}}}888888888888888888888888888888888888888{{{b{dAMb}}}{{b{d}}}}999999999999999999999999999999{{{b{d{A@h{c}}}}}{{b{d}}}{}}:{{{b{d{AJh{c}}}}}{{b{d}}}{}};;;;;;;;;;;;;;;;;;;;;;;;{{{b{d{ACj{c}}}}}{{b{d}}}{}}<<<<<<<<<<<<<<<{{CdCf}Cd}{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{A`}}}}``{AMfCf}{{AHjAHj}Cf}{{AHjGb}}{{AHjAD`}}{{AHjCf}}{{GbGb}}{{GbCf}}{{GbAD`}}{{AD`AD`}}{{AD`Cf}}{{{b{dAHj}}AD`}h}{{{b{dAHj}}Cf}h}{{{b{dAHj}}Gb}h}{{{b{dGb}}Cf}h}{{{b{dGb}}Gb}h}{{{b{dGb}}AD`}h}{{{b{dAD`}}Cf}h}{{{b{dAD`}}AD`}h}{{AD`AD`}Cf}{{{b{Gj}}}Gd}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOh}}{b{de}}}h{}Od}{{{b{dNl}}}h}{{{b{dOj}}}h}{{{b{dLh}}}h}{{{b{d{A@n{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{d}}{b{dOh}}{b{de}}}hOb{}}{{{b{d{ACf{ce}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{dGj}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{A@h{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{A@j{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AJl{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{dAAd}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{AC`{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AAj{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}{{Ob{c}}}}{{{b{d{AAl{c}}}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{AAn{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AB`{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ACj{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AAf{c}}}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{AAf{c}}e}{{AAf{c}}}{}{{Cn{{Ah{Af}}}}}}{{{b{d{ABd{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ADb{c}}}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{ABf{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Nj{c}}}}{{{b{dADh}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{ADj{c}}}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{ADl{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ACn{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ABh{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Nj{c}}}}`{{{b{dAOb}}{b{dAK`}}{b{AJb}}CdAD`Cf}h}{{{b{dOh}}AK`}h}{{{b{dAK`}}AK`}h}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOh}}{b{de}}}h{}{}}{{{b{d{AJh{e}}}}f{b{d{AJj{ce}}}}{b{dOh}}{b{dc}}}h{}{{Nj{c}}}}{{{b{d{AHl{c}}}}{b{dc}}ANj}{{Dd{AOf}}}{}}{fh}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000`{{{b{dNd}}{b{dNl}}{b{dc}}}{{Ah{Ef}}}{}}{{{b{dc}}{b{dNl}}{b{de}}}{{Ah{Ef}}}{}{}}0000000000000000000000000000000000{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOh}}{b{dc}}}h{}}{{{b{dc}}{b{d{Ah{Ef}}}}{b{dOh}}{b{de}}}h{}{}}0000000000000000000000000000000000{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{dc}}{b{d{Ah{Ef}}}}{b{dOj}}{b{de}}{b{n}}}h{}{}}0000000000000000000000000000000000{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{dc}}{b{d{Ah{Ef}}}}{b{dOl}}{b{de}}On}Gb{}{}}0000000000000000000000000000000000{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dLh}}{b{dc}}{b{Nd}}}h{}}{{{b{dc}}{b{d{Ah{Ef}}}}{b{dLh}}{b{de}}{b{Nd}}}h{}{}}0000000000000000000000000000000000{CfMn}0`{{Gbc}{{AAf{e}}}{{Cn{AAh}}}{}}{C`Cj}{{{b{AIb}}{b{AIb}}}A`}{{{b{AId}}{b{AId}}}A`}{{{b{AKh}}{b{AKh}}}A`}{{{b{AKj}}{b{AKj}}}A`}{{{b{AKl}}{b{AKl}}}A`}{{{b{AAh}}{b{AAh}}}A`}{{{b{Ch}}{b{Ch}}}A`}{{{b{AK`}}{b{AK`}}}A`}{{{b{Cd}}{b{Cd}}}A`}{{{b{Cj}}{b{Cj}}}A`}{{{b{AKn}}{b{AKn}}}A`}{{{b{AL`}}{b{AL`}}}A`}{{{b{ALb}}{b{ALb}}}A`}{{{b{Fn}}{b{Fn}}}A`}{{{b{G`}}{b{G`}}}A`}{{{b{AIf}}{b{AIf}}}A`}{{{b{AJd}}{b{AJd}}}A`}{{{b{AJn}}{b{AJn}}}A`}{{{b{ALh}}{b{ALh}}}A`}{{{b{ALj}}{b{ALj}}}A`}{{{b{ALl}}{b{ALl}}}A`}{{{b{ALn}}{b{ALn}}}A`}{{{b{AM`}}{b{AM`}}}A`}{{{b{AMb}}{b{AMb}}}A`}{{{b{Gn}}{b{Gn}}}A`}{{{b{Gj}}{b{Gj}}}A`}{{{b{ADn}}{b{ADn}}}A`}{{{b{A@l}}{b{A@l}}}A`}{{{b{AIh}}{b{AIh}}}A`}{{{b{AHn}}{b{AHn}}}A`}{{{b{AMd}}{b{AMd}}}A`}{{{b{AMf}}{b{AMf}}}A`}{{{b{ACl}}{b{ACl}}}A`}{{{b{AHj}}{b{AHj}}}A`}{{{b{C`}}{b{C`}}}A`}{{{b{Gb}}{b{Gb}}}A`}{{{b{On}}{b{On}}}A`}{{{b{AD`}}{b{AD`}}}A`}{{{b{AIl}}{b{AIl}}}A`}{{{b{AMj}}{b{AMj}}}A`}{{{b{AMl}}{b{AMl}}}A`}{{{b{AMn}}{b{AMn}}}A`}{{{b{AI`}}{b{AI`}}}A`}{{{b{AN`}}{b{AN`}}}A`}{{{b{ANd}}{b{ANd}}}A`}{{{b{Mn}}{b{Mn}}}A`}{{{b{{A@h{c}}}}{b{{A@h{c}}}}}A`ABl}{{{b{{AJh{c}}}}{b{{AJh{c}}}}}A`ABl}{{{b{ANf}}{b{ANf}}}A`}{{{b{ANh}}{b{ANh}}}A`}{{{b{ANj}}{b{ANj}}}A`}{{{b{ANl}}{b{ANl}}}A`}{{{b{ANn}}{b{ANn}}}A`}`{{ANdCf}Cf}{{{b{dj}}{b{d{l{c}}}}{b{dc}}{b{n}}}A`{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOj}}{b{de}}{b{n}}}h{}Od}{{{b{d{AHl{c}}}}{b{dc}}{b{n}}}A`{}}{{{b{d{A@n{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{d}}{b{dOj}}{b{de}}{b{n}}}hOb{}}{{{b{d{ACf{ce}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{dGj}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{A@h{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{A@j{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AJl{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{dAAd}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{AC`{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{ANn}}}}{{{b{d{AAj{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}{{Ob{c}}}}{{{b{d{AAl{c}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{AAn{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AB`{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ACj{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AAf{c}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{ABd{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ADb{c}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{ABf{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Nj{c}}}}{{{b{dADh}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{ADj{c}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{ADl{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ACn{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ABh{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Nj{c}}}}`{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOj}}{b{de}}{b{n}}}h{}{}}{{{b{d{AJh{e}}}}f{b{d{AJj{ce}}}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Nj{c}}}}{c{{AB`{c}}}{}}{{OnGb}On}{{{b{dLl}}c}h{{Cn{Ll}}}}{{CdCf}Cd}{{{ADd{hc}}e}{{ADd{ec}}}{}{}}{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{Cf}}}}}}``{{{b{dOh}}CjChc}h{{Cn{AAh}}}}{{{b{dAK`}}cChe}h{{Cn{{Cl{Cj}}}}}{{Cn{AAh}}}}{{{b{dOh}}C`c}h{{Cn{AAh}}}}{{{b{AMb}}}A`}{GbGb}{{OnGb}Gb}{AElAEl}{{{b{Nn}}}Nb}=`{AHjAHj}4{AD`AD`}{{{b{AKd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AIb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AId}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AKh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AKj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AKl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AAh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ch}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AK`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Cd}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Cj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AKn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AL`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{n}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{G`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AIf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AJd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AJn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AM`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ADn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{A@l}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AIh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AHn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ACl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AHj}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{C`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gb}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{On}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AD`}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AMh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{{Lj{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{{{b{AIl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AI`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AN`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AJ`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AOb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Mn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{{A@h{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{{{b{{AJh{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{{{b{Nn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANj}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{ANl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AEl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AO`}}{b{dBl}}}{{Aj{hBn}}}}{{ei}{{ABb{cgi}}}{}{{Af{{b{dc}}{b{dAf}}}}}{}{{Ob{g}}}}{{{b{Oj}}}A`}{{{AJf{c}}e}{{AJf{c}}}{}{{Cn{ANb}}}}`{{ADhc}ADh{{Cn{{Lj{AIl}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AIl}}}}}}``````{{ADhc}ADh{{Cn{{Lj{Cf}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{Cf}}}}}}``````{{ADhc}ADh{{Cn{{Lj{AMl}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AMl}}}}}}``````{{ADhc}ADh{{Cn{{Lj{AMn}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AMn}}}}}}```````{{ADhc}ADh{{Cn{{Lj{AMj}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AMj}}}}}}``````{{{b{dAKb}}}{{b{dAOb}}}}{AHjAHj}{cc{}}0000000000000000000000000{{{AOh{Cf}}}AIb}1{CfAIb}{{{Df{CfCfCfCf}}}AIb}{CfAId}{{{AOh{Cf}}}AId}0{{{Df{CfCf}}}AId}{{{Df{CfCfCfCf}}}AId}7{GjAKh}888{GjAAh}{CdAAh}{AKhAAh};;;{{{AOh{Cf}}}Cd}<{{{Df{CfCfCfCf}}}Cd}={C`Cj}>>{CfALb}?????????????????{AMbGj}{cc{}}{{{AOh{Cf}}}A@l}1{{{Df{CfCf}}}A@l}2222{{{AOh{Cf}}}ACl}{CfACl}{{{Df{CfCfCfCf}}}ACl}2{{{Df{CfCf}}}ACl}6{{{Df{CfCf}}}AHj}{{{AOh{Cf}}}AHj}{AD`AHj}{GbAHj}{CfAHj};{{{AOh{Cf}}}C`}{GbC`}={CfGb}{AHjGb}{{{AOh{Cf}}}Gb}{{{Df{CfCf}}}Gb}{cc{}}{AD`Gb}1{GbOn}{AHjAD`}3{CfAD`}{GbAD`}{{{AOh{Cf}}}AD`}{{{Df{CfCf}}}AD`}7{AOjLl}{AMhLl}{AOlLl}{AOnLl}{B@`Ll}<{B@bLl}{B@dLl}{B@fLl}{B@hLl}{B@jLl}{B@lLl}{{{Df{CfCf}}}{{Lj{ACl}}}}{Dj{{Lj{AIl}}}}{{{Df{CfCfCfCf}}}{{Lj{AIb}}}}{Cf{{Lj{AIb}}}}{c{{Lj{c}}}{}}{{{AOh{Cf}}}{{Lj{ACl}}}}{{{Df{CfCfCfCf}}}{{Lj{ACl}}}}{{{AOh{Cf}}}{{Lj{AId}}}}{Cf{{Lj{AId}}}}{{{Df{CfCf}}}{{Lj{AId}}}}{Dh{{Lj{AIl}}}}5{{{AOh{Cf}}}{{Lj{AIb}}}}{Cf{{Lj{ACl}}}}{{{AKf{c}}}{{Lj{c}}}{}}{{{b{B`}}}{{Lj{AIl}}}}7{B@nc{}}{cc{}}{{{Df{CfCfCfCf}}}{{Lj{AId}}}}{DhAIl}{DjAIl}3{{{b{B`}}}AIl}4444444{{{b{{AGl{D`}}}}}ANb}{{{O`{D`}}}ANb}{{{b{B`}}}ANb}7{BA`ANb}{{{b{BAb}}}ANb}99{c{{A@h{c}}}{}};:;:{c{{AJh{c}}}{}};;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;{BAdADh}<<<<<<<<{CfAMf}{CfAD`}{{{b{c}}}AJdBAf}{D`{{Dd{G`}}}}{AJbAJ`}{AD`AMf}{GbOn}{BAhAJn}{GlAJd}`{{{b{Cd}}}D`}{{{ABf{c}}e}{{ABf{c}}}{}{{Cn{Cf}}}}{{{ABh{c}}Cf}{{ABh{c}}}{}}`{{{b{dAKd}}}Dj}{{{b{Ll}}{AKf{c}}}{{Dd{c}}}AGf}{{{b{{Lj{c}}}}{b{Ll}}}{{Dd{c}}}AGf}{{{b{Mn}}Cf}Cf}{{{b{AKb}}}{{Dd{{b{c}}}}}Ef}{{{b{dAKb}}}{{Dd{{b{dc}}}}}Ef}{{{b{Ll}}c{AKf{c}}}cAGf}{{{b{{Lj{c}}}}{b{Ll}}c}cAGf}{{{b{Ll}}e{AKf{c}}}cAGf{{Jj{}{{Jd{c}}}}}}{{{b{{Lj{c}}}}{b{Ll}}e}cAGf{{Jj{}{{Jd{c}}}}}}{{{b{AMb}}MjMj}{{AOh{D`}}}}{{{b{AEl}}AJd}{{Dd{{b{ANh}}}}}}{{{b{dAEl}}AJd}{{Dd{{b{dANh}}}}}}{{{b{Nl}}}{{Dd{{b{c}}}}}{}}{{{b{Oh}}}{{Dd{{b{c}}}}}{}}{{{b{Oj}}}{{Dd{{b{c}}}}}{}}{{{b{Ol}}}{{Dd{{b{c}}}}}{}}{{{b{Lh}}}{{Dd{{b{c}}}}}{}}{{{b{Nn}}}{{Dd{{b{c}}}}}{}}{{{b{dNl}}}{{Dd{{b{dc}}}}}{}}{{{b{dOh}}}{{Dd{{b{dc}}}}}{}}{{{b{dOj}}}{{Dd{{b{dc}}}}}{}}{{{b{dOl}}}{{Dd{{b{dc}}}}}{}}{{{b{dLh}}}{{Dd{{b{dc}}}}}{}}{{{b{dNn}}}{{Dd{{b{dc}}}}}{}}{{{b{{AHl{c}}}}ANj}{{Dd{{b{AEl}}}}}{}}{{{b{d{AHl{c}}}}ANj}{{Dd{{b{dAEl}}}}}{}}{CfCd}{{{b{Oj}}}A`}00{{{b{d{AHl{c}}}}{b{dc}}}h{}}{{{b{Nl}}}A`}{{{b{Oh}}}A`}3{{{b{Ol}}}A`}{{{b{Lh}}}A`}{{{b{{AJj{ce}}}}}A`{}{{Nj{c}}}}{{{b{Nn}}}A`}754732075473207{{{b{AKh}}{b{dc}}}hCb}{{{b{AKj}}{b{dc}}}hCb}{{{b{AKl}}{b{dc}}}hCb}{{{b{AAh}}{b{dc}}}hCb}{{{b{Ch}}{b{dc}}}hCb}{{{b{Cd}}{b{dc}}}hCb}{{{b{Cj}}{b{dc}}}hCb}{{{b{AKn}}{b{dc}}}hCb}{{{b{AL`}}{b{dc}}}hCb}{{{b{ALb}}{b{dc}}}hCb}{{{b{Fn}}{b{dc}}}hCb}{{{b{G`}}{b{dc}}}hCb}{{{b{AIf}}{b{dc}}}hCb}{{{b{AJd}}{b{dc}}}hCb}{{{b{AJn}}{b{dc}}}hCb}{{{b{ALh}}{b{dc}}}hCb}{{{b{ALj}}{b{dc}}}hCb}{{{b{ALl}}{b{dc}}}hCb}{{{b{ALn}}{b{dc}}}hCb}{{{b{AM`}}{b{dc}}}hCb}{{{b{AMb}}{b{dc}}}hCb}{{{b{Gn}}{b{dc}}}hCb}{{{b{Gj}}{b{dc}}}hCb}{{{b{ADn}}{b{dc}}}hCb}{{{b{AIh}}{b{dc}}}hCb}{{{b{AHn}}{b{dc}}}hCb}{{{b{AMd}}{b{dc}}}hCb}{{{b{AMf}}{b{dc}}}hCb}{{{b{AHj}}{b{dc}}}hCb}{{{b{C`}}{b{dc}}}hCb}{{{b{Gb}}{b{dc}}}hCb}{{{b{On}}{b{dc}}}hCb}{{{b{AD`}}{b{dc}}}hCb}{{{b{AIl}}{b{dc}}}hCb}{{{b{AMj}}{b{dc}}}hCb}{{{b{AMl}}{b{dc}}}hCb}{{{b{AMn}}{b{dc}}}hCb}{{{b{AI`}}{b{dc}}}hCb}{{{b{AN`}}{b{dc}}}hCb}{{{b{ANd}}{b{dc}}}hCb}{{{b{{A@h{c}}}}{b{de}}}hBAfCb}{{{b{{AJh{c}}}}{b{de}}}hBAfCb}{{{b{ANf}}{b{dc}}}hCb}{{{b{ANj}}{b{dc}}}hCb}{{{b{ANn}}{b{dc}}}hCb}{AD`AD`}`{{Cfc}{{AAn{c}}}{}}{{{b{AMb}}}Mj}{C`Cf}{{{b{AEl}}}Mj}{{{AAn{c}}Cf}{{AAn{c}}}{}}`{{{b{B`}}}Cd}0{c{{ABf{c}}}{}}{c{{ABh{c}}}{}}{{}{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABh{{O`{c}}}}}{}}{{{b{Oj}}}A`}{{{b{dOh}}e}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}Nfe}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}`{c{{ABd{c}}}{}}{{CfCfCf}Cd}0{{CfCfCfCf}Cd}09`{{}{{ABf{{O`{{Ah{Nd}}}}}}}}{{}{{ABf{{O`{c}}}}}{}}3322:`98{{AElc}AEl{{Cn{{Dd{Gj}}}}}}`{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{Cd}}}}}}``{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{Cf}}}}}}``{{{b{Nl}}}Nf}{{{b{Oh}}}Nf}{{{b{Oj}}}Nf}{{{b{Ol}}}Nf}{{{b{Lh}}}Nf}{{{b{Gj}}}Gn}{{{b{Nn}}}Nf}{{{b{ANh}}}AJd}{{{b{AEl}}}ANj}````{{{b{d{AHl{c}}}}{b{dc}}}h{}}{{{b{dj}}{b{d{l{c}}}}{b{dc}}}h{}}`{{{b{Nn}}}{{Dd{{b{F`}}}}}}{{C`AHj}C`}`{{C`Cf}C`}``{{}f}500040000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{dLl}}{b{B`}}{Lj{c}}}h{}}{{{b{dAKb}}c}{{Dd{c}}}Ef}{{{b{dNl}}c}h{}}{{{b{dOh}}c}h{}}{{{b{dOj}}c}h{}}{{{b{dOl}}c}h{}}{{{b{dLh}}c}h{}}{{{b{dNn}}c}h{}}{{{b{dLl}}{b{B`}}{b{B`}}}h}{{{b{dLl}}GlGl}h}{{{b{dLl}}{b{B`}}c}h{}}``{{C`C`}C`}{{C`C`}A`}{ce{}{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{Cj}}}}{ADnADn}{AMfAMf}{{{b{Fn}}Fn{Dd{G`}}}A`}{{{b{G`}}Fn{Dd{G`}}}A`}{{{b{Nl}}}A`}{{{b{Oh}}}A`}{{{b{Oj}}}A`}{{{b{Ol}}}A`}{{{b{Lh}}}A`}{{{b{Nn}}}A`}{{{b{Cj}}}A`}{{{b{n}}}A`}`1{{{b{{AJh{e}}}}}A`{}{{Nj{c}}}}{{{b{{ABf{{O`{c}}}}}}}A`{}}{{{b{{ABh{{O`{c}}}}}}}A`{}}{AHjA`}{GbA`}{OnA`}8=<;:98=<;:98{{{b{AEl}}Nf}A`}321{{{b{ALf}}c}A`Fl}{{{b{n}}c}A`Fl}0`5{{{b{AEl}}AJdAJn}A`}{{{b{ANh}}AJn}A`}`{CdA`}0={{{b{Oh}}C`}A`}`{{{b{Cj}}}Db}`{{{ABf{c}}e}{{ABf{c}}}{}{{Cn{AMd}}}}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{AMd}}}}``0`{{{b{B`}}}{{Lj{c}}}{}}`{{{b{d{AHl{c}}}}{b{dc}}ANjFn{Dd{G`}}{Dd{Dj}}A`}h{}}``{{{b{Cj}}}{{Dd{AHj}}}}{{{b{dAK`}}ADn{Dd{Bd}}{Dd{Nf}}e}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOl}}{b{de}}On}Gb{}Od}{{{b{dNl}}}h}{{{b{dOj}}}h}{{{b{dLh}}}h}{{{b{d{A@n{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{d}}{b{dOl}}{b{de}}On}GbOb{}}{{{b{d{ACf{ce}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{dGj}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{AMd{b{{AGl{Cf}}}}CfCf}H`}{{{b{d{A@h{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{A@j{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AJl{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{dAAd}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{AC`{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AAj{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}{{Ob{c}}}}{{{b{d{AAl{c}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{AAn{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AB`{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ACj{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AAf{c}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{ABd{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ADb{c}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{ABf{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Nj{c}}}}{{{b{dADh}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{ADj{c}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{ADl{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ACn{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ABh{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Nj{c}}}}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOl}}{b{de}}On}Gb{}{}}{{{b{d{AJh{e}}}}f{b{d{AJj{ce}}}}{b{dOl}}{b{dc}}On}Gb{}{{Nj{c}}}}{c{{A@j{c}}}{}}{C`Cf}``{{{b{{Nj{}{{Nh{c}}}}}}}f{}}{{{b{Cj}}}f}{{{b{{AJh{e}}}}}f{}{{Nj{c}}}}{{{b{{ABf{{O`{c}}}}}}}f{}}{{{b{{ABh{{O`{c}}}}}}}f{}}{AD`Cf}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{Cf}}}}}}``1{{AHjAHjCf}AHj}{{}AMh}{{CdCf}Cd}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cd}}}}}}``{{ADhc}ADh{{Cn{{Lj{Cf}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{Cf}}}}}}``````{{{b{dCj}}AHj}h}{CfMn}0{{{b{dAOb}}c}{{Aj{hBAj}}}{{Cn{ANb}}}}{{{b{Oj}}AHj}AHj}{OnOn}00{CdCf}{{{b{AIh}}c}Cf{{Cn{{Df{CfCf}}}}}}{{{b{dNn}}}h}00{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{{BAn{{BAl{}{{Jd{c}}}}}}}}}}{{{AA`{c}}e}{{AA`{c}}}{}{{Cn{{Lj{A`}}}}}}``{{{b{dOh}}cg}e{{Cn{Bd}}}{}{{Jj{{b{dOh}}}{{Jd{e}}}}}}{{{b{dAK`}}Bde}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}`{{AHjAHj}AHj}{{GbGb}Gb}{{AD`AD`}AD`}``{{{b{AIb}}}Cf}{GbCf}{{Cfc}{{AAn{c}}}{}}{{{AAn{c}}Cf}{{AAn{c}}}{}}{{ce}{{AAn{e}}}{{Cn{Gb}}}{}}{{AHjGb}C`}{{{AAn{c}}e}{{AAn{c}}}{}{{Cn{Gb}}}}43{{AElA`}AEl}`{{gk}{{ABj{cie}}}{}ABl{{Jj{{b{dc}}}{{Jd{e}}}}}{{Ob{c}}}{{Jj{{b{dc}}}{{Jd{i}}}}}}`;:9``876543265{{{b{AIh}}c}Cf{{Cn{{Df{CfCf}}}}}}`{{CdCdCf}Cd}0``````{{{b{d{AHl{c}}}}AIf}h{}}{{{b{dGj}}c}h{{Jj{{b{dAMb}}}}}}{{{b{dAEl}}AJdAHj}AD`}{{{b{dCj}}AHj}h}{{CdCf}}{{CdCd}}{{ADnAHj}}{{ADnAD`}}{{ADnADn}}{{AMfAD`}}{{AMfAMf}}{{AMfAHj}}{{AHjCf}}{{AHjAD`}}{{AHjGb}}{{GbAD`}}{{GbCf}}{{GbGb}}{{AD`Cf}}{{AD`AD`}}{{{b{dADn}}ADn}h}{{{b{dAHj}}Cf}h}{{{b{dAHj}}Gb}h}{{{b{dAHj}}AD`}h}{{{b{dGb}}Cf}h}{{{b{dGb}}AD`}h}{{{b{dGb}}Gb}h}{{{b{dAD`}}AD`}h}{{{b{dAD`}}Cf}h}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{A`}}}}`{{{b{dGj}}}h}{ANf{{b{B`}}}}{{{b{Nn}}}A`}00{AHj}{AD`}{{}{{AJf{c}}}{}}{{{Ah{Dl}}}AKd}{{{b{dEl}}{b{dALd}}}AKb}{{{b{dAKb}}{b{dNn}}}Nl}{{{b{dAKb}}{b{dNn}}{b{dAK`}}}Oh}{{{b{dAKb}}{b{dNn}}{b{dA`}}}Oj}{{{b{dAKb}}{b{dNn}}}Ol}{{{b{dAKb}}{b{dNn}}}Lh}{{{b{B`}}}{{AKf{c}}}Od}{i{{A@n{egc}}}{}{}{}{{Af{{b{dc}}{b{dOj}}{b{de}}{b{n}}}{{Jd{{Dd{g}}}}}}}}{c{{ABn{ec}}}{}{}}{c{{ACb{ec}}}{}{}}{c{{ACd{ec}}}{}{}}{{cg}{{ABb{eic}}}{}{}{{Af{{b{de}}{b{dAf}}}}}{}}{{gk}{{ABj{cie}}}{}ABl{{Jj{{b{dc}}}{{Jd{e}}}}}{{Ob{c}}}{{Jj{{b{dc}}}{{Jd{i}}}}}}{c{{ACh{c}}}Ob}{{cg}{{ACf{ec}}}{}{}{{Af{{b{dLh}}{b{de}}}}}}{c{{ADd{hc}}}{ADfEh}}{c{{AE`{c}}}{}}{{ek}{{AEb{gci}}}{}{{Af{}{{Jd{c}}}}}{}{}{{Af{{b{dg}}{b{dc}}}{{Jd{i}}}}}}{{Llc}{{AEd{c}}}{}}{{CfCfCfCf}AIb}{{CfCfCfCf}AId}{{}AK`}{{}Cj}{Dn{{Df{ALdEb}}}}{{{O`{D`}}MjMj}AMb}{{{O`{D`}}MjMj}Gj}{{CfCf}A@l}{{AD`AD`}AMf}{{CfCfCfCf}ACl}{{CfCf}AHj}{{AHjAHj}C`}{{CfCf}Gb}{{GbGb}On}{{CfCf}AD`}{{}Ll}{{{b{dAOb}}CfCf}AJ`}{{}AOb}{c{{A@h{c}}}{}}{c{{AJh{c}}}{}}{NfNn}{{AJdAHj}ANh}{{}ANj}{{}AEl}{{A@lc}{{A@j{c}}}{}}{{cCf}{{AJl{c}}}{}}{c{{AAb{c}}}{}}{A`AAd}{{eANng}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{ce}{{AAj{gce}}}{}{}{}}{{}{{AAl{c}}}{}}{{Onc}{{AAn{c}}}{}}{c{{AA`{c}}}{}}{{CfA`c}{{AB`{c}}}{}}{{ce}{{ACj{e}}}{{Cn{ACl}}}{}}{e{{AAf{c}}}{}{{Af{{b{dOh}}{b{dc}}}}}}{{AIhc}{{ABd{c}}}{}}{Cf{{ADb{c}}}{}}{{AIhc}{{ABf{c}}}{}}{cADh{{Cn{Dh}}}}{{}{{ADj{c}}}{}}{{ce}{{ADl{c}}}{}{{Cn{Dh}}}}{{ADnc}{{ACn{c}}}{}}{{AIhc}{{ABh{c}}}{}}{c{{AEf{c}}}{}}{AD`AD`}{{{b{ACl}}}AD`}{C`AD`}{{CfCfCf}Cd}0{{CfCfCfCf}Cd}0110011001100{{cg}{{ABn{ec}}}{}{}{{Af{{b{dNl}}{b{de}}}}}}{{eg}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{cg}{{ACb{ec}}}{}{}{{Af{{b{dOh}}{b{de}}}}}}{{{ACb{ce}}g}{{ACb{ce}}}{}{}{{Af{{b{dOh}}{b{dc}}}}}}`{{cg}{{ACd{ec}}}{}{}{{Af{{b{dOj}}{b{de}}{b{n}}}}}}0{{{AAl{c}}e}{{AAl{c}}}{}{{Af{{b{dOj}}{b{dc}}Cd}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Af{{b{dOj}}{b{dc}}Cf}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Af{{b{dOj}}{b{dc}}Dj}}}}```{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Af{{b{dOj}}{b{dc}}A`}}}}`7{{cg}{{ACf{ec}}}{}{}{{Af{{b{dLh}}{b{de}}}}}}82`{c{{ACh{c}}}Ob}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Dd{A`}}}}}}`{{AEle}BB`Ob{{Af{}{{Jd{c}}}}Eh}}{{{b{d{l{c}}}}AElg}h{}{{Nd{c}}}{{Af{{b{dc}}}{{Jd{e}}}}}}`{{{b{dOh}}BBbe}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}BBbe}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}{{{b{AIh}}CfCf}c{{BBd{{Df{CfCf}}}}}}{{ce}{{ACj{e}}}{{Cn{ACl}}}{}}{{Cfc}{{ACj{c}}}{}}000{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{ACl}}}}}}`````{e{{AAf{c}}}{}{{Af{{b{dOh}}{b{dc}}}}}}{{{b{AEl}}}Gb}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{Dj}}}}`{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{Cd}}}}}}``{c{{A@h{c}}}{}}{{{b{d{AHl{c}}}}{b{dc}}ANjAJdAJnA`}A`{}}{{{b{d{AHl{c}}}}{b{dc}}ANjAJd}h{}}{{{b{d{AHl{c}}}}{b{dc}}ANjAJdAHj}A`{}}{{{b{d{AHl{c}}}}{b{dc}}ANjAJdAD`}h{}}{{{b{AEl}}}{{b{{AGl{ANh}}}}}}{{{b{dAEl}}}{{b{d{O`{ANh}}}}}}{{{b{Cj}}}{{b{{AGl{AHj}}}}}}`````{GjGj}{{{b{dNn}}}h}{{{b{dAOb}}{b{AJb}}AD`Cf}h}{{{b{dOl}}{b{AJ`}}AD`}h}{{{b{dOl}}{b{AJb}}AD`}h}{{{b{dANh}}AJn}h}{{{b{dAEl}}AJdAJn}h}`{{{b{AK`}}}{{`{{BBf{}{{A@`{{b{Bf}}}}}}}}}}{{{b{dNn}}{b{dNn}}}h}{{{b{dNl}}c}{{b{dc}}}{}}{{{b{dOh}}c}{{b{dc}}}{}}{{{b{dOj}}c}{{b{dc}}}{}}{{{b{dOl}}c}{{b{dc}}}{}}{{{b{dLh}}c}{{b{dc}}}{}}{{{b{dNn}}c}{{b{dc}}}{}}{{{b{dNl}}}{{b{dc}}}En}{{{b{dOh}}}{{b{dc}}}En}{{{b{dOj}}}{{b{dc}}}En}{{{b{dOl}}}{{b{dc}}}En}{{{b{dLh}}}{{b{dc}}}En}{{{b{dNn}}}{{b{dc}}}En}{{{b{dNl}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dOh}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dOj}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dOl}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dLh}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dNn}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{AKb}}}ALd}{CfCf}{{{b{d{ABf{{O`{c}}}}}}c}h{}}{{{b{d{ABh{{O`{c}}}}}}c}h{}}{{{b{dCj}}C`}h}0{{{b{dCj}}C`AIbAId}h}{{{b{dCj}}C`AIb}h}{{{b{dOh}}C`cegi}h{{Cn{AAh}}}{{Cn{AIb}}}{{Cn{AId}}}{{Cn{AAh}}}}{{{b{dCj}}AHjAHj}h}{{{b{d{l{c}}}}}h{}}`{{{b{Cd}}}D`}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{BBh{Cf}}}}}}`{{{b{AJ`}}}{{b{AJb}}}}{{{b{dAJ`}}}{{b{dAJb}}}}{{{b{Lf}}{b{dLh}}{b{Lf}}}h}{{{b{d{Nj{}{{Nh{c}}}}}}{b{dc}}{b{dNl}}{b{de}}{b{{Nj{}{{Nh{c}}}}}}}h{}{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dLh}}{b{de}}{b{{Ob{}{{Nh{c}}}}}}}h{}Od}{{{b{d{AHl{c}}}}{b{dc}}}h{}}8{{{b{dOj}}}h}{{{b{d{A@n{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{A@n{ceg}}}}}h{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABn{ce}}}}}h{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACb{ce}}}}}h{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACd{ce}}}}}h{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABb{ceg}}}}}h{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABj{ceg}}}}}h{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{d}}{b{dLh}}{b{de}}{b{{ACh{c}}}}}hOb{}}{{{b{d{ACf{ce}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACf{ce}}}}}h{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ADd{eg}}}}}h{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AE`{e}}}}}h{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AEb{ceg}}}}}h{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AEd{e}}}}}h{}{{Ob{c}}}}{{{b{dGj}}{b{d}}{b{dLh}}{b{dc}}{b{Gj}}}h{}}{{{b{d{A@h{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{A@h{e}}}}}h{}{{Ob{c}}}}{{{b{d{AJh{e}}}}{b{d{AJj{ce}}}}{b{dNl}}{b{dc}}{b{{AJh{e}}}}}h{}{{Nj{c}}}}{{{b{d{A@j{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{A@j{e}}}}}h{}{{Ob{c}}}}{{{b{{A@j{c}}}}{b{dLh}}{b{{A@j{c}}}}}h{}}{{{b{{AJl{c}}}}{b{dLh}}{b{{AJl{c}}}}}h{}}{{{b{d{AJl{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AJl{e}}}}}h{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAb{e}}}}}h{}{{Ob{c}}}}{{{b{{AAb{c}}}}{b{dLh}}{b{{AAb{c}}}}}h{}}{{{b{dAOj}}{b{{AAb{c}}}}{b{dLh}}}h{}}{{{b{AAd}}{b{dLh}}{b{AAd}}}h}{{{b{dAAd}}{b{d}}{b{dLh}}{b{dc}}{b{AAd}}}h{}}{{{b{dB@d}}{b{AAd}}{b{dLh}}}h}{{{b{{AC`{ceg}}}}{b{dLh}}{b{{AC`{ceg}}}}}h{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AC`{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AC`{ceg}}}}}h{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{{AAj{ceg}}}}{b{dLh}}{b{{AAj{ceg}}}}}h{}{}{}}{{{b{d{AAj{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAj{ceg}}}}}h{}{{Ob{c}}}{{Ob{c}}}}{{{b{dAOl}}{b{{AAj{ceg}}}}{b{dLh}}}h{}{}{}}{{{b{{AAl{c}}}}{b{dLh}}{b{{AAl{c}}}}}h{}}{{{b{d{AAl{c}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAl{c}}}}}h{}}{{{b{dB@l}}{b{{AAl{c}}}}{b{dLh}}}h{}}{{{b{{AAn{c}}}}{b{dLh}}{b{{AAn{c}}}}}h{}}{{{b{d{AAn{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAn{e}}}}}h{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AA`{e}}}}}h{}{{Ob{c}}}}{{{b{{AA`{c}}}}{b{dLh}}{b{{AA`{c}}}}}h{}}{{{b{dB@h}}{b{{AA`{c}}}}{b{dLh}}}h{}}{{{b{d{AB`{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AB`{e}}}}}h{}{{Ob{c}}}}{{{b{{AB`{c}}}}{b{dLh}}{b{{AB`{c}}}}}h{}}{{{b{{ACj{c}}}}{b{dLh}}{b{{ACj{c}}}}}h{}}{{{b{d{ACj{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACj{e}}}}}h{}{{Ob{c}}}}{{{b{{AAf{c}}}}{b{dLh}}{b{{AAf{c}}}}}h{}}{{{b{d{AAf{c}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAf{c}}}}}h{}}{{{b{d{ABd{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABd{e}}}}}h{}{{Ob{c}}}}{{{b{{ABd{c}}}}{b{dLh}}{b{{ABd{c}}}}}h{}}{{{b{dB@f}}{b{{ABd{c}}}}{b{dLh}}}h{}}{{{b{{ADb{c}}}}{b{dLh}}{b{{ADb{c}}}}}h{}}{{{b{d{ADb{c}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ADb{c}}}}}h{}}{{{b{dAOn}}{b{{ADb{c}}}}{b{dLh}}}h{}}{{{b{d{ABf{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABf{e}}}}}h{}{{Nj{c}}}}{{{b{{ABf{c}}}}{b{dLh}}{b{{ABf{c}}}}}h{}}{{{b{dADh}}{b{d}}{b{dLh}}{b{dc}}{b{ADh}}}h{}}{{{b{dB@`}}{b{ADh}}{b{dLh}}}h}{{{b{d{ADj{c}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ADj{c}}}}}h{}}{{{b{dB@b}}{b{{ADj{c}}}}{b{dLh}}}h{}}{{{b{{ADl{c}}}}{b{dLh}}{b{{ADl{c}}}}}h{}}{{{b{d{ADl{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ADl{e}}}}}h{}{{Ob{c}}}}{{{b{dB@j}}{b{{ADl{c}}}}{b{dLh}}}h{}}{{{b{d{ACn{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACn{e}}}}}h{}{{Ob{c}}}}{{{b{{ACn{c}}}}{b{dLh}}{b{{ACn{c}}}}}h{}}{{{b{{ABh{c}}}}{b{dLh}}{b{{ABh{c}}}}}h{}}{{{b{d{ABh{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABh{e}}}}}h{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AEf{e}}}}}h{}{{Nj{c}}}}`{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dLh}}{b{de}}{b{{Nj{}{{Nh{c}}}}}}}h{}{}}{{{b{d{AJh{e}}}}f{b{d{AJj{ce}}}}{b{dLh}}{b{dc}}{b{{AJh{e}}}}}h{}{{Nj{c}}}}{{Gbc}{{AAf{e}}}{{Cn{AAh}}}{}}{{{b{Oh}}}C`}{{{b{Oj}}}C`}{{{b{Lh}}}C`}{{{b{dAK`}}C`c}h{{Cn{AAh}}}}{C`Cj}{{{b{AJ`}}}C`}{{{b{Nn}}}C`}{{{b{dANh}}AJn}A`}{{{b{dAEl}}AJdAJn}A`}{{AHjCf}}{{AHjGb}}{{AHjAD`}}{{GbCf}}{{GbGb}}{{GbAD`}}{{AD`AD`}}{{AD`Cf}}{{{b{dAHj}}Gb}h}{{{b{dAHj}}AD`}h}{{{b{dAHj}}Cf}h}{{{b{dGb}}Cf}h}{{{b{dGb}}Gb}h}{{{b{dGb}}AD`}h}{{{b{dAD`}}Cf}h}{{{b{dAD`}}AD`}h}{{{b{dAKb}}}{{Dd{c}}}Ef}{{{b{dAEl}}AJd}h}{{{b{dNl}}}{{Dd{c}}}{}}{{{b{dOh}}}{{Dd{c}}}{}}{{{b{dOj}}}{{Dd{c}}}{}}{{{b{dOl}}}{{Dd{c}}}{}}{{{b{dLh}}}{{Dd{c}}}{}}{{{b{dNn}}}{{Dd{c}}}{}}{{{b{d{AHl{c}}}}ANj}h{}}{{{b{dNn}}}h}00{{AElA`}AEl}`{{CfCfCf}Cd}0{{CfCfCfCf}Cd}0{{D`D`D`D`}Cd}{c{{A@j{c}}}{}}{C`Cf}``{{Cfc}{{ACn{c}}}{}}{CfADn}1{{{b{dOh}}Cfe}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}Cfe}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}{ADnADn}{AHjAHj}{C`C`}{GbGb}{AD`AD`}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{Cf}}}}`{{CdCf}Cd}{{ce}{{ACn{e}}}{{Cn{AD`}}}{}}{AD`ADn}{{AElCf}AEl}`{{{b{dOh}}AD`e}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}AD`e}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}`{{{b{dAKd}}c}h{{BBj{B`}}}}{{{b{dNl}}A`}A`}{{{b{dOj}}A`}A`}{{{b{dLh}}A`}A`}{{{b{dNn}}A`}h}{{{b{dAJ`}}AI`}h}{{{b{dAJ`}}{b{dAOb}}Gb}h}{{{b{dNl}}{Dd{ANf}}}h}{{{b{dOj}}{Dd{ANf}}}h}{{{b{dLh}}{Dd{ANf}}}h}{{{b{dNn}}{Dd{ANf}}}h}{{{b{dAMb}}A`}h}7:987:987{{{b{dOj}}{Dd{F`}}}h}{{{b{dNn}}{Dd{F`}}}h}{{{b{dAJ`}}{b{dAOb}}CfCf}h}{{{b{dAMb}}MjMj{AOh{D`}}}h}{{{b{dNn}}Gb}h}{{{b{dAJ`}}{b{dAOb}}{b{B`}}M`}h}{{{b{dNn}}ADn}h}{{{b{dAJ`}}{b{dAOb}}AN`}h}``{{C`Cf}C`}{{OnGb}On}{AD`AD`}{{ce}{{AAn{e}}}{{Cn{Gb}}}{}}{{{b{Oh}}}Gb}{{{b{Oj}}}Gb}{{{b{Lh}}}Gb}{{{b{AMb}}}Gb}{{{b{ACl}}}Gb}{C`Gb}{{{b{AJ`}}}Gb}{{{b{Nn}}}Gb}{{AElMjMj}AEl}{{AAdc}AAd{{Cn{{Lj{Cf}}}}}}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cf}}}}}}{{{AAf{c}}e}{{AAf{c}}}{}{{Cn{{Dd{Gb}}}}}}``````{{AElANl}AEl}`{Cf{{ADb{c}}}{}}3``{{{b{AEl}}}AEj}`{{{b{dAKb}}c}h{{ADf{}{{Jd{h}}}}Eh}}{{{b{ALd}}c}h{{ADf{}{{Jd{h}}}}Eh}}{{{b{Mn}}{b{dCf}}A`Cf}A`}{{{b{dOh}}Cjce}h{{Cn{ALb}}}{{Cn{AAh}}}}{{{b{dAK`}}ceg}h{{Cn{{Cl{Cj}}}}}{{Cn{ALb}}}{{Cn{AAh}}}}:``{{{b{dCj}}{b{Cj}}ALb}h}`{{{AJf{c}}e}{{AJf{c}}}{}{{Cn{Ll}}}}``{{{b{{AAb{c}}}}{b{Ll}}}AOj{}}{{{b{AAd}}{b{Ll}}}B@d}{{{b{{AAj{ceg}}}}{b{Ll}}}AOl{}{}{}}{{{b{{AAl{c}}}}{b{Ll}}}B@l{}}{{{b{{AA`{c}}}}{b{Ll}}}B@h{}}{{{b{{ABd{c}}}}{b{Ll}}}B@f{}}{{{b{{ADb{c}}}}{b{Ll}}}AOn{}}{{{b{ADh}}{b{Ll}}}B@`}{{{b{{ADj{c}}}}{b{Ll}}}B@b{}}{{{b{{ADl{c}}}}{b{Ll}}}B@j{}}{{{b{Nl}}}{{b{Ll}}}}{{{b{Oh}}}{{b{Ll}}}}{{{b{Oj}}}{{b{Ll}}}}{{{b{Ol}}}{{b{Ll}}}}{{{b{Lh}}}{{b{Ll}}}}{{AHjAD`}}{{AHjAHj}}{{AHjCf}}{{AHjGb}}{{C`Gb}}{{C`AD`}}{{GbCf}}{{GbGb}}{{GbAD`}}{{OnGb}}{{AD`Cf}}{{AD`AD`}}{{{b{dAHj}}Cf}h}{{{b{dAHj}}Gb}h}{{{b{dAHj}}AD`}h}{{{b{dC`}}Gb}h}{{{b{dC`}}AD`}h}{{{b{dGb}}Gb}h}{{{b{dGb}}Cf}h}{{{b{dGb}}AD`}h}{{{b{dOn}}Gb}h}{{{b{dAD`}}Cf}h}{{{b{dAD`}}AD`}h}``{c{{ADd{hc}}}{ADfEh}}`{{{b{d{AHl{c}}}}}{{`{{BBf{}{{A@`{{BBl{c}}}}}}}}}{}}{cADh{{Cn{Dh}}}}{{{b{dOh}}{b{AJ`}}CdAD`}h}{{ADhc}ADh{{Cn{Dh}}}}{{{ADj{c}}e}{{ADj{c}}}{}BBn}`````{{}{{ADj{c}}}{}}{{{b{dOh}}{b{AJb}}CdAD`}h}{{{AJf{c}}AMh}{{AJf{c}}}{}}`{{AElc}AElBBn}`{AI`BC`}{AN`BCb}{AMjBCd}{AMlBCf}{AMnBCh}{CdAn}{Cd{{Df{CfCfCf}}}}{Cd{{Df{CfCfCfCf}}}}1010101010{{{b{c}}}e{}{}}0000000000000000000000000000000000000000000000000000000000000{GbAHj}{AD`AHj}{Cd{{AOh{D`}}}}{AHjGb}{AD`Gb}{{{b{c}}}Dh{}}0000{Cd{{AOh{Cf}}}}{{{b{c}}}Dj{}}0000{AHjAD`}{GbAD`}{{ce}{{ADl{c}}}{}{{Cn{Dh}}}}{c{{A@j{c}}}{}}{C`Cf}``{C`AHj}20`20``{{ADnc}{{ACn{c}}}{}}{{{b{Oh}}}ADn}{{{b{Oj}}}ADn}{{{b{dCj}}ADn}h}{{C`ADn}C`}{{{b{Nn}}}ADn}``{{{b{dOh}}ADne}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}ADne}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}{{MnA`g}{{A@n{ceCf}}}{}{}{{Af{{b{dOj}}{b{dc}}Cf}{{Jd{e}}}}}}{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{Mn}}}}}}{{AAdc}AAd{{Cn{{Lj{Mn}}}}}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{Mn}}}}}}````````{{Mng}{{A@n{ceCf}}}{}{}{{Af{{b{dOj}}{b{dc}}Cf}{{Jd{e}}}}}}00{{ce}{{ACn{e}}}{{Cn{AD`}}}{}}{AD`ADn}{{{b{dNn}}AD`}h}{{{b{dOh}}AD`e}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}AD`e}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}`{c{{AE`{c}}}{}}{{{b{dOh}}C`}h}{{{b{dAK`}}C`Nf}h}{c{{Aj{e}}}{}{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{B`}}}{{Dd{Cd}}}}{{C`C`}{{Dd{C`}}}}22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222{{{b{c}}}Al{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{c{{AAn{c}}}{}}{{C`C`}C`}{{{b{AIh}}c}{{Df{CfCf}}}{{Cn{{Df{CfCf}}}}}}{{{b{Nn}}}N`}{{{b{d{AHl{c}}}}ANj}A`{}}{{{b{dAEl}}}{{O`{AEh}}}}{e{{Lj{c}}}{}{{Cn{c}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{Cf}}}}`{AIh{{ABf{{O`{c}}}}}{}}{AIh{{ABh{{O`{c}}}}}{}}{{}{{ABf{{O`{c}}}}}{}}0{{{b{Cj}}}{{b{{AGl{Bh}}}}}}{c{{ABf{c}}}{}}{c{{ABh{c}}}{}}{{}{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABh{{O`{c}}}}}{}}{{{b{AK`}}AHj}{{Dd{Nf}}}}{{AElA`}AEl}`{c{{ABd{c}}}{}}6`{{}{{ABf{{O`{{Ah{Nd}}}}}}}}96`54{{{b{ALd}}}h}``{{{b{Oj}}}A`}00`{{Cfc}{{AAn{c}}}{}}{{{b{AMb}}}Mj}{C`Cf}{{{b{AEl}}}Mj}{{{AAn{c}}Cf}{{AAn{c}}}{}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{Cf}}}}}}``````{{{AJf{c}}AEli}{{AJf{c}}}{}{}{}{{Ad{eg}{{Ab{c}}}}}}{{{b{Nl}}}{{b{AEl}}}}{{{b{Oh}}}{{b{AEl}}}}{{{b{Oj}}}{{b{AEl}}}}{{{b{Ol}}}{{b{AEl}}}}{{{b{Lh}}}{{b{AEl}}}}`{{{b{d{AHl{c}}}}{b{dc}}ANj{b{n}}}A`{}}{{{b{d{AHl{c}}}}{b{dc}}ANjA`}h{}}{{{b{dNl}}}{{b{dAEl}}}}{{{b{dOh}}}{{b{dAEl}}}}{{{b{dOj}}}{{b{dAEl}}}}{{{b{dOl}}}{{b{dAEl}}}}{{{b{dLh}}}{{b{dAEl}}}}{{{b{d{AHl{c}}}}{b{dc}}ANjMjMj}h{}}{{{b{d{AHl{c}}}}{b{dc}}ANjCf}h{}}{{{ABf{{O`{c}}}}c}{{ABf{{O`{c}}}}}{}}{{{ABh{{O`{c}}}}c}{{ABh{{O`{c}}}}}{}}{{ei}{{`{{Ob{k}}}}}{}{{Af{}{{Jd{c}}}}}{{Ob{c}}}{{Af{{b{dc}}}{{Jd{g}}}}}{}}{g{{`{{Ob{i}}}}}En{{Ob{c}}}{{Af{{b{dc}}}{{Jd{e}}}}}{}}{{ek}{{AEb{gci}}}{}{{Af{}{{Jd{c}}}}}{}{{Ob{{Df{gc}}}}}{{Af{{b{dg}}{b{dc}}}{{Jd{i}}}}}}{i{{AEb{ceg}}}{}En{{Ob{{Df{ce}}}}}{{Af{{b{dc}}{b{de}}}{{Jd{g}}}}}}{{cg}{{AEd{g}}}{{Cn{Ll}}}{}{{Ob{e}}}}{e{{`{{Ob{{Df{gc}}}}}}}{}{{Ob{c}}}{}}{e{{`{{Ob{{Df{cg}}}}}}}{}{{Ob{c}}}{}}{{ADhc}ADh{{Cn{{Lj{AN`}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AN`}}}}}}``````````````{c{{AEf{c}}}{}}``````````{e{{Lj{c}}}{}{{Ed{{b{Ll}}}{{Jd{c}}}}EhEj}}```{{{b{B`}}}{{Lj{c}}}{}}`````{e{{Lj{c}}}{}{{Cn{c}}}}`","D":"AIJnMn","p":[[1,"reference"],[0,"mut"],[1,"usize"],[1,"unit"],[10,"AppDelegate",2685,7064],[5,"DelegateCx",2685,7064],[6,"Event",2685,7065],[1,"bool"],[17,"Data"],[10,"IntoUiBuilder",6,7066],[10,"FnMut",7067],[5,"Box",7068],[6,"Result",7069],[5,"TypeId",7070],[5,"DisplayHex",76,7071],[1,"str"],[6,"AntiAlias",76,7072],[5,"Mask",76,7072],[6,"Primitive",76,7072],[6,"CurveVerb",76,7073],[6,"CurveSegment",76,7073],[5,"Formatter",7074],[5,"Error",7074],[5,"Rect",2685,7075],[10,"Hasher",7076],[5,"Color",2685,7071],[1,"f32"],[6,"FillRule",2685,7072],[5,"Curve",2685,7073],[5,"Arc",7077],[10,"Into",7078],[1,"u8"],[5,"CurveIter",76,7073],[6,"Option",7079],[1,"tuple"],[5,"SmolStr",7080],[5,"String",7081],[10,"ClipboardBackend",310,7082],[5,"CommandWaker",314,7083],[5,"Command",314,7083],[5,"CommandReceiver",314,7083],[10,"Fn",7067],[10,"Any",7070],[10,"Send",7084],[10,"Sync",7084],[5,"Contexts",367,7085],[10,"Default",7086],[5,"Ime",396,7087],[5,"KeyReleased",396,7088],[5,"PointerLeft",396,7089],[5,"WindowResized",396,7090],[5,"WindowScaled",396,7090],[5,"WindowMaximized",396,7090],[10,"IsKey",396,7088],[6,"Key",2685,7088],[6,"Code",2685,7088],[5,"Size",2685,7091],[5,"WeakImage",772,7092],[5,"TextureId",772,7093],[6,"Texture",772,7093],[5,"Image",2685,7092],[1,"u64"],[5,"ImageId",2685,7092],[5,"JustifyIterator",844,7094],[10,"Subscriber",1860,7095],[5,"Id",1860,7096],[5,"Current",7096],[5,"Metadata",1860,7097],[5,"Event",2155,7098],[10,"Instrument",1860,7099],[5,"Instrumented",2335,7099],[5,"Span",1860,7100],[5,"LevelFilter",2396,7097],[10,"Callsite",1860,7101],[5,"Attributes",2506,7096],[5,"Dispatch",1860,7102],[10,"Value",1860,7103],[5,"Field",2178,7103],[10,"Visit",2178,7103],[5,"Record",2506,7096],[5,"Interest",2584,7095],[17,"Output"],[5,"DefaultGuard",2584,7102],[5,"SetGlobalDefaultError",2584,7102],[10,"FnOnce",7067],[10,"AsField",2178,7104],[5,"DebugValue",2178,7103],[10,"Debug",7074],[5,"DisplayValue",2178,7103],[10,"Display",7074],[10,"Error",7105],[1,"f64"],[1,"i128"],[1,"i64"],[1,"u128"],[10,"WithSubscriber",2335,7099],[5,"WithDispatch",2335,7099],[10,"AsId",2506,7100],[10,"Rebuild",2685,7106],[5,"RebuildCx",2685,7107],[6,"Styled",2685,7108],[5,"Styles",2685,7108],[5,"AtlasGlyph",1074,7109],[5,"TextAttributes",1074,7110],[5,"FontAtlas",1074,7109],[5,"FontSystem",7111],[5,"SwashCache",7112],[5,"CacheKey",7113],[1,"u32"],[5,"Attrs",7114],[5,"Transition",2685,7115],[5,"Update",1182,7116],[5,"ViewFlags",1182,7116],[10,"AnyView",2685,7117],[5,"ViewId",1182,7116],[17,"State"],[10,"ViewSeq",2685,7118],[5,"BuildCx",2685,7119],[5,"ViewState",2685,7116],[5,"Vec",7120],[10,"View",2685,7121],[10,"Sized",7084],[6,"Ordering",7122],[5,"DrawCx",2685,7123],[5,"EventCx",2685,7124],[5,"LayoutCx",2685,7125],[5,"Space",2685,7126],[17,"Item"],[10,"IntoIterator",7127],[5,"Iter",7128],[5,"IterNames",7128],[5,"Pod",2685,7129],[5,"Aligned",2685,7130],[5,"Alignment",2685,7131],[5,"Animate",2685,7132],[5,"Container",2685,7133],[5,"Button",2685,7134],[5,"Checkbox",2685,7135],[5,"Painter",2685,7136],[5,"Paint",2685,7072],[5,"Collapsing",2685,7137],[5,"ColorPicker",2685,7138],[5,"Constrain",2685,7139],[5,"Flexible",2685,7140],[5,"Focus",2685,7141],[5,"Scroll",2685,7142],[5,"Stack",2685,7143],[5,"Wrap",2685,7144],[5,"Memo",2685,7145],[10,"PartialEq",7122],[5,"BuildHandler",2685,7146],[5,"Clickable",2685,7147],[5,"DrawHandler",2685,7148],[5,"EventHandler",2685,7149],[5,"RebuildHandler",2685,7150],[5,"Opaque",2685,7151],[5,"Pad",2685,7152],[5,"Padding",2685,7153],[5,"Transform",2685,7154],[5,"Vector",2685,7155],[5,"Slider",2685,7156],[5,"Suspense",2685,7157],[10,"Future",7158],[5,"Text",2685,7159],[5,"TextInput",2685,7160],[5,"Tooltip",2685,7161],[5,"Affine",2685,7162],[5,"Trigger",2685,7163],[5,"WithState",2685,7164],[5,"WithStyle",2685,7165],[5,"ZStack",2685,7166],[6,"WindowUpdate",1750,7167],[5,"WindowSnapshot",1750,7167],[5,"Window",2685,7167],[5,"Level",1860,7097],[5,"Identifier",2088,7101],[5,"ValueSet",2178,7103],[5,"WeakDispatch",2130,7102],[5,"Entered",2506,7100],[5,"EnteredSpan",2506,7100],[5,"FieldSet",2178,7103],[5,"NonZero",7168],[5,"ParseLevelError",2396,7097],[5,"Kind",2396,7097],[5,"DefaultCallsite",2088,7101],[5,"Iter",2178,7103],[10,"Clone",7169],[5,"Empty",2178,7103],[10,"Borrow",7170],[1,"slice"],[5,"IterBridge",7171],[5,"Pin",7172],[5,"Context",7173],[6,"Poll",7174],[5,"ParseLevelFilterError",2396,7097],[5,"NoSubscriber",2584,7095],[5,"Point",2685,7175],[5,"App",2685,7176],[6,"Align",2685,7094],[6,"TextAlign",2685,7110],[5,"BorderRadius",2685,7177],[5,"BorderWidth",2685,7177],[5,"Modifiers",2685,7178],[6,"Axis",2685,7179],[1,"char"],[6,"FontFamily",2685,7110],[6,"Family",7180],[5,"TextBuffer",2685,7181],[5,"Buffer",7182],[5,"PointerId",2685,7089],[5,"AppBuilder",2685,7183],[5,"PodSeq",2685,7118],[5,"SeqState",2685,7118],[5,"Aspect",2685,7184],[6,"PointerButton",2685,7089],[5,"Canvas",2685,7072],[5,"BaseCx",2685,7185],[5,"Clipboard",2685,7082],[5,"Style",2685,7108],[5,"Pattern",2685,7072],[6,"Shader",2685,7072],[6,"BlendMode",2685,7072],[6,"StrokeCap",2685,7186],[6,"StrokeJoin",2685,7186],[5,"Stroke",2685,7186],[5,"CommandProxy",2685,7083],[5,"KeyPressed",2685,7088],[5,"PointerMoved",2685,7089],[5,"PointerPressed",2685,7089],[5,"PointerReleased",2685,7089],[5,"PointerScrolled",2685,7089],[5,"CloseRequested",2685,7090],[5,"ImageData",2685,7187],[6,"Justify",2685,7094],[5,"Matrix",2685,7188],[5,"Theme",2685,7189],[5,"FontWeight",2685,7110],[6,"FontStretch",2685,7110],[6,"FontStyle",2685,7110],[6,"TextWrap",2685,7110],[6,"FontSource",2685,7190],[6,"Easing",2685,7115],[6,"Cursor",2685,7191],[5,"Pointer",2685,7192],[5,"WindowId",2685,7167],[6,"WindowSizing",2685,7167],[6,"ClickEvent",2685,7147],[5,"Flex",2685,7140],[5,"Fonts",2685,7193],[5,"State",2685,7129],[5,"WindowRenderState",6,7176],[1,"array"],[5,"ButtonStyle",2685,7134],[5,"CollapsingStyle",2685,7137],[5,"SliderStyle",2685,7156],[5,"TextStyle",2685,7159],[5,"TextInputStyle",2685,7160],[5,"CheckboxStyle",2685,7135],[5,"ScrollStyle",2685,7142],[5,"ContainerStyle",2685,7133],[5,"TooltipStyle",2685,7161],[5,"ColorPickerStyle",2685,7138],[1,"never"],[5,"PathBuf",7194],[5,"Path",7194],[5,"Arguments",7074],[10,"Hash",7076],[1,"u16"],[5,"Error",7195],[1,"fn"],[5,"PhantomData",7084],[6,"AppCommand",2685,7196],[1,"i32"],[10,"From",7078],[10,"Iterator",7197],[5,"RangeInclusive",7198],[10,"AsRef",7078],[6,"AppRequest",6,7199],[10,"ToString",7081],[6,"Align",7200],[6,"Wrap",7200],[5,"Weight",7180],[6,"Width",7201],[6,"Style",7180],[15,"Fill",300],[15,"Stroke",300],[15,"Layer",300]],"r":[[3,7202],[5,7202],[6,7176],[7,7183],[8,7196],[9,7064],[10,7199],[14,7064],[17,7066],[23,7066],[25,7176],[55,7203],[56,7203],[57,7203],[58,7203],[59,7203],[60,7203],[61,7203],[62,7203],[63,7203],[64,7203],[65,7203],[66,7203],[67,7203],[68,7203],[69,7203],[70,7203],[71,7203],[72,7203],[73,7203],[74,7203],[75,7203],[76,7072],[78,7072],[79,7177],[80,7177],[82,7072],[86,7071],[89,7073],[90,7073],[91,7073],[92,7073],[95,7071],[99,7072],[104,7072],[110,7072],[111,7072],[113,7072],[118,7072],[123,7186],[125,7186],[126,7186],[224,7071],[225,7071],[226,7071],[227,7071],[228,7071],[251,7071],[252,7071],[253,7071],[254,7071],[255,7071],[256,7071],[257,7071],[258,7071],[261,7071],[262,7071],[310,7082],[311,7082],[314,7083],[315,7083],[316,7083],[317,7083],[367,7185],[368,7119],[369,7085],[370,7123],[371,7124],[372,7125],[373,7107],[418,7090],[420,7088],[444,7065],[499,7087],[502,7088],[509,7088],[520,7088],[522,7088],[534,7178],[560,7089],[561,7089],[562,7089],[564,7089],[566,7089],[568,7089],[570,7089],[609,7090],[611,7090],[613,7090],[773,7092],[775,7187],[776,7092],[777,7093],[778,7093],[779,7092],[844,7162],[845,7094],[846,7131],[847,7179],[852,7204],[855,7094],[856,7094],[857,7188],[858,7153],[859,7175],[860,7075],[861,7091],[862,7126],[869,7155],[889,7204],[905,7101],[906,7102],[907,7098],[908,7096],[909,7099],[910,7097],[911,7097],[912,7100],[913,7095],[914,7103],[915,7205],[918,7206],[919,7206],[920,7206],[924,7206],[926,7206],[927,7206],[928,7205],[930,7206],[932,7206],[934,7206],[936,7206],[937,7206],[938,7206],[940,7207],[941,7206],[943,7205],[945,7205],[953,7206],[954,7206],[955,7206],[956,7206],[957,7206],[958,7206],[960,7206],[961,7206],[962,7101],[963,7101],[964,7101],[966,7101],[967,7101],[969,7102],[970,7102],[971,7102],[972,7102],[973,7102],[974,7102],[975,7102],[976,7102],[977,7098],[978,7104],[979,7103],[980,7103],[981,7103],[982,7103],[983,7103],[984,7103],[985,7103],[986,7103],[987,7103],[989,7103],[990,7103],[1001,7099],[1002,7099],[1003,7099],[1004,7099],[1009,7097],[1010,7097],[1011,7208],[1012,7097],[1013,7097],[1014,7097],[1015,7097],[1016,7097],[1017,7097],[1018,7100],[1019,7096],[1020,7100],[1021,7100],[1022,7096],[1023,7096],[1024,7100],[1026,7102],[1027,7095],[1028,7095],[1029,7102],[1030,7095],[1046,7209],[1047,7209],[1049,7209],[1050,7106],[1051,7202],[1054,7108],[1056,7108],[1057,7108],[1058,7189],[1062,7108],[1066,7108],[1072,7108],[1074,7109],[1085,7109],[1086,7110],[1087,7190],[1088,7110],[1089,7110],[1090,7110],[1091,7193],[1105,7110],[1106,7110],[1107,7181],[1108,7110],[1147,7202],[1175,7115],[1177,7115],[1179,7115],[1181,7115],[1184,7117],[1185,7117],[1186,7117],[1197,7129],[1198,7118],[1199,7118],[1200,7129],[1203,7116],[1204,7121],[1205,7116],[1206,7116],[1207,7118],[1208,7116],[1211,7117],[1344,7129],[1376,7130],[1377,7132],[1378,7184],[1379,7146],[1380,7134],[1381,7134],[1382,7135],[1383,7135],[1385,7147],[1386,7147],[1387,7137],[1388,7137],[1389,7138],[1390,7138],[1391,7139],[1392,7133],[1393,7133],[1394,7148],[1395,7149],[1396,7140],[1397,7140],[1398,7141],[1399,7141],[1400,7145],[1401,7151],[1402,7152],[1403,7136],[1405,7150],[1407,7142],[1408,7142],[1409,7156],[1410,7156],[1411,7143],[1412,7157],[1413,7159],[1414,7160],[1415,7160],[1416,7159],[1417,7161],[1418,7161],[1419,7154],[1420,7163],[1421,7164],[1422,7165],[1423,7144],[1424,7166],[1427,7130],[1440,7132],[1447,7133],[1501,7130],[1502,7130],[1503,7130],[1504,7134],[1507,7130],[1508,7135],[1510,7136],[1511,7137],[1527,7138],[1529,7139],[1530,7133],[1558,7136],[1560,7140],[1563,7140],[1565,7141],[1598,7139],[1599,7142],[1600,7143],[1601,7203],[1602,7143],[1603,7143],[1604,7144],[1605,7203],[1606,7144],[1607,7144],[1620,7130],[1633,7139],[1634,7139],[1635,7139],[1636,7145],[1637,7139],[1638,7139],[1639,7139],[1641,7146],[1642,7147],[1643,7148],[1645,7149],[1646,7149],[1651,7147],[1652,7150],[1653,7147],[1655,7151],[1657,7152],[1658,7152],[1659,7152],[1660,7152],[1661,7152],[1667,7136],[1673,7136],[1674,7130],[1675,7154],[1676,7154],[1678,7154],[1679,7139],[1685,7156],[1692,7157],[1693,7159],[1698,7160],[1700,7161],[1701,7130],[1702,7130],[1703,7130],[1704,7154],[1706,7132],[1715,7132],[1716,7132],[1717,7132],[1718,7154],[1719,7163],[1721,7142],[1722,7143],[1723,7203],[1724,7143],[1725,7143],[1726,7144],[1727,7203],[1728,7144],[1729,7144],[1730,7139],[1735,7164],[1736,7164],[1737,7164],[1738,7164],[1739,7165],[1740,7164],[1741,7164],[1748,7166],[1749,7203],[1760,7191],[1782,7192],[1798,7167],[1799,7167],[1800,7167],[1801,7167],[1802,7167],[1860,7101],[1862,7102],[1864,7098],[1866,7096],[1867,7099],[1868,7097],[1869,7097],[1870,7100],[1871,7095],[1873,7103],[1886,7205],[1908,7206],[1909,7206],[1921,7206],[1939,7206],[1949,7206],[1950,7206],[1951,7205],[1954,7206],[1956,7206],[1959,7206],[1992,7206],[1993,7206],[1999,7206],[2001,7207],[2021,7206],[2026,7205],[2029,7205],[2055,7206],[2056,7206],[2057,7206],[2058,7206],[2066,7206],[2067,7206],[2085,7206],[2086,7206],[2088,7101],[2089,7101],[2090,7101],[2118,7101],[2119,7101],[2130,7102],[2131,7102],[2132,7102],[2133,7102],[2144,7102],[2147,7102],[2148,7102],[2154,7102],[2155,7098],[2178,7104],[2179,7103],[2180,7103],[2181,7103],[2182,7103],[2183,7103],[2184,7103],[2185,7103],[2186,7103],[2187,7103],[2218,7103],[2233,7103],[2335,7099],[2336,7099],[2337,7099],[2338,7099],[2393,7097],[2394,7097],[2395,7208],[2401,7097],[2402,7097],[2403,7097],[2404,7097],[2406,7097],[2407,7097],[2506,7100],[2507,7096],[2508,7100],[2509,7100],[2510,7096],[2511,7096],[2512,7100],[2584,7102],[2585,7095],[2586,7095],[2587,7102],[2588,7095],[2664,7209],[2665,7209],[2684,7209],[2693,7162],[2696,7094],[2697,7130],[2698,7131],[2703,7132],[2705,7117],[2707,7176],[2708,7183],[2709,7196],[2710,7064],[2712,7184],[2713,7179],[2754,7185],[2756,7072],[2757,7177],[2758,7177],[2760,7117],[2763,7202],[2764,7119],[2765,7146],[2768,7134],[2769,7134],[2783,7072],[2791,7135],[2792,7135],[2796,7147],[2797,7147],[2798,7082],[2799,7090],[2802,7088],[2805,7137],[2806,7137],[2807,7071],[2808,7138],[2809,7138],[2812,7083],[2816,7139],[2817,7133],[2818,7133],[2827,7191],[2828,7073],[2837,7064],[2845,7123],[2846,7148],[2852,7115],[2865,7065],[2866,7124],[2867,7149],[2911,7204],[2931,7072],[2934,7140],[2935,7140],[2938,7141],[2939,7110],[2940,7190],[2941,7110],[2942,7110],[2943,7110],[2944,7193],[2971,7092],[2972,7187],[2973,7092],[2979,7094],[2985,7088],[2996,7088],[3011,7125],[3015,7141],[3021,7188],[3022,7145],[3027,7178],[3068,7151],[3077,7152],[3078,7153],[3083,7072],[3084,7136],[3087,7072],[3092,7129],[3093,7118],[3094,7175],[3095,7192],[3097,7089],[3098,7089],[3100,7089],[3102,7089],[3104,7089],[3106,7089],[3121,7106],[3122,7202],[3123,7107],[3124,7150],[3125,7075],[3153,7142],[3156,7142],[3163,7118],[3165,7072],[3167,7091],[3169,7156],[3170,7156],[3174,7126],[3181,7143],[3185,7129],[3189,7186],[3190,7186],[3191,7186],[3192,7108],[3194,7108],[3195,7202],[3196,7108],[3198,7157],[3215,7159],[3217,7110],[3218,7181],[3219,7160],[3220,7160],[3221,7159],[3222,7110],[3223,7189],[3224,7161],[3225,7161],[3227,7154],[3228,7115],[3229,7163],[3242,7155],[3245,7121],[3246,7118],[3247,7116],[3259,7167],[3260,7167],[3264,7167],[3265,7164],[3266,7165],[3268,7144],[3284,7166],[3323,7130],[3353,7132],[3359,7117],[3421,7133],[3747,7130],[3752,7130],[3755,7130],[3801,7134],[3812,7130],[3817,7135],[3825,7136],[4074,7137],[4100,7138],[4103,7108],[4107,7139],[4110,7133],[4159,7206],[4481,7202],[4852,7115],[4855,7136],[4910,7206],[4954,7140],[4970,7140],[5045,7141],[5414,7139],[5420,7071],[5430,7142],[5431,7071],[5433,7071],[5435,7143],[5436,7203],[5437,7143],[5438,7143],[5439,7071],[5441,7071],[5443,7144],[5444,7203],[5445,7144],[5446,7144],[5473,7202],[5476,7206],[5751,7202],[5779,7202],[5788,7202],[5797,7108],[5846,7130],[5875,7115],[5901,7139],[5903,7139],[5906,7139],[5910,7145],[5919,7139],[5921,7139],[5924,7139],[5930,7202],[6043,7071],[6045,7071],[6047,7071],[6049,7071],[6051,7071],[6053,7071],[6055,7071],[6057,7071],[6059,7146],[6060,7147],[6061,7148],[6064,7149],[6065,7149],[6074,7147],[6075,7150],[6076,7147],[6079,7151],[6088,7152],[6089,7152],[6090,7152],[6091,7152],[6092,7152],[6099,7136],[6106,7129],[6148,7204],[6237,7136],[6277,7071],[6279,7071],[6282,7130],[6286,7154],[6288,7154],[6299,7154],[6340,7139],[6361,7156],[6376,7203],[6379,7203],[6420,7157],[6423,7159],[6432,7160],[6536,7161],[6537,7130],[6542,7130],[6545,7130],[6548,7206],[6549,7154],[6559,7132],[6571,7132],[6572,7132],[6573,7132],[6574,7154],[6580,7163],[6957,7108],[6972,7142],[6973,7143],[6974,7203],[6975,7143],[6976,7143],[6977,7144],[6978,7203],[6979,7144],[6980,7144],[6982,7206],[6987,7202],[6988,7139],[7018,7164],[7019,7164],[7020,7164],[7021,7164],[7022,7165],[7023,7164],[7024,7164],[7041,7166],[7042,7203],[7044,7108],[7046,7108],[7047,7108],[7048,7189],[7052,7108],[7056,7108],[7062,7108]],"b":[[209,"impl-Debug-for-DisplayHex"],[210,"impl-Display-for-DisplayHex"],[815,"impl-From%3CImage%3E-for-Texture"],[816,"impl-From%3CTextureId%3E-for-Texture"],[1222,"impl-Update"],[1223,"impl-Flags-for-Update"],[1224,"impl-ViewFlags"],[1225,"impl-Flags-for-ViewFlags"],[1285,"impl-Binary-for-Update"],[1286,"impl-LowerHex-for-Update"],[1287,"impl-UpperHex-for-Update"],[1288,"impl-Debug-for-Update"],[1289,"impl-Octal-for-Update"],[1290,"impl-Octal-for-ViewFlags"],[1291,"impl-Binary-for-ViewFlags"],[1292,"impl-LowerHex-for-ViewFlags"],[1293,"impl-UpperHex-for-ViewFlags"],[1294,"impl-Debug-for-ViewFlags"],[1295,"impl-Debug-for-ViewId"],[1296,"impl-Display-for-ViewId"],[1302,"impl-Update"],[1303,"impl-Flags-for-Update"],[1304,"impl-ViewFlags"],[1305,"impl-Flags-for-ViewFlags"],[1923,"impl-dyn+Subscriber+%2B+Sync"],[1924,"impl-dyn+Subscriber+%2B+Send+%2B+Sync"],[1925,"impl-dyn+Subscriber+%2B+Send"],[1926,"impl-dyn+Subscriber"],[1946,"impl-PartialEq%3CLevelFilter%3E-for-Level"],[1947,"impl-PartialEq-for-Level"],[1963,"impl-Display-for-dyn+Value"],[1964,"impl-Debug-for-dyn+Value"],[1968,"impl-Debug-for-Level"],[1969,"impl-Display-for-Level"],[1981,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[1982,"impl-PartialOrd-for-Level"],[1983,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[1984,"impl-PartialOrd-for-Level"],[2009,"impl-dyn+Subscriber+%2B+Send+%2B+Sync"],[2010,"impl-dyn+Subscriber+%2B+Sync"],[2011,"impl-dyn+Subscriber+%2B+Send"],[2012,"impl-dyn+Subscriber"],[2018,"impl-PartialOrd-for-Level"],[2019,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[2023,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[2024,"impl-PartialOrd-for-Level"],[2043,"impl-PartialOrd-for-Level"],[2044,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[2189,"impl-AsField-for-%26Field"],[2190,"impl-AsField-for-Field"],[2245,"impl-Debug-for-FieldSet"],[2246,"impl-Display-for-FieldSet"],[2247,"impl-Debug-for-ValueSet%3C\'a%3E"],[2248,"impl-Display-for-ValueSet%3C\'a%3E"],[2249,"impl-Debug-for-Field"],[2250,"impl-Display-for-Field"],[2253,"impl-Debug-for-DisplayValue%3CT%3E"],[2254,"impl-Display-for-DisplayValue%3CT%3E"],[2444,"impl-PartialEq%3CLevel%3E-for-LevelFilter"],[2445,"impl-PartialEq-for-LevelFilter"],[2447,"impl-Display-for-LevelFilter"],[2448,"impl-Debug-for-LevelFilter"],[2449,"impl-Debug-for-ParseLevelFilterError"],[2450,"impl-Display-for-ParseLevelFilterError"],[2451,"impl-Debug-for-ParseLevelError"],[2452,"impl-Display-for-ParseLevelError"],[2455,"impl-From%3COption%3CLevel%3E%3E-for-LevelFilter"],[2456,"impl-From%3CLevel%3E-for-LevelFilter"],[2461,"impl-PartialOrd-for-LevelFilter"],[2462,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2463,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2464,"impl-PartialOrd-for-LevelFilter"],[2479,"impl-PartialOrd-for-LevelFilter"],[2480,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2481,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2482,"impl-PartialOrd-for-LevelFilter"],[2483,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2484,"impl-PartialOrd-for-LevelFilter"],[2632,"impl-Debug-for-SetGlobalDefaultError"],[2633,"impl-Display-for-SetGlobalDefaultError"],[3294,"impl-Add%3Cf32%3E-for-Point"],[3295,"impl-Add%3CSize%3E-for-Point"],[3296,"impl-Add%3CVector%3E-for-Point"],[3297,"impl-Add%3CVector%3E-for-Rect"],[3298,"impl-Add%3CSize%3E-for-Rect"],[3299,"impl-Add%3Cf32%3E-for-Size"],[3300,"impl-Add%3CVector%3E-for-Size"],[3301,"impl-Add-for-Size"],[3303,"impl-Add-for-Vector"],[3304,"impl-Add%3Cf32%3E-for-Vector"],[3306,"impl-AddAssign%3CSize%3E-for-Point"],[3307,"impl-AddAssign%3Cf32%3E-for-Point"],[3308,"impl-AddAssign%3CVector%3E-for-Point"],[3309,"impl-AddAssign%3CSize%3E-for-Rect"],[3310,"impl-AddAssign%3CVector%3E-for-Rect"],[3311,"impl-AddAssign-for-Size"],[3312,"impl-AddAssign%3Cf32%3E-for-Size"],[3313,"impl-AddAssign%3CVector%3E-for-Size"],[3315,"impl-AddAssign%3Cf32%3E-for-Vector"],[3316,"impl-AddAssign-for-Vector"],[4484,"impl-Div%3CSize%3E-for-Point"],[4485,"impl-Div%3CVector%3E-for-Point"],[4486,"impl-Div%3Cf32%3E-for-Point"],[4487,"impl-Div-for-Size"],[4488,"impl-Div%3Cf32%3E-for-Size"],[4489,"impl-Div%3CVector%3E-for-Size"],[4490,"impl-Div-for-Vector"],[4491,"impl-Div%3Cf32%3E-for-Vector"],[4492,"impl-DivAssign%3CVector%3E-for-Point"],[4493,"impl-DivAssign%3Cf32%3E-for-Point"],[4494,"impl-DivAssign%3CSize%3E-for-Point"],[4495,"impl-DivAssign%3Cf32%3E-for-Size"],[4496,"impl-DivAssign-for-Size"],[4497,"impl-DivAssign%3CVector%3E-for-Size"],[4498,"impl-DivAssign%3Cf32%3E-for-Vector"],[4499,"impl-DivAssign-for-Vector"],[4531,"impl-View%3CT%3E-for-Painter%3CT%3E"],[4532,"impl-Painter%3CT%3E"],[4933,"impl-View%3CT%3E-for-Clickable%3CT,+V,+F%3E"],[4934,"impl-Clickable%3CT,+V,+F%3E"],[4984,"impl-Debug-for-Color"],[4985,"impl-Display-for-Color"],[5013,"impl-Debug-for-Point"],[5014,"impl-Display-for-Point"],[5016,"impl-Display-for-Size"],[5017,"impl-Debug-for-Size"],[5019,"impl-Display-for-Vector"],[5020,"impl-Debug-for-Vector"],[5039,"impl-Display-for-WindowId"],[5040,"impl-Debug-for-WindowId"],[5118,"impl-From%3C%5Bf32;+4%5D%3E-for-BorderRadius"],[5120,"impl-From%3Cf32%3E-for-BorderRadius"],[5121,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-BorderRadius"],[5122,"impl-From%3Cf32%3E-for-BorderWidth"],[5123,"impl-From%3C%5Bf32;+4%5D%3E-for-BorderWidth"],[5124,"impl-From%3C%5Bf32;+2%5D%3E-for-BorderWidth"],[5125,"impl-From%3C(f32,+f32)%3E-for-BorderWidth"],[5126,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-BorderWidth"],[5132,"impl-From%3CImage%3E-for-Paint"],[5133,"impl-From%3CColor%3E-for-Paint"],[5134,"impl-From%3CPattern%3E-for-Paint"],[5138,"impl-From%3C%5Bf32;+4%5D%3E-for-Color"],[5140,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Color"],[5165,"impl-From%3C%5Bf32;+2%5D%3E-for-Alignment"],[5167,"impl-From%3C(f32,+f32)%3E-for-Alignment"],[5172,"impl-From%3C%5Bf32;+2%5D%3E-for-Padding"],[5173,"impl-From%3Cf32%3E-for-Padding"],[5174,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Padding"],[5175,"impl-From%3C%5Bf32;+4%5D%3E-for-Padding"],[5176,"impl-From%3C(f32,+f32)%3E-for-Padding"],[5178,"impl-From%3C(f32,+f32)%3E-for-Point"],[5179,"impl-From%3C%5Bf32;+2%5D%3E-for-Point"],[5180,"impl-From%3CVector%3E-for-Point"],[5181,"impl-From%3CSize%3E-for-Point"],[5182,"impl-From%3Cf32%3E-for-Point"],[5184,"impl-From%3C%5Bf32;+4%5D%3E-for-Rect"],[5185,"impl-From%3CSize%3E-for-Rect"],[5187,"impl-From%3Cf32%3E-for-Size"],[5188,"impl-From%3CPoint%3E-for-Size"],[5189,"impl-From%3C%5Bf32;+2%5D%3E-for-Size"],[5190,"impl-From%3C(f32,+f32)%3E-for-Size"],[5192,"impl-From%3CVector%3E-for-Size"],[5195,"impl-From%3CPoint%3E-for-Vector"],[5197,"impl-From%3Cf32%3E-for-Vector"],[5198,"impl-From%3CSize%3E-for-Vector"],[5199,"impl-From%3C%5Bf32;+2%5D%3E-for-Vector"],[5200,"impl-From%3C(f32,+f32)%3E-for-Vector"],[5202,"impl-From%3CButtonStyle%3E-for-Styles"],[5203,"impl-From%3CTheme%3E-for-Styles"],[5204,"impl-From%3CCollapsingStyle%3E-for-Styles"],[5205,"impl-From%3CSliderStyle%3E-for-Styles"],[5206,"impl-From%3CTextStyle%3E-for-Styles"],[5208,"impl-From%3CTextInputStyle%3E-for-Styles"],[5209,"impl-From%3CCheckboxStyle%3E-for-Styles"],[5210,"impl-From%3CScrollStyle%3E-for-Styles"],[5211,"impl-From%3CContainerStyle%3E-for-Styles"],[5212,"impl-From%3CTooltipStyle%3E-for-Styles"],[5213,"impl-From%3CColorPickerStyle%3E-for-Styles"],[5214,"impl-From%3C(f32,+f32)%3E-for-Styled%3CPadding%3E"],[5215,"impl-From%3CString%3E-for-Styled%3CFontFamily%3E"],[5216,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CBorderRadius%3E"],[5217,"impl-From%3Cf32%3E-for-Styled%3CBorderRadius%3E"],[5218,"impl-From%3CT%3E-for-Styled%3CT%3E"],[5219,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CPadding%3E"],[5220,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CPadding%3E"],[5221,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CBorderWidth%3E"],[5222,"impl-From%3Cf32%3E-for-Styled%3CBorderWidth%3E"],[5223,"impl-From%3C(f32,+f32)%3E-for-Styled%3CBorderWidth%3E"],[5224,"impl-From%3CSmolStr%3E-for-Styled%3CFontFamily%3E"],[5225,"impl-From%3C%5Bf32;+2%5D%3E-for-Styled%3CPadding%3E"],[5226,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CBorderRadius%3E"],[5227,"impl-From%3Cf32%3E-for-Styled%3CPadding%3E"],[5228,"impl-From%3CStyle%3CT%3E%3E-for-Styled%3CT%3E"],[5229,"impl-From%3C%26str%3E-for-Styled%3CFontFamily%3E"],[5230,"impl-From%3C%5Bf32;+2%5D%3E-for-Styled%3CBorderWidth%3E"],[5233,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CBorderWidth%3E"],[5234,"impl-From%3CSmolStr%3E-for-FontFamily"],[5235,"impl-From%3CString%3E-for-FontFamily"],[5237,"impl-From%3C%26str%3E-for-FontFamily"],[5245,"impl-From%3C%26%5Bu8%5D%3E-for-FontSource%3C\'a%3E"],[5246,"impl-From%3CVec%3Cu8%3E%3E-for-FontSource%3C\'_%3E"],[5247,"impl-From%3C%26str%3E-for-FontSource%3C\'a%3E"],[5249,"impl-From%3CPathBuf%3E-for-FontSource%3C\'_%3E"],[5250,"impl-From%3C%26Path%3E-for-FontSource%3C\'a%3E"],[5940,"impl-Mul%3Cf32%3E-for-Color"],[5941,"impl-Mul-for-Color"],[5942,"impl-Mul%3CPoint%3E-for-Affine"],[5943,"impl-Mul%3CVector%3E-for-Affine"],[5944,"impl-Mul-for-Affine"],[5945,"impl-Mul%3CVector%3E-for-Matrix"],[5946,"impl-Mul-for-Matrix"],[5947,"impl-Mul%3CPoint%3E-for-Matrix"],[5948,"impl-Mul%3Cf32%3E-for-Point"],[5949,"impl-Mul%3CVector%3E-for-Point"],[5950,"impl-Mul%3CSize%3E-for-Point"],[5951,"impl-Mul%3CVector%3E-for-Size"],[5952,"impl-Mul%3Cf32%3E-for-Size"],[5953,"impl-Mul-for-Size"],[5954,"impl-Mul%3Cf32%3E-for-Vector"],[5955,"impl-Mul-for-Vector"],[5957,"impl-MulAssign%3Cf32%3E-for-Point"],[5958,"impl-MulAssign%3CSize%3E-for-Point"],[5959,"impl-MulAssign%3CVector%3E-for-Point"],[5960,"impl-MulAssign%3Cf32%3E-for-Size"],[5961,"impl-MulAssign%3CVector%3E-for-Size"],[5962,"impl-MulAssign-for-Size"],[5963,"impl-MulAssign-for-Vector"],[5964,"impl-MulAssign%3Cf32%3E-for-Vector"],[6185,"impl-View%3CT%3E-for-Aligned%3CV%3E"],[6186,"impl-Rebuild-for-Aligned%3CV%3E"],[6187,"impl-Rebuild-for-Aspect%3CV%3E"],[6188,"impl-View%3CT%3E-for-Aspect%3CV%3E"],[6189,"impl-View%3CT%3E-for-Button%3CV%3E"],[6190,"impl-Rebuild-for-Button%3CV%3E"],[6192,"impl-Rebuild-for-Checkbox"],[6193,"impl-View%3CT%3E-for-Checkbox"],[6195,"impl-Rebuild-for-Clickable%3CT,+V,+F%3E"],[6196,"impl-View%3CT%3E-for-Clickable%3CT,+V,+F%3E"],[6197,"impl-Rebuild-for-Collapsing%3CT,+H,+V%3E"],[6198,"impl-View%3CT%3E-for-Collapsing%3CT,+H,+V%3E"],[6200,"impl-Rebuild-for-ColorPicker%3CT%3E"],[6201,"impl-View%3CT%3E-for-ColorPicker%3CT%3E"],[6203,"impl-Rebuild-for-Constrain%3CV%3E"],[6204,"impl-View%3CT%3E-for-Constrain%3CV%3E"],[6205,"impl-View%3CT%3E-for-Container%3CV%3E"],[6206,"impl-Rebuild-for-Container%3CV%3E"],[6208,"impl-View%3CT%3E-for-Flexible%3CV%3E"],[6209,"impl-Rebuild-for-Flexible%3CV%3E"],[6210,"impl-Rebuild-for-Pad%3CV%3E"],[6211,"impl-View%3CT%3E-for-Pad%3CV%3E"],[6212,"impl-Rebuild-for-Painter%3CT%3E"],[6213,"impl-View%3CT%3E-for-Painter%3CT%3E"],[6214,"impl-View%3CT%3E-for-Scroll%3CV%3E"],[6215,"impl-Rebuild-for-Scroll%3CV%3E"],[6217,"impl-Rebuild-for-Slider%3CT%3E"],[6218,"impl-View%3CT%3E-for-Slider%3CT%3E"],[6220,"impl-View%3CT%3E-for-Stack%3CV%3E"],[6221,"impl-Rebuild-for-Stack%3CV%3E"],[6226,"impl-Rebuild-for-Tooltip%3CV%3E"],[6227,"impl-View%3CT%3E-for-Tooltip%3CV%3E"],[6229,"impl-View%3CT%3E-for-Transform%3CV%3E"],[6230,"impl-Rebuild-for-Transform%3CV%3E"],[6231,"impl-Rebuild-for-Wrap%3CV%3E"],[6232,"impl-View%3CT%3E-for-Wrap%3CV%3E"],[6247,"impl-Rem%3Cf32%3E-for-Point"],[6248,"impl-Rem%3CSize%3E-for-Point"],[6249,"impl-Rem%3CVector%3E-for-Point"],[6250,"impl-Rem%3Cf32%3E-for-Size"],[6251,"impl-Rem-for-Size"],[6252,"impl-Rem%3CVector%3E-for-Size"],[6253,"impl-Rem-for-Vector"],[6254,"impl-Rem%3Cf32%3E-for-Vector"],[6255,"impl-RemAssign%3CSize%3E-for-Point"],[6256,"impl-RemAssign%3CVector%3E-for-Point"],[6257,"impl-RemAssign%3Cf32%3E-for-Point"],[6258,"impl-RemAssign%3Cf32%3E-for-Size"],[6259,"impl-RemAssign-for-Size"],[6260,"impl-RemAssign%3CVector%3E-for-Size"],[6261,"impl-RemAssign%3Cf32%3E-for-Vector"],[6262,"impl-RemAssign-for-Vector"],[6395,"impl-Sub%3CVector%3E-for-Point"],[6396,"impl-Sub-for-Point"],[6397,"impl-Sub%3Cf32%3E-for-Point"],[6398,"impl-Sub%3CSize%3E-for-Point"],[6399,"impl-Sub%3CSize%3E-for-Rect"],[6400,"impl-Sub%3CVector%3E-for-Rect"],[6401,"impl-Sub%3Cf32%3E-for-Size"],[6402,"impl-Sub-for-Size"],[6403,"impl-Sub%3CVector%3E-for-Size"],[6405,"impl-Sub%3Cf32%3E-for-Vector"],[6406,"impl-Sub-for-Vector"],[6407,"impl-SubAssign%3Cf32%3E-for-Point"],[6408,"impl-SubAssign%3CSize%3E-for-Point"],[6409,"impl-SubAssign%3CVector%3E-for-Point"],[6410,"impl-SubAssign%3CSize%3E-for-Rect"],[6411,"impl-SubAssign%3CVector%3E-for-Rect"],[6412,"impl-SubAssign-for-Size"],[6413,"impl-SubAssign%3Cf32%3E-for-Size"],[6414,"impl-SubAssign%3CVector%3E-for-Size"],[6416,"impl-SubAssign%3Cf32%3E-for-Vector"],[6417,"impl-SubAssign-for-Vector"]],"c":"OjAAAAEAAAAAAAQAEAAAAJsDCwSQB5EHPwo=","e":"OzAAAAEAAFIOUAEbAAMAIQAFACsAAAAtAAAAMgAFAIIAAACHAA0AmQAVALIAGwDPAAYA2QAAAN8AAQDnAAYA9QAAAPsAAAAKAQgAFwEUAD8BFABXAQAAWQECAGQBBgBsAQIAdwEBAHoBBACDAQAAigEIAJQBAQCXAQsApgEBAKkBEwC+ASgA6AELAPUBAQD4AQUA/wEJAA0CCQAYAg4AKAIIAD4CDQBNAgsAWgIEAGACAQBoAgQAbgILAH0CFACWAgAAmQIcALwCAwDGAgUA6AIXAA0DIAAwAwEANAMBADcDAgBAAwsAaAMBAGsDAgBwAwAAcgMAAHkDAAB+AwIAWQQMAGcECgBzBAIAfQQCAIoECgDIBAAAygQAAM8EBQDXBAwA6AQIAPUEAgD/BAIABgULABgFAAAaBQAAIQUFADAFAQBABQAATwUEAFYFCADXBgQA3gYCAOQGAgDoBgIA7gYIAPgGAQD7BgEA/gYAAAAHAQADBwAABQcBAAwHCwAcBwMAIQcEACsHAQA7BwcAVQcJAGIHBwBsBwUAeAcJAIoHBQCZBwQArAcHALgHAAC8BwAAvgcDAMMHAgDLBwQA4wcBAOgHAQD8BwEADQgFABcIDgAsCA8APggCAEUIAABLCAcAVwgIAGIIAABmCAMAbQgBAHAIAQBzCAAAdQgAAHcIAACACAIAjggQAKEICACsCA0AuwgJAMYICgDYCAcA5wgBAPAIAQD0CAIAAAkfACQJDQAzCQQAOwkBAEgJAQBMCQEAUAkHAGwJEgCACRUAmAkBAJ0JBQCkCQMAsAkaANMJBwDeCQ4A7wkDAPgJAwAMCgsAHwoLACwKAgAwCggAOgoEAEEKAABDCgAARQoAAEgKBQBSCgMAYQoAAGQKAABmCgAAaAoAAGwKAwBxCgsAfgoCAIUKAACHCgEAjAoDAJMKAACYCgAAmwoBAKIKAACkCgAAvwoDAMgKAADKCgEA0woAANwKAwDhCgIA5woAAOsKAAD0CgEA+woAAP4KAAAFCwUADgsDABQLAQAXCwEAGwsBACALAQAmCwIALAsEADULAQA6CyQAdQsAAHkLAQCDCw0AkgsBAJkLAQCfCwEAogsBAKULAACnCwIAqwsJALgLAgDCCwEAxQsCAMoLAQDQCwIA1gsBAN0LAADfCwIA5gsRAPoLAQAADAAABAwBAAgMAwAODAAAEgwCABkMAAAnDAIAKwwDADAMAQA3DAAAOQwDAD8MAwBHDAAASQwHAFMMAQBWDAAAWAwAAFsMAABfDAAAYQwAAGgMAQB+DAAAgAwDAIwMAgCRDAAAmwwAAJ8MAACkDAMAqQwAAK0MAACxDAMAugwBAMYMAADJDAAAzAwBANYMAwDeDBcAKA0iAFANAABSDQAAcA0DALAN8wC2Dg0AxQ4UAPwO5ABDECcAchAMAYURDwCbERkAthEIAMYReQBCEiIAZhIiAIoSIgCuEiIA0hIiAPoSNAA0ExIASBMPAHATRQD/EwAAARQGAAkUAAANFAIAExQAABUUAAAXFAAAGhQAACwUAAAuFAAAMBQAADUUBAA7FAQAQRQBAEQUAwBJFAAASxQBAE4UAwBTFAQAWRQXAHIUAgB2FAAAfhQCAIIUAQCGFAEAiRQAAIsUAACrFAAA+BQsAGYVAABoFQIAbBV1AGsWAABuFgEAsRYMAL8WFQA1FxgAVRcBABsYDQAqGAUAMRgBADQYAwA5GAEAPBgDAEEYBwBKGAEATRgCAFEYAABTGAEAVhgEAGgYDwD8GBYAORk9AHwZBACCGQQAuBl5ADQa8wA="}],\
+["ori",{"t":"CCCXCXFFGKGPPRFPPKPPPPPIPFNNNNOONNNNNNMNNNNNNNNMONNNNNNCCCCCQQQCCCCQCCCCQQCQGPGFFPFPPPFPPFFGGPPFPPPGPPPPFPPPPPFFPGPPPPGPPPPFPGGOONNNOONNNNNNNNNNNNNNOOOONNNNNNNNNNNNNNNNNNNNNNONONNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNONNHHHHHONNNNNNNNNNNNNNNOOONNNHHHHHHHHNOHHOONNNNNNNNNOOOONNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOFKMMFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFFFFFFNNNNNNNNNNNNNNNNNNNNNNPPPPPPPPPPPPPPPPPPPPPPFPGPPPPPPPPPPPPPPPPPPPPPPPGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFPPKPPPPPPGPPPPPPPPPPFPFPPPPPPPPPPPFPPPPPPPPPPPPPPPPPPPPPPPPPGFFPFPFPFPFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFPFPFPPPPPPONNNNNNNNNNNNOOONNNNNNNNNNNNNNNNNNNNNOOOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOONNNNNNNNNNNNMNOOOOOOOOOOOOOOOOONOONNNNNNNNNNNNNNNNNNNNNNNNOOOOOPFPFFGFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFGFGPPPPSPPGFFFFFFFPPPPPPFPNNONNNNONNNOOOOOONHOOONNNOOOOOOOOOKFFFKFFFKKCNNQQCNNMQMQQCMQNQMCNQQCNXCNCMQMNMMMNMCQQCQQNQQKFFMHHMFFFFHHHHFKFFFFFFKFKMHHMNMNNNNNNNKFFKNNNNFFSFFFFFFKFFFFFFMFFFFKNNNNMMMNMNMNMMNHHNHKYMPFPGFFPOOHOOOHOOOOOHOFPPPPPPPPPPFGGGGFFPPPPPPPPPPPPPGFFGPPPNNNNNNNNNNNNNONNNNNNNNNNNONNNOONNNNQNNNNNNNONOOONNNNNNNNNNNNOOPGPFOHOHTTIKITTTTTTTTTTFFFFRRFKFFKFNNHMNNNNNNNNNNNNNNNNNNNNNNNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNMMNNNMMMMMNNNNNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMMMNNNNHMMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFFFFFFFPGFFFFFFFFFFFFFIFFFFPFPFFFFFFFFFFFFFFFFFFOOHOOOOOOOOOOOOHOOOOOOHOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOHHHHOOHHOHHOOOOOOOOOOOOOOOHOHHOOOOOOOOOOOOOOOOOOOOOOOOOOOHOHOOHOHOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOHHHQHHHQHHOOOOOOOOOOOOHOOOOOOOOOOOOHHHHHHHOHHHOHHOOOOHHHOHOHHHHHOOOOOHOOOOOHHHHOHHOOOOOHOOOOOOHHOOOQHOHHHHHOHOOOOOOOOHHHHHOHHQHHHQHHHOOOOHHHHHHHOOOOOOHQPPPPPPPPPPGPPPPPPPPPPPPPPPPPPPPPFPPPPPPPPPPPPPPPFFGFGPPNNNNNNNNNNOOOONNNNNNNNNNNNOOONNNNOOOOOOOOOOOONNNNNNNNOOKTFTFTFKFFFKTKTNNNNNNNNNNNCNNNNNNNNNNNNNNNNNNNNNQQNNNNNNNNNNNCNNNNNNNNNNNNNNNMNQMNNNNNNNNQQCMNQNQMNCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQQNNNNNCNXNNNNNNNNNNNNNNNNNNNCNNNNCMNQNNNNNNNMNNNNNNNMMNNNMNNNMCQQCNNNNNNNQQNNNNNNNNNNNNNNNNNQQNKFFNNNNNNNNNNNNNNNNNNNNNNNNMNNHHNMNNNNNNNNFFFFNNNNNNNNNNHNNHHNNNNNHFNNNNNNNNNNNNNNNNNNNNNNKFFFFFFKFKMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNNNNNNNNNNNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKFFKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFSTTTTTFFFFTFFTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKFFFFFFMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFFFKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNMNMNNMNNNNNNNNNNNNNNNNNNNNNNNNMNNMNMNNNHHNNNNNNNNNNNNNNNNNNHPTTTTTTPFPPGFFPPPPFPKPFFGKPFGPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTPPPPPFPGFFTIPPYFFPPFFPTTTTTTTTTTTPFPPPPPPPFFPPPGFFFPPGPPFFFFFPPFPPPFFFPPPPPPPPGFPPTTTPPPFPPPPPPPFFPPTTPGPPPPPPPPPPPPGFFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTSTTTTTTTTTTTTTTTTTPPGPPFFPPFGGGGFFPPTPPPPPPPPPPPPPPPTTTTTTTTFFFPPPPPGPTPPPGPPPPPPPPPPFPPPPPTTTTTTTPPFPPTIPPTTTFFPTPPFPPPTTTTTPPPPPPPPPPPPPPPPPPPPPPPPPPPTTTTPFPPPTTTTTFFPPPPFFPPFPPPPFFFFPGFPFPFPFPFPPPPPPPPPPTTPPKYFFFPPPPTPPPPPTTTTTTPTTTTTTTTTPFPPFPPPPPPFPGPFPFFPPPFPPPPPPFPPPFRRPFGGFPGYFPFPPPPTTTTTTTTTPPPFPGFFFFGFFFTFFFPTTPPPPPPPPPFPPKKFPTTTTTTTTPPFFPPPGFFPFPTTPTTTPTTTTTTTFPPPPONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOHNNNNNNOOOOOOOOONNNNNNNOOONONNHNNNOOHNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNOOOOONHNNNNOOOOOOOOOOONONNNNONNNNNNOOOOOOOOOOOOOONNNNNNOOOOOOOOOOOOOONNNNNNOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNOONHNOHNONNNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNOOOONONNNHNNNNHNONNNNNHNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHNNNNNNNNNOOOOOOOOOOOOOOOOOHNOHNNNHNNHNNNNNNNNNNOOOOOOOOOOOOOOOOOOOOOONNNNNONONNOONNNNQNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOXNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNOHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOMNHNNNNNOONNNNNNNNHONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNONNOOOOOONNOOOOOONNOOOOOONNOOOOOOONNOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHNNNNOHNNNNNNNNOHHNHNHQHHHNHNHQHHNONOONOONNNNNNNNNOOOONNONNQNOQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNONNNNQNONNOONOHONNOONNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNHNOOMNNNNNNOONNNNNOONNOOOOOONHNNNNNNNNNNNNNOONNONNNOONNHNHNNHNNOHONNNOONNHNHNNHNNONNXOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNHNHNHNHNHNHNHNHHHNOHHNNNOOONOHHHNOHNONNONNNHHHHHNOOOOOHNNONOOHNNNNNNNOOOOONNNNNNNONNNNNNNNNNNNNNNNNNNNNHNNNNNNNNNONNONNMMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOMNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHNHNNHNOOHNHNNNNNNNNONHNNONNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNOONNNHNNNNNNNNNNNNOOOOOONOHNOONONNNNNNOONCNOQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOHONHNNNOOOOQHNNONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHNOONHNOHNOQHNNNNNOONNHNNNNOOOOOOOOHHHHNNNNOHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNONNNNNNNNNNNOHHQHHHQHHNQONNNXHNNNNNNOOOOOONNNNNNONNNNNNNNNNNHHHHHHHNNOOOOOOOOOOOOOOHQPFPGFFPOOHOOOHOOOOOHO","n":["app","core","log","main","prelude","reloadable","App","AppBuilder","AppCommand","AppDelegate","AppRequest","CloseWindow","CloseWindow","Data","DelegateCx","DragWindow","DragWindow","IntoUiBuilder","OpenWindow","OpenWindow","Quit","Quit","RequestRedraw","UiBuilder","UpdateWindow","WindowRenderState","borrow","borrow","borrow_mut","borrow_mut","canvas","clear_color","deref","deref","deref_mut","deref_mut","drop","drop","event","from","from","idle","init","init","init","into","into","into_ui_builder","logical_size","try_from","try_from","try_into","try_into","type_id","type_id","canvas","clipboard","command","context","event","format_text","hstack","hwrap","image","layout","rebuild","style","style","text","transition","view","views","vstack","vwrap","window","zstack","AntiAlias","Bevel","BlendMode","BorderRadius","BorderWidth","Butt","Canvas","Clear","Close","Close","Color","Cubic","Cubic","Curve","CurveIter","CurveSegment","CurveVerb","Destination","DestinationOver","DisplayHex","EvenOdd","Fast","Fill","FillRule","Full","Layer","Line","Line","Mask","Miter","Move","Move","NonZero","None","Paint","Pattern","Pattern","Primitive","Quad","Quad","Round","Round","Shader","Solid","Source","SourceOver","Square","Stroke","Stroke","StrokeCap","StrokeJoin","a","anti_alias","as_ref","as_str","as_str_with_alpha","b","blend","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom_left","bottom_right","cap","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","color","count","curve","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","eq","fill","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","g","hash","hash","hex","hsl","hsla","hsv","hsva","image","init","init","init","init","init","init","init","into","into","into","into","into","into","into","into_iter","join","left","miter","new","new","next","okhsl","okhsla","okhsv","okhsva","oklab","oklaba","oklch","oklcha","points","r","rgb","rgba","right","shader","size_hint","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_smolstr","to_string","top","top_left","top_right","transform","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","width","curve","curve","fill","mask","paint","paint","primitives","stroke","transform","view","Clipboard","ClipboardBackend","get_text","set_text","Command","CommandProxy","CommandReceiver","CommandWaker","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","clone","clone_into","clone_to_uninit","deref","deref","deref","deref_mut","deref_mut","deref_mut","drop","drop","drop","fmt","fmt","fmt","from","from","from","from","get","init","init","init","into","into","into","is","name","new","new","to_any","to_owned","try_from","try_from","try_from","try_into","try_into","try_into","try_recv","type_id","type_id","type_id","wake","BaseCx","BuildCx","Contexts","DrawCx","EventCx","LayoutCx","RebuildCx","borrow","borrow_mut","contains","default","deref","deref_mut","drop","fmt","from","get","get_mut","get_or_default","init","insert","into","is_empty","len","new","remove","try_from","try_into","type_id","A","Accept","Again","Alphanumeric","Alt","AltGraph","Animate","Apostrophe","B","Back","Backslash","Backspace","Backspace","Backtick","BracketLeft","BracketRight","C","Cancel","CapsLock","CapsLock","Character","Clear","CloseRequested","CloseRequested","Code","CodeInput","Comma","Command","Compose","Control","Convert","Copy","Cut","D","Dead","Delete","Delete","Down","Down","E","Eisu","End","End","Enter","Enter","Equal","Escape","Escape","Event","Execute","F","F1","F1","F10","F10","F11","F11","F12","F12","F13","F14","F15","F16","F17","F18","F19","F2","F2","F20","F21","F22","F23","F24","F3","F3","F4","F4","F5","F5","F6","F6","F7","F7","F8","F8","F9","F9","Find","Fn","FnLock","Forward","G","H","HangulMode","HanjaMode","Hankaku","Help","Hiragana","HiraganaKatakana","Home","Home","Hyper","I","Ime","Insert","Insert","IsKey","J","JunjaMode","K","KanaMode","KanjiMode","Katakana","Key","Key0","Key1","Key2","Key3","Key4","Key5","Key6","Key7","Key8","Key9","KeyPressed","KeyPressed","KeyReleased","KeyReleased","L","LAlt","LCtrl","LMeta","LShift","Left","Left","M","Meta","Minus","Modifiers","N","NumLock","NumLock","NumStar","Numpad0","Numpad1","Numpad2","Numpad3","Numpad4","Numpad5","Numpad6","Numpad7","Numpad8","Numpad9","O","Other","P","PageDown","PageDown","PageUp","PageUp","Paste","Pause","Period","Play","PointerButton","PointerId","PointerLeft","PointerLeft","PointerMoved","PointerMoved","PointerPressed","PointerPressed","PointerReleased","PointerReleased","PointerScrolled","PointerScrolled","Primary","PrintScreen","Q","R","RAlt","RCtrl","RMeta","RShift","Redo","Right","Right","Romaji","S","ScrollLock","ScrollLock","Secondary","Select","Semicolon","Shift","Slash","Space","Space","Super","Symbol","SymbolLock","T","Tab","Tab","Tertiary","U","Undo","Unidentified","Up","Up","Update","V","W","WindowMaximized","WindowMaximized","WindowResized","WindowResized","WindowScaled","WindowScaled","X","Y","Z","Zenkaku","ZenkakuHankaku","alt","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","button","button","clicked","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","code","code","compose","ctrl","default","delta","delta","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","hash","hash","hash","hash","height","id","id","id","id","id","init","init","init","init","init","init","into","into","into","into","into","into","is","is_key","key","key","maximized","meta","modifiers","modifiers","modifiers","modifiers","modifiers","modifiers","position","position","position","position","scale_factor","selection","shift","size","text","text","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","width","window","window","window","window","Backend","Image","Image","ImageData","ImageId","Texture","TextureId","WeakImage","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","default","default","deref","deref","deref","deref_mut","deref_mut","deref_mut","drop","drop","drop","eq","eq","eq","fmt","fmt","fmt","from","from","from","from","from","from_index","hash","hash","id","init","init","init","into","into","into","new","strong_count","to_index","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_into","try_into","try_into","type_id","type_id","type_id","weak_count","Affine","Align","Alignment","Axis","Center","Center","End","End","FILL","Fill","Horizontal","Justify","JustifyIterator","Matrix","Padding","Point","Rect","Size","Space","SpaceAround","SpaceBetween","SpaceEvenly","Start","Start","Stretch","Vector","Vertical","borrow","borrow_mut","bottom","deref","deref_mut","drop","from","height","init","into","into_iter","left","matrix","max","max","min","min","next","pt","right","top","translation","try_from","try_into","type_id","width","x","x","x","x","y","y","y","y","Callsite","Dispatch","Event","Id","Instrument","Level","Metadata","Span","Subscriber","Value","callsite","clone_span","current_span","debug","debug_span","dispatcher","downcast_raw","drop_span","enabled","enabled","enter","error","error_span","event","event","event","event_enabled","event_enabled","exit","field","in_current_span","info","info_span","instrument","instrument","instrument","level_filters","max_level_hint","metadata","metadata","metadata","new_span","on_register_dispatch","record","record","record_follows_from","register_callsite","set_interest","span","span","span_enabled","subscriber","trace","trace_span","try_close","warn","warn_span","Callsite","DefaultCallsite","Identifier","metadata","rebuild_interest_cache","register","set_interest","DefaultGuard","Dispatch","SetGlobalDefaultError","WeakDispatch","get_default","set_default","set_global_default","with_default","Event","AsField","DebugValue","DisplayValue","Empty","Field","FieldSet","Iter","Value","ValueSet","Visit","as_field","debug","display","record","record_bool","record_debug","record_error","record_f64","record_i128","record_i64","record_str","record_u128","record_u64","Instrument","Instrumented","WithDispatch","WithSubscriber","in_current_span","instrument","with_current_subscriber","with_subscriber","LevelFilter","ParseLevelFilterError","STATIC_MAX_LEVEL","Kind","Level","LevelFilter","Metadata","ParseLevelError","ParseLevelFilterError","AsId","Attributes","Entered","EnteredSpan","Id","Record","Span","as_id","DefaultGuard","Interest","NoSubscriber","SetGlobalDefaultError","Subscriber","clone_span","current_span","downcast_raw","drop_span","enabled","enter","event","event_enabled","exit","max_level_hint","new_span","on_register_dispatch","record","record_follows_from","register_callsite","set_default","set_global_default","try_close","with_default","Rebuild","Rebuild","rebuild","Computed","Style","Style","Styled","Styles","Theme","Value","accent","background","comp","contrast","danger","info","key","outline","primary","secondary","success","surface","val","warning","AtlasGlyph","Bundle","Center","Condensed","Cursive","Data","End","Expanded","ExtraCondensed","ExtraExpanded","Fantasy","FontAtlas","FontFamily","FontSource","FontStretch","FontStyle","FontWeight","Fonts","Italic","Monospace","Name","None","Normal","Normal","Oblique","Path","SansSerif","SemiCondensed","SemiExpanded","Serif","Start","TextAlign","TextAttributes","TextBuffer","TextWrap","UltraCondensed","UltraExpanded","Word","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","curve_cache","default","deref","deref","deref","deref_mut","deref_mut","deref_mut","drop","drop","drop","eq","family","fmt","fmt","fmt","font_atlas","font_system","from","from","from","image","include_font","init","init","init","insert","into","into","into","layout","new","stretch","style","swash_cache","to_cosmic_text","to_owned","to_owned","try_from","try_from","try_from","try_into","try_into","try_into","type_id","type_id","type_id","uv","weight","Ease","Easing","Linear","Transition","duration","ease","easing","linear","ACTIVE","ANIMATE","AnyState","AnyView","BoxedView","DRAW","FOCUSABLE","FOCUSED","HAS","HAS_ACTIVE","HAS_FOCUSED","HAS_HOT","HOT","IS","LAYOUT","Pod","PodSeq","SeqState","State","State","State","Update","View","ViewFlags","ViewId","ViewSeq","ViewState","all","all","any","as_any","as_u64","bitand","bitand","bitand_assign","bitand_assign","bitor","bitor","bitor_assign","bitor_assign","bits","bits","bits","bits","bitxor","bitxor","bitxor_assign","bitxor_assign","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","build","build","clone","clone","clone","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmp","complement","complement","contains","contains","default","default","default","deref","deref","deref","deref_mut","deref_mut","deref_mut","difference","difference","draw","draw_nth","drop","drop","drop","dyn_build","dyn_draw","dyn_event","dyn_layout","dyn_rebuild","empty","empty","eq","eq","eq","event","event_nth","extend","extend","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from_bits","from_bits","from_bits_retain","from_bits_retain","from_bits_retain","from_bits_retain","from_bits_truncate","from_bits_truncate","from_iter","from_iter","from_name","from_name","hash","hash","hash","init","init","init","insert","insert","intersection","intersection","intersects","intersects","into","into","into","into_iter","into_iter","is_all","is_all","is_empty","is_empty","iter","iter","iter_names","iter_names","layout","layout_nth","len","new","not","not","partial_cmp","pod","rebuild","rebuild","rebuild_nth","remove","remove","set","set","sub","sub","sub_assign","sub_assign","symmetric_difference","symmetric_difference","to_owned","to_owned","to_owned","to_smolstr","to_string","toggle","toggle","try_from","try_from","try_from","try_into","try_into","try_into","type_id","type_id","type_id","union","union","Aligned","Animate","Aspect","BuildHandler","Button","ButtonStyle","Checkbox","CheckboxStyle","Click","ClickEvent","Clickable","Collapsing","CollapsingStyle","ColorPicker","ColorPickerStyle","Constrain","Container","ContainerStyle","DrawHandler","EventHandler","Flex","Flexible","Focus","Lens","Memo","Opaque","Pad","Painter","Press","RebuildHandler","Release","Scroll","ScrollStyle","Slider","SliderStyle","Stack","Suspense","Text","TextInput","TextInputStyle","TextStyle","Tooltip","TooltipStyle","Transform","Trigger","WithState","WithStyle","Wrap","ZStack","after","after","align","align","align","align","align","align","align","align","align","alignment","alpha_color","alpha_color","amount","animate","animate","aspect","axis","axis","axis","axis","background","background","background","background","background","background","background","background","background","background","background","before","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","bottom","bottom_left","bottom_right","button","button","callback","center","checkbox","checked","circle","collapsing","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color_picker","column_gap","constrain","container","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","default_open","delay","delay","descendants","draw","ellipse","event","expand","fancy","fancy","flex","flex","focus","font_family","font_family","font_family","font_family","font_family","font_family","font_size","font_size","font_size","font_size","font_size","font_size","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_style","font_style","font_style","font_style","font_style","font_style","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","gap","header","height","hscroll","hstack","hstack","hstack_any","hstack_vec","hwrap","hwrap","hwrap_any","hwrap_vec","icon_color","icon_color","icon_size","icon_size","inset","inset","is_tight","justify","justify","justify_cross","knob_color","knob_color","left","length","length","lightness_color","lightness_color","line_height","line_height","line_height","line_height","line_height","line_height","mask","mask","max_height","max_size","max_width","memo","min_height","min_size","min_width","multiline","on_build","on_click","on_draw","on_draw","on_event","on_event_before","on_input","on_input","on_input","on_open","on_press","on_rebuild","on_release","on_submit","opaque","open","pad","pad_bottom","pad_left","pad_right","pad_top","padding","padding","padding","padding","padding","painter","placeholder","placeholder_color","placeholder_color","range","rebuild","rect","right","rotate","rotate_degrees","row_gap","scale","size","size","size","size","size","size","slider","slider_width","slider_width","space","stroke","stroke","style","suspense","text","text","text","text","text","text_input","tight","tooltip","top","top_left","top_right","transform","transform","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition_active","transition_focused","transition_hot","translate","trigger","value","vscroll","vstack","vstack","vstack_any","vstack_vec","vwrap","vwrap","vwrap_any","vwrap_vec","width","width","width","width","width","with_data","with_data_default","with_state","with_state_default","with_style","without_data","without_state","wrap","wrap","wrap","wrap","wrap","wrap","zstack","zstack","Alias","AllScroll","Arrow","Cell","ColResize","Color","Content","ContextMenu","Copy","Crosshair","Cursor","Cursor","Decorated","Default","EResize","EwResize","Fixed","Grab","Grabbing","Help","Icon","Ime","Maximized","Move","NResize","NeResize","NeswResize","NoDrop","NotAllowed","NsResize","NwResize","NwseResize","Pointer","Pointer","Progress","Resizable","RowResize","SResize","Scale","SeResize","Size","SwResize","Text","Title","VerticalText","Visible","WResize","Wait","Window","WindowId","WindowSizing","WindowSnapshot","WindowUpdate","ZoomIn","ZoomOut","borrow","borrow","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","color","color","decorated","decorated","deref","deref","deref_mut","deref_mut","difference","drop","drop","eq","fmt","fmt","from","from","hovering","icon","icon","init","init","into","into","maximized","maximized","position","resizable","resizable","scale","scale","size","size","sizing","title","title","to_owned","to_owned","try_from","try_from","try_into","try_into","type_id","type_id","visible","visible","Callsite","DEBUG","Dispatch","ERROR","Event","INFO","Id","Instrument","Level","Metadata","Span","Subscriber","TRACE","Value","WARN","as_str","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","callsite","callsite","child_of","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_span","clone_span","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmp","current","current_span","current_span","debug","debug_span","default","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","dispatcher","downcast_raw","downcast_ref","downcast_ref","downcast_ref","downcast_ref","downcast_ref","downgrade","drop","drop","drop","drop","drop","drop","drop_span","drop_span","enabled","enabled","enabled","enter","enter","enter","entered","eq","eq","eq","eq","eq","error","error_span","event","event","event","event","event_enabled","event_enabled","exit","exit","field","field","fields","file","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","follows_from","from","from","from","from","from","from","from_non_zero_u64","from_str","from_u64","ge","ge","gt","gt","has_field","hash","hash","hash","id","in_current_span","in_scope","info","info_span","init","init","init","init","init","instrument","instrument","instrument","into","into","into","into","into","into_non_zero_u64","into_u64","is","is","is","is","is","is_disabled","is_event","is_none","is_span","le","le","level","level_filters","line","lt","lt","max_level_hint","metadata","metadata","metadata","metadata","module_path","name","new","new","new","new_disabled","new_root","new_span","new_span","none","none","on_register_dispatch","or_current","partial_cmp","partial_cmp","record","record","record","record","record_all","record_follows_from","record_follows_from","register_callsite","register_callsite","set_interest","span","span","span_enabled","subscriber","target","to_owned","to_owned","to_owned","to_owned","to_smolstr","to_string","trace","trace_span","try_close","try_close","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","warn","warn_span","with_subscriber","Callsite","DefaultCallsite","Identifier","borrow","borrow","borrow_mut","borrow_mut","clone","clone_into","clone_to_uninit","deref","deref","deref_mut","deref_mut","drop","drop","eq","fmt","fmt","from","from","hash","init","init","interest","into","into","metadata","metadata","new","rebuild_interest_cache","register","register","set_interest","set_interest","to_owned","try_from","try_from","try_into","try_into","type_id","type_id","DefaultGuard","Dispatch","SetGlobalDefaultError","WeakDispatch","borrow","borrow_mut","clone","clone_into","clone_to_uninit","deref","deref_mut","drop","fmt","from","get_default","init","into","set_default","set_global_default","to_owned","try_from","try_into","type_id","upgrade","with_default","Event","borrow","borrow_mut","child_of","deref","deref_mut","dispatch","drop","fields","fmt","from","init","into","is_contextual","is_root","metadata","new","new_child_of","parent","record","try_from","try_into","type_id","AsField","DebugValue","DisplayValue","Empty","Field","FieldSet","Iter","Value","ValueSet","Visit","as_field","as_field","as_field","as_ref","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","callsite","callsite","clone","clone","clone","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","contains","debug","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","display","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","field","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","hash","init","init","init","init","init","init","init","into","into","into","into","into","into","into","into_iter","into_iter","is_empty","is_empty","iter","len","len","name","new","next","par_bridge","record","record","record","record","record","record_bool","record_debug","record_error","record_f64","record_i128","record_i64","record_str","record_u128","record_u64","to_owned","to_owned","to_owned","to_smolstr","to_smolstr","to_smolstr","to_smolstr","to_string","to_string","to_string","to_string","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","Instrument","Instrumented","WithDispatch","WithSubscriber","borrow","borrow","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","deref","deref","deref_mut","deref_mut","dispatcher","drop","drop","drop","fmt","fmt","from","from","in_current_span","init","init","inner","inner","inner_mut","inner_mut","inner_pin_mut","inner_pin_mut","inner_pin_ref","inner_pin_ref","instrument","into","into","into_future","into_future","into_inner","into_inner","poll","poll","span","span_mut","to_owned","to_owned","try_from","try_from","try_into","try_into","type_id","type_id","with_current_subscriber","with_subscriber","LevelFilter","ParseLevelFilterError","STATIC_MAX_LEVEL","DEBUG","ERROR","EVENT","HINT","INFO","Kind","Level","LevelFilter","Metadata","OFF","ParseLevelError","ParseLevelFilterError","SPAN","TRACE","WARN","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmp","current","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","eq","eq","eq","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from_level","from_str","ge","ge","gt","gt","hash","hint","init","init","init","init","into","into","into","into","into_level","is_event","is_hint","is_span","le","le","lt","lt","partial_cmp","partial_cmp","to_owned","to_owned","to_owned","to_smolstr","to_smolstr","to_smolstr","to_string","to_string","to_string","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","AsId","Attributes","Entered","EnteredSpan","Id","Record","Span","as_id","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","child_of","contains","contains","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","drop","drop","exit","fields","fmt","fmt","fmt","fmt","from","from","from","from","id","init","init","init","init","into","into","into","into","is_contextual","is_empty","is_empty","is_root","len","metadata","new","new","new_root","parent","record","record","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","values","DefaultGuard","Interest","NoSubscriber","SetGlobalDefaultError","Subscriber","always","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_span","clone_to_uninit","clone_to_uninit","clone_to_uninit","current_span","default","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","downcast_raw","drop","drop","drop","drop","drop","drop_span","enabled","enabled","enter","enter","event","event","event_enabled","exit","exit","fmt","fmt","fmt","fmt","fmt","from","from","from","from","init","init","init","init","into","into","into","into","is_always","is_never","is_sometimes","max_level_hint","never","new","new_span","new_span","on_register_dispatch","record","record","record_follows_from","record_follows_from","register_callsite","register_callsite","set_default","set_global_default","sometimes","to_owned","to_owned","to_smolstr","to_string","try_close","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","with_default","A","ACCENT","ACCENT_LOW","ALIGN","ALIGN","ALIGN","ALPHA_COLOR","Accept","Affine","Again","Alias","Align","Aligned","Alignment","AllScroll","Alphanumeric","Alt","AltGraph","Animate","Animate","AnyView","Apostrophe","App","AppBuilder","AppCommand","AppDelegate","Arrow","Aspect","Axis","B","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BLACK","BLACK","BLUE","BOLD","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BOTTOM","BOTTOM_LEFT","BOTTOM_RIGHT","Back","Backslash","Backspace","Backspace","Backtick","BaseCx","Bevel","BlendMode","BorderRadius","BorderWidth","Bottom","BoxedView","BracketLeft","BracketRight","Build","BuildCx","BuildHandler","Bundle","Butt","Button","ButtonStyle","C","CENTER","COLOR","COLOR","COLOR","COLOR","COLOR","COLOR","COLOR","CONTRAST","CONTRAST_LOW","CYAN","Cancel","Canvas","CapsLock","CapsLock","Cell","Center","Center","Center","Character","Checkbox","CheckboxStyle","Clear","Clear","Click","ClickEvent","Clickable","Clipboard","CloseRequested","CloseRequested","CloseWindow","Code","CodeInput","ColResize","Collapsing","CollapsingStyle","Color","ColorPicker","ColorPickerStyle","Comma","Command","CommandProxy","Compose","Computed","Condensed","Constrain","Container","ContainerStyle","Content","ContextMenu","Control","Convert","Copy","Copy","Crosshair","Cursive","Cursor","Curve","Cut","D","DANGER","DANGER_LOW","DELAY","Data","Dead","Default","DelegateCx","Delete","Delete","Destination","DestinationOver","Down","Down","DragWindow","DrawCx","DrawHandler","E","EResize","EXTRA_BOLD","EXTRA_LIGHT","Ease","Easing","Eisu","End","End","End","End","End","Enter","Enter","Equal","Escape","Escape","EvenOdd","Event","EventCx","EventHandler","EwResize","Execute","Expanded","ExtraCondensed","ExtraExpanded","F","F1","F1","F10","F10","F11","F11","F12","F12","F13","F14","F15","F16","F17","F18","F19","F2","F2","F20","F21","F22","F23","F24","F3","F3","F4","F4","F5","F5","F6","F6","F7","F7","F8","F8","F9","F9","FANCY","FILL","FILL","FILL","FONT_FAMILY","FONT_FAMILY","FONT_FAMILY","FONT_SIZE","FONT_SIZE","FONT_SIZE","FONT_STRETCH","FONT_STRETCH","FONT_STRETCH","FONT_STYLE","FONT_STYLE","FONT_STYLE","FONT_WEIGHT","FONT_WEIGHT","FONT_WEIGHT","Fantasy","Fill","FillRule","Find","Fixed","Flex","Flexible","Fn","FnLock","Focus","FontFamily","FontSource","FontStretch","FontStyle","FontWeight","Fonts","Forward","G","GREEN","Grab","Grabbing","H","HangulMode","HanjaMode","Hankaku","Help","Help","Hiragana","HiraganaKatakana","Home","Home","Horizontal","Hyper","I","ICON_COLOR","ICON_SIZE","IDENTITY","IDENTITY","INFINITY","INFO","INFO_LOW","INSET","Image","ImageData","ImageId","Insert","Insert","Italic","J","JunjaMode","Justify","K","KNOB_COLOR","KanaMode","KanjiMode","Katakana","Key","Key0","Key1","Key2","Key3","Key4","Key5","Key6","Key7","Key8","Key9","KeyPressed","KeyPressed","KeyReleased","L","LAlt","LCtrl","LEFT","LENGTH","LIGHT","LIGHTNESS_COLOR","LINE_HEIGHT","LINE_HEIGHT","LINE_HEIGHT","LMeta","LShift","LayoutCx","Left","Left","Left","Lens","Linear","M","MAGENTA","MASK","MEDIUM","Matrix","Memo","Meta","Middle","Minus","Miter","Modifiers","Monospace","Move","N","NEG_X","NEG_X","NEG_Y","NEG_Y","NORMAL","NResize","Name","NeResize","NeswResize","NoDrop","NonZero","None","Normal","Normal","NotAllowed","NsResize","NumLock","NumLock","NumStar","Numpad0","Numpad1","Numpad2","Numpad3","Numpad4","Numpad5","Numpad6","Numpad7","Numpad8","Numpad9","NwResize","NwseResize","O","ONE","ONE","OUTLINE","OUTLINE_LOW","Oblique","Opaque","OpenWindow","Other","P","PADDING","PADDING","PLACEHOLDER_COLOR","PRIMARY","PRIMARY_LOW","Pad","Padding","PageDown","PageDown","PageUp","PageUp","Paint","Painter","Paste","Path","Pattern","Pattern","Pause","Period","Play","Pod","PodSeq","Point","Pointer","Pointer","PointerButton","PointerId","PointerLeft","PointerMoved","PointerMoved","PointerPressed","PointerPressed","PointerReleased","PointerReleased","PointerScrolled","PointerScrolled","Press","Primary","PrintScreen","Progress","Q","Quit","R","RAlt","RCtrl","RED","RIGHT","RMeta","RShift","Rebuild","Rebuild","RebuildCx","RebuildHandler","Rect","Redo","Release","Right","Right","Right","Romaji","Round","Round","RowResize","S","SECONDARY","SECONDARY_LOW","SEMI_BOLD","SIZE","SIZE","SLIDER_WIDTH","SResize","STROKE","SUCCESS","SUCCESS_LOW","SURFACE","SURFACE_HIGH","SURFACE_HIGHER","SURFACE_HIGHEST","SURFACE_LOW","SURFACE_LOWER","SansSerif","Scroll","ScrollLock","ScrollLock","ScrollStyle","SeResize","Secondary","Select","SemiCondensed","SemiExpanded","Semicolon","SeqState","Serif","Shader","Shift","Size","Slash","Slider","SliderStyle","Solid","Source","SourceOver","Space","Space","Space","SpaceAround","SpaceBetween","SpaceEvenly","Square","Stack","Start","Start","Start","State","State","State","Stretch","Stroke","StrokeCap","StrokeJoin","Style","Style","Styled","Styled","Styles","Super","Suspense","SwResize","Symbol","SymbolLock","T","THIN","TOP","TOP_LEFT","TOP_RIGHT","TRANSITION","TRANSITION","TRANSITION","TRANSITION","TRANSPARENT","Tab","Tab","Tertiary","Text","Text","TextAlign","TextBuffer","TextInput","TextInputStyle","TextStyle","TextWrap","Theme","Tooltip","TooltipStyle","Top","Transform","Transition","Trigger","U","UNBOUNDED","UNBOUNDED","UltraCondensed","UltraExpanded","Undo","Unidentified","Up","Up","Update","V","Value","Vector","Vertical","VerticalText","View","ViewSeq","ViewState","W","WARNING","WARNING_LOW","WHITE","WIDTH","WIDTH","WRAP","WRAP","WRAP","WResize","Wait","Window","WindowId","WindowMaximized","WindowResized","WindowScaled","WindowSizing","WithState","WithStyle","Word","Wrap","X","X","X","Y","Y","Y","YELLOW","Z","ZERO","ZERO","ZERO","ZERO","ZERO","ZERO","ZERO","ZStack","Zenkaku","ZenkakuHankaku","ZoomIn","ZoomOut","a","a8","accent","active_changed","add","add","add","add","add","add","add","add","add","add","add","add","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_context","add_window","after","after","after","after","align","align","align","align","align","align","align","align","align","align","align","align","align","align","align","alignment","all","all","all","all","all","all","alpha_color","alpha_color","alpha_color","alt","amount","amount","angle","angle_between","animate","animate","animate","animate","animate","anti_alias","any","any","any","any","any_horizontal","any_vertical","area","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_build_cx","as_build_cx","as_char","as_fontdb","as_layout_cx","as_mut","as_rebuild_cx","as_ref","as_u64","aspect","axis","axis","axis","axis","axis","axis","axis","axis","b","b8","background","background","background","background","background","background","background","background","background","background","background","background","background","background","background","background","before","before","bitand","bitand","bitand_assign","bitand_assign","blend","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom","bottom","bottom","bottom_center","bottom_left","bottom_left","bottom_left","bottom_right","bottom_right","bottom_right","bounds","bounds","buffer_size","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","button","button","button","button","button","callback","canvas","cap","ceil","ceil","ceil","center","center","center_left","center_right","center_size","checkbox","checked","checked","child","child","child","child","child","circle","circle","clamp","clamp","clamp","clamp","clear","clear","clicked","clipboard","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","close","close_requested","close_window","cmd","cmd","cmd","cmd_async","cmd_async","cmd_silent","code","collapsing","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color_picker","column_gap","column_gap","comp","complete","compute_id","conic_to","constrain","constrain","contain","container","contains","contains","contains_context","contains_property","contains_property","contains_property","contains_property","contains_property","contains_property","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","context","context_mut","context_or_default","contexts","contexts_mut","contrast","cross","ctrl","cubic_to","cursor","curve_cache","danger","dark","darken","data","data_mut","debug","decorated","decorated","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default","default_open","default_open","delay","delay","delegate","delta","delta","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","desaturate","descendants","descendants","desktop","determinant","distance","div","div","div","div","div","div","div","div","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","dot","downgrade","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw_buffer","draw_canvas","draw_canvas","draw_nth","draw_nth","draw_window","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","duration","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","ease","ease","easing","ellipse","ellipse","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","error","evaluate","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event_nth","event_nth","expand","expand","extend","fade","fallback","fancy","fancy","fancy","fill","fill","fill_rect","filter","finite_or_zero","fit","fit_content","flags","flex","flex","floor","floor","floor","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","focus","focused_changed","font","font_atlas","font_family","font_family","font_family","font_family","font_family","font_family","font_family","font_family","font_size","font_size","font_size","font_size","font_size","font_size","font_size","font_size","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_style","font_style","font_style","font_style","font_style","font_style","font_style","font_style","font_system","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","fonts","fract","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from_angle","from_angle","from_hash","from_linux_scancode","from_raw","from_scale","from_size","from_u16","from_u64","g","g8","gap","gap","gap","get","get","get","get","get_context","get_context_mut","get_or","get_or","get_or_else","get_or_else","get_pixel","get_pointer","get_pointer_mut","get_property","get_property","get_property","get_property","get_property","get_property","get_property_mut","get_property_mut","get_property_mut","get_property_mut","get_property_mut","get_property_mut","get_window","get_window_mut","grayscale","had_active","had_focused","had_hot","handle_commands","has_active","has_active","has_active","has_active","has_active","has_active","has_active","has_active_changed","has_focused","has_focused","has_focused","has_focused","has_focused","has_focused","has_focused_changed","has_hot","has_hot","has_hot","has_hot","has_hot","has_hot","has_hot_changed","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hat","header","height","height","height","height","height","height","hex","hex","horizontal","horizontal","horizontal_any","horizontal_vec","hot_changed","hoverable","hoverable","hovering","hscroll","hsl","hsl","hsla","hsla","hstack","hstack","hstack_any","hstack_vec","hsv","hsv","hsva","hsva","hwrap","hwrap","hwrap_any","hwrap_vec","icon","icon","icon_color","icon_color","icon_color","icon_size","icon_size","icon_size","id","id","id","id","id","id","id","id","id","id","id","id","id","idle","idle","image","ime","include","include_font","inflate","info","info","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","insert","insert_context","insert_property","insert_property","insert_property","insert_property","insert_property","insert_property","insert_style","insert_style_keys","insert_value","inset","inset","inset","intersection","intersects","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into_iter","inverse","inverse","is","is","is_active","is_active","is_active","is_active","is_active","is_active","is_closed","is_cmd","is_desktop","is_empty","is_empty","is_empty","is_empty","is_finite","is_finite","is_finite","is_focusable","is_focused","is_focused","is_focused","is_focused","is_focused","is_focused","is_hot","is_hot","is_hot","is_hot","is_hot","is_hot","is_hovered","is_infinite","is_infinite","is_infinite","is_key","is_key_pressed","is_key_released","is_mobile","is_nan","is_pointer_held","is_pressed","is_tight","is_translucent","is_transparent","is_valid","is_visible","is_web","iter","join","justify","justify","justify","justify","justify_cross","justify_cross","key","key","keyboard_key","knob_color","knob_color","knob_color","last_point","layer","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout_nth","layout_nth","left","left","left","left","len","len","len","len","len","length","length","length","length","length_squared","lerp","light","lighten","lightness_color","lightness_color","lightness_color","line_height","line_height","line_height","line_height","line_height","line_height","line_height","line_height","line_to","linear","linear","load_font","local","loosen","loosen_height","loosen_width","luminocity","major","mark_animated","mark_drawn","mark_layed_out","marker","mask","mask","mask","masked","masked","matrix","max","max","max","max","max","max_element","max_element","max_height","max_height","max_size","max_size","max_size","max_width","max_width","maximized","maximized","memo","meta","min","min","min","min","min","min_element","min_element","min_height","min_height","min_size","min_size","min_size","min_width","min_width","minor","miter","mix","mix_rgb","mobile","modifiers","modifiers","modifiers","modifiers","modifiers","modifiers_changed","modify","move_pointer","move_to","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","multiline","multiline","multiply_alpha","name","needs_animate","needs_draw","needs_layout","neg","neg","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","normalize","offset","offset","okhsl","okhsl","okhsla","okhsla","okhsv","okhsv","okhsva","okhsva","oklab","oklab","oklaba","oklaba","oklch","oklch","oklcha","oklcha","on_build","on_click","on_draw","on_draw","on_draw","on_event","on_event_before","on_input","on_input","on_input","on_input","on_input","on_input","on_open","on_open","on_press","on_rebuild","on_release","on_submit","on_submit","opaque","open","open","open_window","open_window","outline","overlay","overlay","pack","pad","pad_bottom","pad_left","pad_right","pad_top","padding","padding","padding","padding","padding","padding","painter","physical_size","placeholder","placeholder","placeholder_color","placeholder_color","placeholder_color","pod","pointer_button","pointer_left","pointer_moved","pointer_scrolled","pointers","pointers_mut","points","position","position","position","position","position","premultiplied","prepare","prepare_buffer","prepare_text","prepare_text_raw","press","press_pointer","primary","primitives","propagate","property_or","property_or","property_or","property_or","property_or","property_or","property_or_default","property_or_default","property_or_default","property_or_default","property_or_default","property_or_default","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","proxy","pt","push","push","push_oval","push_rect","push_rect_with_borders","push_rect_with_radius","quad","quad_to","quit","r","r8","range","range","raw","raw_mut","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild_nth","rebuild_nth","rect","rect","rect","rect","rect","rect","rect","rect","release","release_pointer","rem","rem","rem","rem","rem","rem","rem","rem","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","remove_context","remove_pointer","remove_property","remove_property","remove_property","remove_property","remove_property","remove_property","remove_window","request_animate","request_draw","request_layout","resizable","resizable","rgb","rgb","rgba","rgba","rgba8","right","right","right","right","rotate","rotate","rotate_degrees","rotated","rotated","round","round","round","round","round","row_gap","row_gap","saturate","scale","scale","scale","scale","scaled","scaled","secondary","set","set_active","set_active","set_active","set_active","set_align","set_bounds","set_cursor","set_cursor","set_cursor","set_cursor","set_filter","set_focusable","set_focused","set_focused","set_focused","set_focused","set_hot","set_hot","set_hot","set_hot","set_ime","set_ime","set_metrics","set_pixel","set_size","set_text","set_transform","set_wrap","shader","shift","shrink","shrink","signum","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","size","sizing","sizing","slider","slider_width","slider_width","slider_width","snapshot","space","spawn_async","spawn_async","step","stroke","stroke","stroke","stroke","stroke","stroke_curve","style","style","style","style","styled","styled","styled","styled","styled","styled","styled","styled","styled","styled","styles","styles","styles","styles","styles","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","success","surface","suspense","swash_cache","take_requests","text","text","text","text","text","text","text","text","text","text_input","text_raw","theme","tight","title","title","to_cosmic_text","to_cosmic_text","to_fontdb","to_fontdb","to_fontdb","to_hex","to_hsl","to_hsla","to_hsv","to_hsva","to_okhsl","to_okhsla","to_okhsv","to_okhsva","to_oklab","to_oklaba","to_oklch","to_oklcha","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_point","to_point","to_rgba8","to_size","to_size","to_smolstr","to_smolstr","to_smolstr","to_smolstr","to_smolstr","to_srgb","to_string","to_string","to_string","to_string","to_string","to_vector","to_vector","tooltip","top","top","top","top","top_center","top_left","top_left","top_left","top_right","top_right","top_right","trace","transform","transform","transform","transform","transform","transform","transform","transform","transformed","transformed","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition_active","transition_focused","transition_hot","translate","translate","translate","translated","translated","translation","trigger","trigger","trigger","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_hex","try_intersection","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","unbounded","union","unpack","update","update_hovered","updates","val","value","value","vec","vec","vec_horizontal","vec_vertical","verbs","vertical","vertical","vertical_any","vertical_vec","view_at","visible","visible","vscroll","vstack","vstack","vstack_any","vstack_vec","vwrap","vwrap","vwrap_any","vwrap_vec","wake","warn","warning","was_active","was_focused","was_hot","web","width","width","width","width","width","width","width","width","width","width","width","width","width","window","window","window","window","window","window","window","window_event","window_maximized","window_mut","window_mut","window_mut","window_mut","window_mut","window_resized","window_scaled","with","with","with_data","with_data_default","with_state","with_state_default","with_style","without_data","without_state","wrap","wrap","wrap","wrap","wrap","wrap","wrap","wrap","x","x","x","x","y","y","y","y","zstack","zstack","Computed","Style","Style","Styled","Styles","Theme","Value","accent","background","comp","contrast","danger","info","key","outline","primary","secondary","success","surface","val","warning"],"q":[[0,"ori"],[6,"ori::app"],[55,"ori::core"],[76,"ori::core::canvas"],[300,"ori::core::canvas::Primitive"],[310,"ori::core::clipboard"],[314,"ori::core::command"],[367,"ori::core::context"],[396,"ori::core::event"],[772,"ori::core::image"],[844,"ori::core::layout"],[905,"ori::core::log"],[962,"ori::core::log::callsite"],[969,"ori::core::log::dispatcher"],[977,"ori::core::log::event"],[978,"ori::core::log::field"],[1001,"ori::core::log::instrument"],[1009,"ori::core::log::level_filters"],[1012,"ori::core::log::metadata"],[1018,"ori::core::log::span"],[1026,"ori::core::log::subscriber"],[1050,"ori::core::rebuild"],[1053,"ori::core::style"],[1074,"ori::core::text"],[1174,"ori::core::transition"],[1182,"ori::core::view"],[1376,"ori::core::views"],[1750,"ori::core::window"],[1860,"ori::log"],[2088,"ori::log::callsite"],[2130,"ori::log::dispatcher"],[2155,"ori::log::event"],[2178,"ori::log::field"],[2335,"ori::log::instrument"],[2393,"ori::log::level_filters"],[2396,"ori::log::metadata"],[2506,"ori::log::span"],[2584,"ori::log::subscriber"],[2685,"ori::prelude"],[7050,"ori::prelude::style"],[7071,"ori_app::delegate"],[7072,"ori_core::event::event"],[7073,"ori_app"],[7074,"core::ops::function"],[7075,"alloc::boxed"],[7076,"core::result"],[7077,"core::any"],[7078,"ori_core::canvas::color"],[7079,"ori_core::canvas::canvas"],[7080,"ori_core::canvas::curve"],[7081,"core::fmt"],[7082,"ori_core::layout::rect"],[7083,"core::hash"],[7084,"alloc::sync"],[7085,"core::convert"],[7086,"core::option"],[7087,"smol_str"],[7088,"alloc::string"],[7089,"ori_core::clipboard"],[7090,"ori_core::command"],[7091,"core::marker"],[7092,"ori_core::context::contexts"],[7093,"core::default"],[7094,"ori_core::event::ime"],[7095,"ori_core::event::keyboard"],[7096,"ori_core::event::pointer"],[7097,"ori_core::event::window"],[7098,"ori_core::layout::size"],[7099,"ori_core::image::image"],[7100,"ori_core::image::texture"],[7101,"ori_core::layout::justify"],[7102,"tracing_core::subscriber"],[7103,"tracing_core::span"],[7104,"tracing_core::metadata"],[7105,"tracing_core::event"],[7106,"tracing::instrument"],[7107,"tracing::span"],[7108,"tracing_core::callsite"],[7109,"tracing_core::dispatcher"],[7110,"tracing_core::field"],[7111,"tracing::field"],[7112,"core::error"],[7113,"ori_core::rebuild"],[7114,"ori_core::context::rebuild"],[7115,"ori_core::style::style"],[7116,"ori_core::text::atlas"],[7117,"ori_core::text::attributes"],[7118,"cosmic_text::font::system"],[7119,"cosmic_text::swash"],[7120,"cosmic_text::glyph_cache"],[7121,"cosmic_text::attrs"],[7122,"ori_core::transition"],[7123,"ori_core::view::state"],[7124,"ori_core::view::any"],[7125,"ori_core::view::sequence"],[7126,"ori_core::context::build"],[7127,"alloc::vec"],[7128,"ori_core::view::view"],[7129,"core::cmp"],[7130,"ori_core::context::draw"],[7131,"ori_core::context::event"],[7132,"ori_core::context::layout"],[7133,"ori_core::layout::space"],[7134,"core::iter::traits::collect"],[7135,"bitflags::iter"],[7136,"ori_core::view::pod"],[7137,"ori_core::views::aligned"],[7138,"ori_core::layout::alignment"],[7139,"ori_core::views::animate"],[7140,"ori_core::views::container"],[7141,"ori_core::views::button"],[7142,"ori_core::views::checkbox"],[7143,"ori_core::views::painter"],[7144,"ori_core::views::collapsing"],[7145,"ori_core::views::color_picker"],[7146,"ori_core::views::constrain"],[7147,"ori_core::views::flex"],[7148,"ori_core::views::focus"],[7149,"ori_core::views::scroll"],[7150,"ori_core::views::stack"],[7151,"ori_core::views::wrap"],[7152,"ori_core::views::memorize"],[7153,"ori_core::views::build_handler"],[7154,"ori_core::views::clickable"],[7155,"ori_core::views::draw_handler"],[7156,"ori_core::views::event_handler"],[7157,"ori_core::views::rebuild_handler"],[7158,"ori_core::views::opaque"],[7159,"ori_core::views::pad"],[7160,"ori_core::layout::padding"],[7161,"ori_core::views::transform"],[7162,"ori_core::layout::vector"],[7163,"ori_core::views::slider"],[7164,"ori_core::views::suspense"],[7165,"core::future::future"],[7166,"ori_core::views::text"],[7167,"ori_core::views::text_input"],[7168,"ori_core::views::tooltip"],[7169,"ori_core::layout::affine"],[7170,"ori_core::views::trigger"],[7171,"ori_core::views::with_state"],[7172,"ori_core::views::with_style"],[7173,"ori_core::views::zstack"],[7174,"ori_core::window::window"],[7175,"core::num::nonzero"],[7176,"core::clone"],[7177,"core::borrow"],[7178,"rayon::iter::par_bridge"],[7179,"core::pin"],[7180,"core::task::wake"],[7181,"core::task::poll"],[7182,"ori_core::layout::point"],[7183,"ori_app::app"],[7184,"ori_core::canvas::border"],[7185,"ori_core::event::modifiers"],[7186,"ori_core::layout::axis"],[7187,"fontdb"],[7188,"ori_core::text::buffer"],[7189,"cosmic_text::buffer"],[7190,"ori_app::builder"],[7191,"ori_core::views::aspect"],[7192,"ori_core::context::base"],[7193,"ori_core::canvas::stroke"],[7194,"ori_core::image::data"],[7195,"ori_core::layout::matrix"],[7196,"ori_core::style::palette"],[7197,"ori_core::text::source"],[7198,"ori_core::window::cursor"],[7199,"ori_core::window::pointer"],[7200,"ori_core::text::fonts"],[7201,"std::path"],[7202,"std::io::error"],[7203,"ori_app::command"],[7204,"core::iter::traits::iterator"],[7205,"core::ops::range"],[7206,"ori_app::request"],[7207,"cosmic_text::layout"],[7208,"ttf_parser::tables::os2"],[7209,"ori_macro"],[7210,"ori_core"],[7211,"ori_core::layout"],[7212,"tracing_core"],[7213,"tracing"],[7214,"tracing_attributes"],[7215,"tracing::level_filters"],[7216,"tracing::subscriber"]],"i":[0,0,0,0,0,0,0,0,0,0,0,272,278,10,0,272,278,0,272,278,272,278,278,0,278,0,251,278,251,278,251,251,251,278,251,278,251,278,5,251,278,5,251,5,278,251,278,10,251,251,278,251,278,251,278,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,224,0,0,0,223,0,222,20,21,0,20,21,0,0,0,0,222,222,0,28,17,19,0,17,19,20,21,0,224,20,21,28,17,0,0,221,0,20,21,223,224,0,221,222,222,223,0,19,0,0,26,140,15,15,15,26,140,33,17,18,19,15,20,21,33,17,18,19,15,20,21,202,201,201,225,17,18,19,15,20,21,17,18,19,15,20,21,17,17,18,19,15,15,20,20,21,21,220,19,18,33,17,18,19,15,15,20,21,33,17,18,19,15,20,21,33,17,18,19,15,20,21,17,18,19,15,20,21,18,17,18,19,15,15,20,21,33,17,18,18,19,15,20,21,26,17,20,0,0,0,0,0,220,33,17,18,19,15,20,21,33,17,18,19,15,20,21,33,225,202,225,18,15,33,0,0,0,0,0,0,0,0,20,26,0,0,202,140,33,17,18,19,15,20,21,15,15,202,201,201,220,33,17,18,19,15,20,21,33,17,18,19,15,20,21,33,17,18,19,15,20,21,225,285,286,285,287,285,286,287,286,287,287,0,0,38,38,0,0,0,0,40,41,39,40,41,39,39,39,39,40,41,39,40,41,39,40,41,39,40,41,39,40,41,39,39,40,40,41,39,40,41,39,40,40,40,39,40,39,40,41,39,40,41,39,41,40,41,39,39,0,0,0,0,0,0,0,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,46,56,55,55,55,55,55,7,56,56,215,56,55,56,56,56,56,56,55,55,56,55,55,0,7,0,55,56,7,55,55,55,55,55,56,55,55,56,55,56,56,55,55,56,55,56,56,55,56,0,55,56,55,56,55,56,55,56,55,56,55,55,55,55,55,55,55,55,56,55,55,55,55,55,55,56,55,56,55,56,55,56,55,56,55,56,55,56,55,55,55,215,56,56,55,55,55,55,55,55,55,56,55,56,0,55,56,0,56,55,56,55,55,55,0,56,56,56,56,56,56,56,56,56,56,0,7,0,7,56,56,56,56,56,55,56,56,55,56,0,56,55,56,56,56,56,56,56,56,56,56,56,56,56,56,215,56,55,56,55,56,55,55,56,55,0,0,0,7,0,7,0,7,0,7,0,7,215,55,56,56,56,56,56,56,55,55,56,55,56,55,56,215,55,56,55,56,55,56,55,55,55,56,55,56,215,56,55,55,55,56,7,56,56,0,7,0,7,0,7,56,56,56,55,55,203,48,49,50,51,52,53,48,49,50,51,52,53,229,230,230,48,49,50,51,52,53,48,49,50,51,52,53,48,49,50,51,51,52,52,53,53,227,49,48,203,48,228,231,48,49,50,51,52,53,48,49,50,51,52,53,48,49,50,51,52,53,48,50,51,52,53,48,49,50,51,52,53,48,49,50,51,52,53,48,50,51,53,51,228,50,229,230,231,48,49,50,51,52,53,48,49,50,51,52,53,54,49,227,49,53,203,227,49,228,229,230,231,228,229,230,231,52,48,203,51,48,227,48,49,50,51,52,53,48,49,50,51,52,53,48,49,50,51,52,53,48,49,50,51,52,53,51,232,51,52,53,60,0,60,0,0,0,0,0,58,59,60,58,59,60,58,59,60,58,59,60,58,59,59,60,59,60,58,59,60,58,59,60,58,59,60,58,59,60,58,59,60,58,59,60,60,60,59,58,59,58,58,59,60,58,59,60,59,58,59,58,59,60,58,59,60,58,59,60,58,59,60,58,0,0,0,0,199,234,199,234,0,199,204,0,0,0,0,0,0,0,0,234,234,234,199,234,199,0,204,64,64,158,64,64,64,64,57,64,64,64,158,167,24,127,24,127,64,0,158,158,167,64,64,64,57,134,235,197,160,134,235,197,160,0,0,0,0,0,0,0,0,0,0,0,65,65,0,0,0,65,65,65,0,65,0,0,0,65,0,65,0,65,0,70,0,0,0,70,0,0,65,0,74,0,65,65,77,65,65,65,74,0,0,0,0,0,0,65,0,0,0,0,0,74,0,0,74,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,86,0,0,77,79,79,79,79,79,79,79,79,79,0,0,0,0,70,70,96,96,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,98,0,0,0,0,0,65,65,65,65,65,65,65,65,65,65,65,65,65,65,65,0,0,65,0,0,0,99,101,0,101,0,0,0,101,236,236,0,236,236,236,0,236,236,236,236,236,0,236,0,241,200,238,206,241,200,238,238,238,206,0,0,0,0,0,0,0,239,206,206,240,238,239,239,241,206,238,238,206,200,0,0,0,0,238,238,240,105,103,104,105,103,104,103,104,103,104,103,103,104,249,104,105,103,104,105,103,104,105,103,104,104,104,105,103,104,249,249,105,103,104,105,0,105,103,104,105,105,103,104,103,105,104,104,249,104,103,104,105,103,104,105,103,104,105,103,104,103,104,242,0,242,0,111,0,111,0,113,112,0,0,0,112,113,113,113,113,113,113,113,113,112,0,0,0,0,117,121,0,0,0,0,0,0,112,113,0,114,115,112,113,112,113,112,113,112,113,112,112,113,113,112,113,112,113,112,113,115,112,113,115,117,121,112,113,115,112,113,115,112,112,113,113,115,115,115,112,113,112,113,112,113,115,112,113,115,112,113,115,112,113,121,117,112,113,115,114,114,114,114,114,112,113,112,113,115,121,117,112,113,112,112,112,112,112,113,113,113,113,113,115,115,112,113,115,112,113,112,112,113,113,112,113,112,113,112,113,112,113,115,112,113,115,112,113,112,113,112,113,112,113,115,112,113,112,113,112,113,112,113,112,113,121,117,117,115,112,113,115,0,117,121,117,112,113,112,113,112,113,112,113,112,113,112,113,115,115,115,112,113,112,113,115,112,113,115,112,113,115,112,113,0,0,0,0,0,0,0,0,247,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,247,0,247,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,151,154,0,147,164,257,165,253,166,254,148,133,142,261,248,0,135,214,146,161,147,148,0,138,256,141,255,136,262,161,258,166,254,154,137,259,138,256,141,255,142,261,136,262,161,258,166,254,137,259,138,256,141,255,136,262,146,260,161,258,166,254,137,259,138,256,141,255,142,261,136,262,161,258,166,254,0,0,0,0,152,152,0,0,138,0,0,137,259,138,256,142,146,260,161,258,164,257,165,253,166,254,0,148,0,0,151,153,154,156,155,168,170,133,214,137,152,141,143,136,144,157,146,147,166,159,148,171,141,166,254,152,139,0,152,0,137,259,0,144,0,164,257,165,253,166,254,164,257,165,253,166,254,164,257,165,253,166,254,164,257,165,253,166,254,164,257,165,253,166,254,147,141,0,0,0,0,0,0,0,0,0,0,141,255,141,255,146,260,248,147,148,148,146,260,0,161,258,142,261,164,257,165,253,166,254,136,262,0,0,0,0,0,0,0,165,0,0,0,153,0,0,142,161,165,141,0,0,0,165,0,141,0,0,0,0,0,137,259,157,166,254,0,165,165,253,161,155,0,0,0,0,148,0,0,138,256,142,261,139,0,142,261,143,138,256,170,0,0,164,165,166,0,0,144,0,0,0,0,0,159,0,137,259,138,256,141,255,146,260,0,0,0,0,0,161,0,0,0,0,0,0,0,0,0,0,146,260,161,258,0,0,0,0,0,0,0,164,257,165,253,166,254,0,0,243,243,243,243,243,172,246,243,243,243,0,172,172,243,243,243,246,243,243,243,172,172,172,243,243,243,243,243,243,243,243,243,0,243,243,172,243,243,172,243,172,243,243,172,243,172,243,243,0,0,0,0,0,243,243,172,173,172,173,172,173,172,173,172,173,174,173,174,173,172,173,172,173,173,172,173,172,172,173,172,173,244,174,173,172,173,172,173,174,173,244,174,173,174,173,174,173,174,174,173,172,173,172,173,172,173,172,173,174,173,0,175,0,175,0,175,0,0,0,0,0,0,175,0,175,175,72,68,76,175,66,72,68,76,175,66,0,68,72,72,76,175,66,72,76,175,66,65,76,72,76,175,175,66,175,72,65,76,0,0,76,72,68,76,175,66,72,68,76,175,66,0,65,65,65,65,65,76,76,72,72,68,76,175,66,65,76,65,76,0,65,72,76,72,72,68,175,175,66,0,0,0,65,76,0,65,0,65,76,0,72,68,68,77,77,72,68,76,175,175,66,72,72,68,76,76,175,66,66,175,66,175,175,175,175,72,72,175,66,72,70,72,0,0,72,68,76,175,66,0,70,0,72,68,76,175,66,66,66,65,65,65,65,76,72,68,72,68,175,175,68,0,68,175,175,65,0,74,72,0,68,68,72,68,76,72,72,65,76,72,76,65,72,175,175,77,65,72,76,72,65,76,65,76,74,0,0,0,0,68,72,76,175,66,175,175,0,0,65,76,72,68,76,175,66,72,68,76,175,66,72,68,76,175,66,0,0,72,0,0,0,176,185,176,185,176,176,176,176,185,176,185,176,185,176,176,185,176,185,176,176,185,185,176,185,74,185,185,0,0,185,74,185,176,176,185,176,185,176,185,0,0,0,0,178,178,178,178,178,178,178,178,178,178,0,178,178,0,0,178,178,178,178,178,0,0,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,69,0,0,0,0,0,0,0,0,0,0,86,78,78,78,181,177,78,188,186,89,87,181,177,78,188,186,89,87,177,78,78,89,87,78,89,87,78,89,87,181,0,181,177,78,188,186,89,87,181,177,78,188,186,89,87,0,181,177,78,188,186,89,87,181,78,188,181,181,181,177,177,78,78,188,186,89,89,87,181,177,78,188,186,89,87,78,181,177,78,188,186,89,87,181,177,78,188,186,89,87,181,186,181,177,181,181,177,78,181,186,186,77,177,188,89,87,79,79,79,79,79,79,79,79,79,78,89,87,181,177,78,89,181,177,78,89,181,177,78,188,186,89,87,181,177,78,188,186,89,87,181,177,78,188,186,89,87,0,0,0,0,97,71,97,71,97,71,97,71,97,71,97,71,97,71,97,97,71,71,97,71,97,71,70,97,71,97,71,97,71,97,71,97,71,70,97,71,97,71,97,71,97,71,71,71,97,71,97,71,97,71,97,71,96,96,0,0,0,73,73,184,184,73,0,0,0,0,73,0,0,184,73,73,184,73,195,183,184,73,195,183,184,73,195,184,73,195,184,73,73,195,73,73,184,73,195,183,184,73,195,183,184,73,195,183,184,73,73,184,73,73,195,195,183,183,184,73,73,73,195,183,73,73,73,73,73,73,73,184,184,73,195,183,184,73,195,183,73,184,184,184,73,73,73,73,73,73,184,73,195,73,195,183,73,195,183,184,73,195,183,184,73,195,183,184,73,195,183,0,0,0,0,0,0,0,98,179,180,75,80,179,180,75,80,75,75,80,179,180,180,75,80,179,180,75,80,179,179,180,180,75,80,180,75,179,180,75,80,179,180,75,80,180,179,180,75,80,179,180,75,80,75,75,80,75,80,75,75,80,75,75,75,80,179,180,75,80,179,180,75,80,179,180,75,80,75,0,0,0,0,0,81,84,83,81,196,84,83,81,196,81,196,81,196,65,81,196,196,65,196,84,83,81,196,84,83,81,196,65,84,83,83,81,196,65,65,196,65,196,65,196,65,65,196,84,84,83,81,196,84,83,81,196,84,83,81,196,84,83,81,196,81,81,81,65,81,196,65,196,65,65,196,65,196,65,196,0,0,81,81,196,84,84,65,84,83,81,196,84,83,81,196,84,83,81,196,0,56,236,236,257,253,254,261,55,0,55,243,0,0,0,243,55,55,55,0,7,0,56,0,0,0,0,243,0,0,56,236,256,255,262,258,254,26,237,26,237,259,256,255,261,262,258,254,259,256,255,262,260,258,254,259,256,255,261,262,258,254,134,134,134,215,56,55,56,56,0,224,0,0,0,200,0,56,56,0,0,0,241,223,0,0,56,134,259,256,260,258,257,253,254,236,236,26,55,0,55,56,243,199,234,200,55,0,0,222,55,247,0,0,0,0,7,272,0,55,243,0,0,0,0,0,56,7,0,55,101,238,0,0,0,246,243,55,55,55,243,243,206,0,0,55,56,236,236,254,241,55,243,0,55,56,222,222,55,56,272,0,0,56,243,237,237,242,0,55,55,56,199,234,200,55,56,56,55,56,28,0,0,0,243,55,238,238,238,56,55,56,55,56,55,56,55,56,55,55,55,55,55,55,55,55,56,55,55,55,55,55,55,56,55,56,55,56,55,56,55,56,55,56,55,56,259,0,57,127,257,253,254,257,253,254,257,253,254,257,253,254,257,253,254,206,199,0,55,246,0,0,55,55,0,0,0,0,0,0,0,215,56,26,243,243,56,55,55,55,55,243,55,55,55,56,204,55,56,255,255,167,235,57,236,236,260,0,0,0,55,56,239,56,55,0,56,260,55,55,55,0,56,56,56,56,56,56,56,56,56,56,0,7,7,56,56,56,134,258,237,261,257,253,254,56,56,0,55,56,200,0,242,56,26,262,237,0,0,55,200,56,224,0,206,243,56,197,160,197,160,237,243,206,243,243,243,28,240,238,239,243,243,55,56,56,56,56,56,56,56,56,56,56,56,56,243,243,56,197,160,236,236,239,0,272,215,56,259,254,253,236,236,0,0,55,56,55,56,0,0,55,241,0,221,55,56,55,0,0,0,0,243,0,0,7,0,7,0,7,0,7,0,7,247,215,55,243,56,272,56,56,56,26,134,56,56,0,0,0,0,0,55,247,55,56,200,55,223,224,243,56,236,236,237,256,261,261,243,256,236,236,236,236,236,236,236,236,206,0,55,56,0,243,215,55,238,238,56,0,206,0,55,0,56,0,0,221,222,222,0,55,56,234,234,234,223,0,199,234,200,0,117,121,199,0,0,0,0,101,0,0,0,55,0,243,55,55,56,237,134,134,134,259,256,255,260,26,55,56,215,0,243,0,0,0,0,0,0,0,0,0,200,0,0,0,56,57,127,238,238,55,55,55,56,7,56,101,0,204,243,0,0,0,56,236,236,26,260,258,257,253,254,243,243,0,0,7,7,7,0,0,0,240,0,56,197,160,56,197,160,26,56,201,202,197,24,57,127,160,0,55,55,243,243,26,26,236,125,26,197,197,197,24,24,57,57,57,127,160,160,26,197,197,197,24,24,57,57,57,127,160,160,198,198,151,154,151,154,0,134,199,147,164,165,148,147,164,257,165,253,166,254,148,133,201,202,158,197,57,160,142,142,261,203,144,248,160,160,0,118,125,100,135,140,0,203,147,148,147,147,24,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,125,100,55,206,100,208,125,208,210,214,146,161,147,148,146,161,147,148,26,26,0,138,141,136,161,236,138,256,141,255,136,262,161,258,166,254,154,154,24,127,24,127,140,137,138,141,142,136,161,137,259,138,256,141,255,142,261,136,262,161,258,166,254,137,138,141,136,146,161,137,259,138,256,141,255,136,262,146,260,161,258,166,254,137,138,141,142,136,161,137,259,138,256,141,255,142,261,136,262,161,258,166,254,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,0,24,202,158,24,0,24,201,0,24,201,29,208,249,117,121,198,211,135,151,153,154,145,149,156,155,162,168,169,170,61,132,212,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,0,152,229,230,152,152,124,225,197,57,160,0,24,24,24,24,0,138,138,118,124,125,126,100,0,29,197,24,57,160,216,29,230,217,219,201,202,220,221,222,140,28,216,26,29,223,224,225,226,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,241,242,111,132,212,243,244,245,246,174,247,248,219,201,202,220,221,222,140,28,216,26,29,223,224,225,226,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,241,242,111,132,212,243,244,245,246,174,247,248,219,219,201,201,202,202,220,221,222,222,140,28,28,216,26,26,29,223,223,224,224,225,225,226,227,55,55,56,56,203,203,210,210,215,215,228,229,230,231,232,232,233,63,63,61,167,167,134,134,204,204,199,199,234,234,235,235,158,158,197,197,24,24,57,57,127,127,160,160,236,236,102,101,206,237,237,238,238,239,239,200,200,240,240,241,242,242,111,111,132,132,212,212,243,243,244,245,245,246,246,174,247,247,248,248,29,198,6,217,226,7,217,226,226,227,0,61,174,137,138,142,146,161,164,165,220,174,137,259,138,256,142,146,260,161,258,164,257,165,253,166,254,0,148,148,0,111,233,29,0,127,24,0,29,24,217,118,124,125,126,100,119,152,151,153,154,156,155,168,170,133,214,137,152,141,143,136,144,157,146,147,166,159,148,171,217,217,217,217,217,236,160,203,29,119,249,236,236,26,233,233,0,174,174,211,218,201,202,140,216,26,29,225,203,233,61,167,134,235,158,197,24,57,127,160,236,102,206,237,238,239,200,240,249,242,111,119,243,245,246,174,142,248,165,141,141,166,254,211,228,231,198,211,272,6,6,218,217,118,118,124,124,125,125,126,126,100,100,219,250,250,213,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,233,63,61,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,132,212,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,198,211,272,6,6,218,217,118,118,124,124,125,125,126,126,100,100,219,250,250,213,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,132,212,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,26,152,152,0,235,197,197,197,197,57,57,57,160,160,197,197,197,57,57,57,160,160,160,61,121,118,125,100,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,139,146,161,147,164,165,166,159,148,171,139,249,124,216,117,212,198,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,111,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,114,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,0,111,111,0,29,201,202,220,221,222,140,28,216,26,29,223,224,225,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,206,237,238,239,200,240,242,111,132,212,243,244,245,246,247,0,242,5,121,198,135,151,153,154,145,149,156,155,162,168,169,170,61,132,133,214,137,138,152,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,152,117,212,0,127,102,26,162,137,137,259,124,216,124,233,57,127,174,119,0,144,197,57,160,218,201,202,220,221,222,140,28,216,26,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,197,24,57,57,127,160,160,236,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,245,246,174,247,248,0,125,211,249,164,165,164,257,165,253,166,254,164,165,164,257,165,253,166,254,164,165,164,257,165,253,166,254,164,165,164,257,165,253,166,254,249,164,165,164,257,165,253,166,254,217,197,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,201,201,201,202,202,202,202,202,202,220,220,221,222,140,140,140,140,28,216,26,26,26,29,29,223,224,225,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,61,167,134,134,134,204,199,234,235,158,158,158,158,158,158,197,197,197,197,197,197,24,24,24,57,57,57,57,57,57,127,127,160,160,160,160,160,160,236,102,102,102,102,102,102,102,102,102,102,102,102,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,101,206,206,206,206,237,238,239,200,240,208,249,241,241,241,241,241,241,242,111,132,132,132,212,212,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,164,257,165,253,166,254,159,148,171,235,160,210,56,208,235,127,215,210,26,26,147,148,147,218,102,101,111,217,217,102,101,102,101,233,174,174,118,124,125,126,100,119,118,124,125,126,100,119,198,198,26,125,125,125,198,118,124,125,126,100,213,119,125,118,124,125,126,100,119,125,118,124,125,126,100,119,125,220,221,222,140,28,26,29,223,224,225,55,56,203,210,215,228,229,230,231,232,233,63,61,167,204,199,234,235,197,24,57,127,160,206,237,238,239,200,240,242,132,212,243,245,247,160,141,0,233,24,174,143,57,0,26,147,148,148,148,125,124,216,244,0,0,26,0,26,0,0,0,0,0,26,0,26,0,0,0,0,174,174,141,141,255,141,141,255,118,124,125,126,100,61,119,244,174,228,229,230,231,198,5,220,119,24,0,24,236,0,198,198,211,272,6,5,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,102,217,118,124,125,126,100,119,102,102,102,146,146,260,24,24,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,29,167,235,55,56,118,124,125,126,100,119,29,7,0,29,212,147,148,197,57,127,119,118,124,125,126,100,119,118,124,125,126,100,119,174,197,57,127,227,7,7,0,197,174,244,248,26,26,29,124,0,29,225,147,148,147,148,148,148,0,227,198,146,146,260,29,216,121,118,125,100,135,151,153,154,145,149,156,155,162,168,169,170,61,234,132,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,117,212,0,24,202,158,117,29,212,147,148,160,161,161,258,160,197,236,26,142,142,261,164,165,164,257,165,253,166,254,29,0,111,249,125,127,127,127,26,204,119,119,119,152,136,136,262,124,216,167,197,57,160,24,127,201,57,0,143,0,24,143,0,143,174,174,0,203,197,57,160,24,127,201,57,0,143,0,24,143,0,143,204,225,26,26,0,227,228,229,230,231,198,61,174,29,26,26,167,167,167,235,235,235,197,197,197,57,57,57,160,160,167,197,197,197,57,57,57,160,160,165,165,61,243,119,119,119,197,160,211,218,217,118,124,125,126,100,219,135,151,153,154,145,149,156,155,162,168,169,170,201,202,216,29,226,233,61,134,235,158,197,24,57,127,160,102,208,249,132,212,119,244,245,174,133,214,137,138,152,141,142,143,136,144,157,139,146,161,147,164,165,166,159,148,171,160,158,24,0,26,0,26,0,26,0,26,0,26,0,26,0,26,0,26,0,0,0,153,153,0,0,142,161,165,142,161,165,141,141,0,0,0,165,165,0,141,141,272,6,236,124,216,204,0,0,0,0,0,137,137,259,157,166,254,0,174,165,165,165,165,253,0,198,198,198,198,174,174,29,228,229,230,231,244,61,119,249,126,126,244,174,236,216,119,118,124,125,126,100,119,118,124,125,126,100,119,118,124,125,126,100,119,217,0,147,148,29,29,29,29,124,29,6,26,26,161,161,208,208,99,117,121,198,6,125,135,151,153,154,145,149,156,155,162,168,169,170,61,132,212,133,133,214,214,137,137,259,138,138,256,152,152,141,141,255,142,142,261,143,143,136,136,262,144,144,157,157,139,139,146,146,260,161,161,258,147,147,164,257,165,253,166,166,254,159,159,148,148,171,155,117,212,0,124,125,100,216,29,208,119,244,174,197,197,197,57,57,57,160,160,197,197,197,57,57,57,160,160,217,174,118,124,125,126,100,119,198,119,119,119,174,174,0,26,0,26,26,0,24,202,158,0,167,0,124,216,167,197,24,57,160,148,148,26,0,167,174,174,124,216,236,218,118,125,100,119,208,208,118,125,100,119,233,119,118,125,100,119,118,125,100,119,125,119,208,233,119,208,119,208,140,203,24,127,160,0,124,125,100,233,158,24,208,119,174,138,142,139,174,138,256,142,261,139,174,174,0,142,142,261,174,143,217,226,111,124,216,138,138,256,29,0,211,170,0,259,256,255,261,262,260,258,257,253,254,118,124,125,126,100,197,197,197,197,24,24,57,57,57,127,160,160,197,197,197,24,24,57,57,57,127,160,160,236,236,0,249,198,0,124,164,165,227,164,165,166,0,0,124,211,144,174,174,200,240,237,238,239,26,26,26,26,26,26,26,26,26,26,26,26,26,219,201,202,220,221,222,140,28,216,26,29,223,224,225,226,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,241,242,111,132,212,243,244,245,246,174,247,248,57,160,26,197,160,26,197,57,160,245,26,26,197,57,160,245,197,57,0,0,24,202,158,24,0,24,201,0,24,201,0,0,124,125,29,24,119,220,159,124,216,0,137,138,141,146,137,259,138,256,141,255,146,260,0,0,0,0,167,119,124,216,167,0,124,216,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,26,24,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,198,211,272,6,218,217,118,124,125,126,100,219,250,213,135,151,153,154,145,149,156,155,162,168,169,170,201,202,220,221,222,140,28,216,26,29,223,224,225,226,7,227,55,56,203,210,215,228,229,230,231,232,233,63,61,167,134,204,199,234,235,158,197,24,57,127,160,236,102,101,206,237,238,239,200,240,208,249,241,242,111,132,212,119,243,244,245,246,174,133,214,137,259,138,256,247,152,141,255,142,261,143,136,262,248,144,157,139,146,260,161,258,147,164,257,165,253,166,254,159,148,171,143,24,204,119,198,174,0,161,161,147,148,147,147,29,147,148,148,148,216,174,174,0,0,0,0,0,0,0,0,0,226,0,236,125,125,125,0,0,233,24,174,143,146,161,225,57,146,260,161,258,211,118,124,125,126,100,232,198,198,118,124,125,126,100,198,198,147,148,0,0,0,0,0,0,0,164,165,164,257,165,253,166,254,134,235,197,160,134,235,197,160,0,0,101,0,101,0,0,0,101,236,236,0,236,236,236,0,236,236,236,236,236,0,236],"f":"``````````````````````````{{{b{c}}}{{b{e}}}{}{}}0{{{b{dc}}}{{b{de}}}{}{}}0``{f{{b{c}}}{}}0{f{{b{dc}}}{}}0{fh}0{{{b{dj}}{b{d{l{c}}}}{b{dc}}{b{n}}}A`{}}{cc{}}0{{{b{dj}}{b{d{l{c}}}}{b{dc}}}h{}}{{}f}10{ce{}{}}0{{{Ad{}{{Ab{c}}}}}{{Ah{Af}}}{}}`{c{{Aj{e}}}{}{}}000{{{b{c}}}Al{}}0``````````````````````````````````````````````````````````````````````````{{{b{An}}}{{b{B`}}}}00``=======<<<<<<<````{{{b{Bb}}}Bb}{{{b{Bd}}}Bd}{{{b{Bf}}}Bf}{{{b{An}}}An}{{{b{Bh}}}Bh}{{{b{Bj}}}Bj}{{{b{c}}{b{de}}}h{}{}}00000{{{b{c}}}h{}}000000000`{{{b{Bf}}}f}`{f{{b{c}}}{}}000{{{b{An}}}b}111{f{{b{dc}}}{}}000000{fh}000000{{{b{Bb}}{b{Bb}}}A`}{{{b{Bd}}{b{Bd}}}A`}{{{b{Bf}}{b{Bf}}}A`}{{{b{An}}{b{An}}}A`}{{{b{Bh}}{b{Bh}}}A`}{{{b{Bj}}{b{Bj}}}A`}`{{{b{Bb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Bd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Bf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{An}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Bh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Bj}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}00{C`Bd}1111`{{{b{Bb}}{b{dc}}}hCb}{{{b{Bh}}{b{dc}}}hCb}{{{b{B`}}}Cd}{{CfCfCf}Cd}{{CfCfCfCf}Cd}10`{{}f}000000{ce{}{}}0000000```{{cCh}Bd{{Cn{{Cl{Cj}}}}}}{{D`D`D`D`}An}{{{b{dDb}}}Dd}65656565{{{b{Bh}}}f}`76``{{{b{Db}}}{{Df{f{Dd{f}}}}}}{{{b{c}}}e{}{}}00000{{{b{c}}}Dh{}}{{{b{c}}}Dj{}}````{c{{Aj{e}}}{}{}}0000000000000{{{b{c}}}Al{}}000000`````````````{{{b{dDl}}}Dj}{{{b{dDl}}{b{B`}}}h}````{{{b{c}}}{{b{e}}}{}{}}00{{{b{dc}}}{{b{de}}}{}{}}00{{{b{Dn}}}Dn}{{{b{c}}{b{de}}}h{}{}}{{{b{c}}}h{}}{f{{b{c}}}{}}00{f{{b{dc}}}{}}00{fh}00{{{b{E`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Eb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Dn}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}00{{{Cl{Ed}}}Dn}{{{b{E`}}}{{Dd{{b{c}}}}}Ef}{{}f}00{ce{}{}}00{{{b{E`}}}A`}{{{b{E`}}}{{b{B`}}}}{cE`{EfEh}}{cDn{EdEhEj}}{E`{{Ah{Ef}}}}{{{b{c}}}e{}{}}{c{{Aj{e}}}{}{}}00000{{{b{Eb}}}{{Dd{E`}}}}{{{b{c}}}Al{}}00{{{b{Dn}}}h}```````{{{b{c}}}{{b{e}}}{}{}}{{{b{dc}}}{{b{de}}}{}{}}{{{b{El}}}A`}{{}El}{f{{b{c}}}{}}{f{{b{dc}}}{}}{fh}{{{b{El}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}{{{b{El}}}{{Dd{{b{c}}}}}Ef}{{{b{dEl}}}{{Dd{{b{dc}}}}}Ef}{{{b{dEl}}}{{b{dc}}}{EfEn}}{{}f}{{{b{dEl}}c}{{Dd{c}}}Ef}{ce{}{}}<{{{b{El}}}f}<{{{b{dEl}}}{{Dd{c}}}Ef}{c{{Aj{e}}}{}{}}0{{{b{c}}}Al{}}`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{b{c}}}{{b{e}}}{}{}}00000{{{b{dc}}}{{b{de}}}{}{}}00000```{{{b{F`}}}F`}{{{b{Fb}}}Fb}{{{b{Fd}}}Fd}{{{b{Ff}}}Ff}{{{b{Fh}}}Fh}{{{b{Fj}}}Fj}{{{b{c}}{b{de}}}h{}{}}00000{{{b{c}}}h{}}00000000````{{}F`}``{f{{b{c}}}{}}00000{f{{b{dc}}}{}}00000{fh}00000{{{b{F`}}{b{F`}}}A`}{{{b{Fd}}{b{Fd}}}A`}{{{b{Ff}}{b{Ff}}}A`}{{{b{Fh}}{b{Fh}}}A`}{{{b{Fj}}{b{Fj}}}A`}{{{b{F`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ff}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fj}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}00000{{{b{F`}}{b{dc}}}hCb}{{{b{Fd}}{b{dc}}}hCb}{{{b{Ff}}{b{dc}}}hCb}{{{b{Fj}}{b{dc}}}hCb}``````{{}f}00000{ce{}{}}00000{{{b{Fl}}Fn{Dd{G`}}}A`}{{{b{Fb}}c}A`Fl}`````````````````{{{b{Ff}}}Gb}``{{{b{c}}}e{}{}}00000{c{{Aj{e}}}{}{}}00000000000{{{b{c}}}Al{}}00000`````````````{{{b{c}}}{{b{e}}}{}{}}00{{{b{dc}}}{{b{de}}}{}{}}00{{{b{Gd}}}Gd}{{{b{Gf}}}Gf}{{{b{Gh}}}Gh}{{{b{c}}{b{de}}}h{}{}}00{{{b{c}}}h{}}000{{}Gf}{{}Gh}{f{{b{c}}}{}}00{f{{b{dc}}}{}}00{fh}00{{{b{Gd}}{b{Gd}}}A`}{{{b{Gf}}{b{Gf}}}A`}{{{b{Gh}}{b{Gh}}}A`}{{{b{Gd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gh}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}00{GjGh}{GfGh}{GlGf}{{{b{Gd}}{b{dc}}}hCb}{{{b{Gf}}{b{dc}}}hCb}{{{b{Gd}}}Gn}{{}f}00{ce{}{}}00{{}Gf}{{{b{Gd}}}f}{GfGl}{{{b{c}}}e{}{}}00{c{{Aj{e}}}{}{}}00000{{{b{c}}}Al{}}004```````````````````````````{{{b{c}}}{{b{e}}}{}{}}{{{b{dc}}}{{b{de}}}{}{}}`{f{{b{c}}}{}}{f{{b{dc}}}{}}{fh}{cc{}}`=<<``````{{{b{dH`}}}Dd}{CfCf}```998````````````````````{{{b{Hb}}{b{Hd}}}Hd}{{{b{Hb}}}Hf}```{{{b{Hb}}Al}{{Dd{h}}}}{{{b{Hb}}Hd}h}{{{b{Hb}}{b{Hh}}}A`}`{{{b{Hb}}{b{Hd}}}h}```{{{b{Hb}}{b{Hj}}}h}`{{{b{Hb}}{b{Hj}}}A`}`2`{Hl{{Hn{Hl}}}}```{{HlI`}{{Hn{Hl}}}}``{{{b{Hb}}}{{Dd{Ib}}}}`{{{b{Id}}}{{b{Hh}}}}`{{{b{Hb}}{b{If}}}Hd}{{{b{Hb}}{b{Ih}}}h}{{{b{Ij}}{b{Il}}{b{dIn}}}h}{{{b{Hb}}{b{Hd}}{b{J`}}}h}{{{b{Hb}}{b{Hd}}{b{Hd}}}h}{{{b{Hb}}{b{Hh}}}Jb}{{{b{Id}}Jb}h}``````{{{b{Hb}}Hd}A`}`````8{{}h}{{{b{Id}}}h}3````{ec{}{{Af{{b{Ih}}}{{Jd{c}}}}}}{{{b{Ih}}}Jf}{Ih{{Aj{hJh}}}}{{{b{Ih}}e}c{}{{Jj{}{{Jd{c}}}}}}```````````{{{b{Jl}}{b{Hh}}}{{Dd{Il}}}}{c{{Jn{c}}}K`}{c{{Kb{c}}}Kd}>{{{b{dIn}}{b{Il}}A`}h}{{{b{dIn}}{b{Il}}{b{K`}}}h}{{{b{dIn}}{b{Il}}{b{Kf}}}h}{{{b{dIn}}{b{Il}}Kh}h}{{{b{dIn}}{b{Il}}Kj}h}{{{b{dIn}}{b{Il}}Kl}h}{{{b{dIn}}{b{Il}}{b{B`}}}h}{{{b{dIn}}{b{Il}}Kn}h}{{{b{dIn}}{b{Il}}Gl}h}````{Hl{{Hn{Hl}}}}{{HlI`}{{Hn{Hl}}}}{L`{{Lb{L`}}}}{{L`c}{{Lb{L`}}}{{Cn{Ih}}}}````````````````{{{b{Ld}}}{{Dd{{b{Hd}}}}}}`````{{{b{Hb}}{b{Hd}}}Hd}{{{b{Hb}}}Hf}{{{b{Hb}}Al}{{Dd{h}}}}{{{b{Hb}}Hd}h}{{{b{Hb}}{b{Hh}}}A`}{{{b{Hb}}{b{Hd}}}h}{{{b{Hb}}{b{Hj}}}h}{{{b{Hb}}{b{Hj}}}A`}2{{{b{Hb}}}{{Dd{Ib}}}}{{{b{Hb}}{b{If}}}Hd}{{{b{Hb}}{b{Ih}}}h}{{{b{Hb}}{b{Hd}}{b{J`}}}h}{{{b{Hb}}{b{Hd}}{b{Hd}}}h}{{{b{Hb}}{b{Hh}}}Jb}{cJf{HbEhEj}}{c{{Aj{hJh}}}{HbEhEj}}{{{b{Hb}}Hd}A`}{{cg}e{HbEhEj}{}{{Jj{}{{Jd{e}}}}}}``{{{b{Lf}}{b{dLh}}{b{Lf}}}h}`````````{e{{Lj{c}}}{}{{Ed{{b{Ll}}}{{Jd{c}}}}EhEj}}```{{{b{B`}}}{{Lj{c}}}{}}`````{e{{Lj{c}}}{}{{Cn{c}}}}```````````````````````````````````````{{{b{c}}}{{b{e}}}{}{}}00{{{b{dc}}}{{b{de}}}{}{}}00{{{b{Ln}}}Ln}{{{b{M`}}}M`}{{{b{c}}{b{de}}}h{}{}}0{{{b{c}}}h{}}00`{{}M`}{f{{b{c}}}{}}00{f{{b{dc}}}{}}00{fh}00{{{b{M`}}{b{M`}}}A`}`{{{b{Mb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ln}}{b{dBl}}}{{Aj{hBn}}}}{{{b{M`}}{b{dBl}}}{{Aj{hBn}}}}``{cc{}}00{{{b{Mb}}}{{b{Gj}}}}`{{}f}00{{{b{dMb}}{b{dMd}}{b{dMf}}Mh}{{Dd{Ln}}}}{ce{}{}}00`{MjMb}```{{{b{M`}}}Ml}{{{b{c}}}e{}{}}0{c{{Aj{e}}}{}{}}00000{{{b{c}}}Al{}}00```````{CfMn}`0```````````````````````````{{}N`}{{}Nb}{e{{Ah{Nd}}}{}{{Nd{c}}}}{{{b{Nd}}}{{b{Ef}}}}{{{b{Nf}}}Gl}{{N`N`}N`}{{NbNb}Nb}{{{b{dN`}}N`}h}{{{b{dNb}}Nb}h}3210{{{b{N`}}}D`}0{{{b{Nb}}}D`}05432{{{b{c}}}{{b{e}}}{}{}}00{{{b{dc}}}{{b{de}}}{}{}}00{{{b{d{Nj{}{{Nh{c}}}}}}{b{dNl}}{b{de}}}{{Df{c{O`{Nn}}}}}{}{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dNl}}{b{de}}}c{}Od}{{{b{N`}}}N`}{{{b{Nb}}}Nb}{{{b{Nf}}}Nf}{{{b{c}}{b{de}}}h{}{}}00{{{b{c}}}h{}}00000{{{b{Nf}}{b{Nf}}}Of}{N`N`}{NbNb}{{{b{N`}}N`}A`}{{{b{Nb}}Nb}A`}{{}N`}{{}Nb}{{}Nf}{f{{b{c}}}{}}00{f{{b{dc}}}{}}00{{N`N`}N`}{{NbNb}Nb}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOh}}{b{de}}}h{}Od}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOh}}{b{de}}}h{}{}}{fh}00{{{b{dNd}}{b{dNl}}{b{dc}}}{{Ah{Ef}}}{}}{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOh}}{b{dc}}}h{}}{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dLh}}{b{dc}}{b{Nd}}}h{}}>={{{b{N`}}{b{N`}}}A`}{{{b{Nb}}{b{Nb}}}A`}{{{b{Nf}}{b{Nf}}}A`}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOj}}{b{de}}{b{n}}}h{}Od}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOj}}{b{de}}{b{n}}}h{}{}}{{{b{dN`}}c}h{{A@b{}{{A@`{N`}}}}}}{{{b{dNb}}c}h{{A@b{}{{A@`{Nb}}}}}}{{{b{N`}}{b{dBl}}}{{Aj{hBn}}}}0000{{{b{Nb}}{b{dBl}}}{{Aj{hBn}}}}0000{{{b{Nf}}{b{dBl}}}{{Aj{hBn}}}}0{cc{}}00{D`{{Dd{N`}}}}{D`{{Dd{Nb}}}}{D`N`}0{D`Nb}010{cN`{{A@b{}{{A@`{N`}}}}}}{cNb{{A@b{}{{A@`{Nb}}}}}}{{{b{B`}}}{{Dd{N`}}}}{{{b{B`}}}{{Dd{Nb}}}}{{{b{N`}}{b{dc}}}hCb}{{{b{Nb}}{b{dc}}}hCb}{{{b{Nf}}{b{dc}}}hCb}{{}f}00{{{b{dN`}}N`}h}{{{b{dNb}}Nb}h}{{N`N`}N`}{{NbNb}Nb}{{{b{N`}}N`}A`}{{{b{Nb}}Nb}A`}{ce{}{}}00{N`}{Nb}{{{b{N`}}}A`}{{{b{Nb}}}A`}10{{{b{N`}}}{{A@d{N`}}}}{{{b{Nb}}}{{A@d{Nb}}}}{{{b{N`}}}{{A@f{N`}}}}{{{b{Nb}}}{{A@f{Nb}}}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOl}}{b{de}}On}Gb{}Od}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOl}}{b{de}}On}Gb{}{}}{{{b{{Nj{}{{Nh{c}}}}}}}f{}}{{}Nf}{N`N`}{NbNb}{{{b{Nf}}{b{Nf}}}{{Dd{Of}}}}{c{{A@h{c}}}{}}{{{b{d{Nj{}{{Nh{c}}}}}}{b{dc}}{b{dNl}}{b{de}}{b{{Nj{}{{Nh{c}}}}}}}h{}{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dLh}}{b{de}}{b{{Ob{}{{Nh{c}}}}}}}h{}Od}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dLh}}{b{de}}{b{{Nj{}{{Nh{c}}}}}}}h{}{}}{{{b{dN`}}N`}h}{{{b{dNb}}Nb}h}{{{b{dN`}}N`A`}h}{{{b{dNb}}NbA`}h}{{N`N`}N`}{{NbNb}Nb}5410{{{b{c}}}e{}{}}00{{{b{c}}}Dh{}}{{{b{c}}}Dj{}}87{c{{Aj{e}}}{}{}}00000{{{b{c}}}Al{}}0065```````````````````````````````````````````````````{{ce}{{A@j{e}}}{{Cn{A@l}}}{}}````````````{i{{A@n{egc}}}{}{}{}{{Af{{b{dc}}{b{dOj}}{b{de}}{b{n}}}{{Jd{{Dd{g}}}}}}}}``````{{ce}{{AA`{e}}}{{Cn{{Lj{Cd}}}}}{}}`````````````````````````````````````````````````````{c{{A@j{c}}}{}}00{c{{AAb{c}}}{}}``1{A`AAd}`{{Cfc}{{AAf{e}}}{{Cn{AAh}}}{}}{{ce}{{AAj{gce}}}{}{}{}}```````````````{{}{{AAl{c}}}{}}`{{ce}{{AAn{e}}}{{Cn{On}}}{}}{c{{AA`{c}}}{}}```````````````````````````{{Gbc}{{AAf{e}}}{{Cn{AAh}}}{}}`{c{{AB`{c}}}{}}``0`{{ei}{{ABb{cgi}}}{}{{Af{{b{dc}}{b{dAf}}}}}{}{{Ob{g}}}}````````````````````````````````{{Cfc}{{AAn{c}}}{}}{c{{ABd{c}}}{}}{c{{ABf{c}}}{}}`{{}{{ABf{{O`{{Ah{Nd}}}}}}}}{{}{{ABf{{O`{c}}}}}{}}{c{{ABh{c}}}{}}`{{}{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABh{{O`{c}}}}}{}}````````````{c{{A@j{c}}}{}}````````````8{{ce}{{AAn{e}}}{{Cn{Gb}}}{}}9{{gk}{{ABj{cie}}}{}ABl{{Jj{{b{dc}}}{{Jd{e}}}}}{{Ob{c}}}{{Jj{{b{dc}}}{{Jd{i}}}}}}:1:`{{cg}{{ABn{ec}}}{}{}{{Af{{b{dNl}}{b{de}}}}}}{{eg}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{cg}{{ACb{ec}}}{}{}{{Af{{b{dOh}}{b{de}}}}}}`{{cg}{{ACd{ec}}}{}{}{{Af{{b{dOj}}{b{de}}{b{n}}}}}}0````2{{cg}{{ACf{ec}}}{}{}{{Af{{b{dLh}}{b{de}}}}}}3`{c{{ACh{c}}}Ob}`{{ce}{{ACj{e}}}{{Cn{ACl}}}{}}{{Cfc}{{ACj{c}}}{}}000`````{e{{AAf{c}}}{}{{Af{{b{dOh}}{b{dc}}}}}}`````{{Gbc}{{AAf{e}}}{{Cn{AAh}}}{}}<{{Cfc}{{ACn{c}}}{}}0`{{ce}{{ACn{e}}}{{Cn{AD`}}}{}}=`````{Cf{{ADb{c}}}{}}``````{c{{ADd{hc}}}{ADfEh}}{cADh{{Cn{Dh}}}}````{{}{{ADj{c}}}{}}`{{ce}{{ADl{c}}}{}{{Cn{Dh}}}}{c{{A@j{c}}}{}}00{{ADnc}{{ACn{c}}}{}}`{{MnA`g}{{A@n{ceCf}}}{}{}{{Af{{b{dOj}}{b{dc}}Cf}{{Jd{e}}}}}}````````{{Mng}{{A@n{ceCf}}}{}{}{{Af{{b{dOj}}{b{dc}}Cf}{{Jd{e}}}}}}009{c{{AE`{c}}}{}}`{c{{ABd{c}}}{}}{c{{ABf{c}}}{}}`{{}{{ABf{{O`{{Ah{Nd}}}}}}}}{{}{{ABf{{O`{c}}}}}{}}{c{{ABh{c}}}{}}`{{}{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABh{{O`{c}}}}}{}}{{Cfc}{{AAn{c}}}{}}````{{ei}{{`{{Ob{k}}}}}{}{{Af{}{{Jd{c}}}}}{{Ob{c}}}{{Af{{b{dc}}}{{Jd{g}}}}}{}}{g{{`{{Ob{i}}}}}En{{Ob{c}}}{{Af{{b{dc}}}{{Jd{e}}}}}{}}{{ek}{{AEb{gci}}}{}{{Af{}{{Jd{c}}}}}{}{{Ob{{Df{gc}}}}}{{Af{{b{dg}}{b{dc}}}{{Jd{i}}}}}}{i{{AEb{ceg}}}{}En{{Ob{{Df{ce}}}}}{{Af{{b{dc}}{b{de}}}{{Jd{g}}}}}}{{cg}{{AEd{g}}}{{Cn{Ll}}}{}{{Ob{e}}}}{e{{`{{Ob{{Df{gc}}}}}}}{}{{Ob{c}}}{}}{e{{`{{Ob{{Df{cg}}}}}}}{}{{Ob{c}}}{}}``````{c{{AEf{c}}}{}}````````````````````````````````````````````````````````{{{b{c}}}{{b{e}}}{}{}}0{{{b{dc}}}{{b{de}}}{}{}}0{{{b{AEh}}}AEh}{{{b{AEj}}}AEj}{{{b{c}}{b{de}}}h{}{}}0{{{b{c}}}h{}}0````{f{{b{c}}}{}}0{f{{b{dc}}}{}}0{{{b{AEj}}{b{AEl}}}{{O`{AEh}}}}{fh}0{{{b{AEh}}{b{AEh}}}A`}{{{b{AEh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AEj}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}0```{{}f}0{ce{}{}}0````````````{{{b{c}}}e{}{}}0{c{{Aj{e}}}{}{}}000{{{b{c}}}Al{}}0`````````````````{{{b{AEn}}}{{b{B`}}}}{{{b{c}}}{{b{e}}}{}{}}0000{{{b{dc}}}{{b{de}}}{}{}}0000`{{{b{Hh}}}AF`}{{c{b{Hh}}{b{AFb}}}I`{{Cn{{Dd{Hd}}}}}}{{{b{I`}}}I`}{{{b{Ih}}}Ih}{{{b{AEn}}}AEn}{{{b{Hd}}}Hd}{{{b{c}}{b{de}}}h{}{}}000{{{b{Hb}}{b{Hd}}}Hd}{{{b{Ih}}{b{Hd}}}Hd}{{{b{c}}}h{}}0000{{{b{AEn}}{b{AEn}}}Of}{{}I`}{{{b{Hb}}}Hf}{{{b{Ih}}}Hf}``{{}Ih}{f{{b{c}}}{}}0000{f{{b{dc}}}{}}0000`{{{b{Hb}}Al}{{Dd{h}}}}{{{b{Hb}}}{{Dd{{b{c}}}}}Ef}000{{{b{Ih}}}{{Dd{{b{c}}}}}Ef}{{{b{Ih}}}AFd}{{{b{dI`}}}h}{fh}0000{{{b{Hb}}Hd}h}{{{b{Ih}}Hd}h}{{{b{Hb}}{b{Hh}}}A`}{{{b{Ih}}{b{Hh}}}A`}`{{{b{Hb}}{b{Hd}}}h}{{{b{I`}}}AFf}{{{b{Ih}}{b{Hd}}}h}{I`AFh}{{{b{I`}}{b{I`}}}A`}{{{b{Hh}}{b{Hh}}}A`}{{{b{AEn}}{b{Ib}}}A`}{{{b{AEn}}{b{AEn}}}A`}{{{b{Hd}}{b{Hd}}}A`}```{{{b{Hb}}{b{Hj}}}h}{{{b{Ih}}{b{Hj}}}h}`{{{b{Hb}}{b{Hj}}}A`}`;9`{{{b{I`}}{b{c}}}{{Dd{Il}}}{JlOd}}{{{b{Hh}}}{{b{AFj}}}}{{{b{Hh}}}{{Dd{{b{B`}}}}}}{{{b{Ij}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{I`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Hh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ih}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AEn}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Hd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{I`}}c}{{b{I`}}}{{Cn{{Dd{Hd}}}}}}{cc{}}00{cIh{HbEhEj}}11{{{AFl{Gl}}}Hd}{{{b{B`}}}{{Aj{AEnAFn}}}}{GlHd}{{{b{AEn}}{b{Ib}}}A`}{{{b{AEn}}{b{AEn}}}A`}10{{{b{I`}}{b{c}}}A`{JlOd}}{{{b{I`}}{b{dc}}}hCb}{{{b{AEn}}{b{dc}}}hCb}{{{b{Hd}}{b{dc}}}hCb}{{{b{I`}}}{{Dd{Hd}}}}{Hl{{Hn{Hl}}}}{{{b{I`}}e}c{}{{Jj{}{{Jd{c}}}}}}``{{}f}0000`{{HlI`}{{Hn{Hl}}}}`{ce{}{}}0000{{{b{Hd}}}{{AFl{Gl}}}}{{{b{Hd}}}Gl}{{{b{Hb}}}A`}000{{{b{Ih}}}A`}{{{b{I`}}}A`}{{{b{Hh}}}A`}10{{{b{AEn}}{b{Ib}}}A`}{{{b{AEn}}{b{AEn}}}A`}{{{b{Hh}}}{{b{AEn}}}}`{{{b{Hh}}}{{Dd{Mj}}}}32{{{b{Hb}}}{{Dd{Ib}}}}`{{{b{Id}}}{{b{Hh}}}}{{{b{I`}}}{{Dd{{b{Hh}}}}}}`{{{b{Hh}}}{{Dd{{b{B`}}}}}}{{{b{Hh}}}{{b{B`}}}}{{{b{Hh}}{b{AFb}}}I`}{{{b{B`}}{b{B`}}AEn{Dd{{b{B`}}}}{Dd{Mj}}{Dd{{b{B`}}}}AFjAG`}Hh}{cIh{HbEhEj}}{{{b{Hh}}}I`}3{{{b{Hb}}{b{If}}}Hd}{{{b{Ih}}{b{If}}}Hd}{{}I`}{{}Ih}{{{b{Hb}}{b{Ih}}}h}{I`I`}{{{b{AEn}}{b{AEn}}}{{Dd{Of}}}}{{{b{AEn}}{b{Ib}}}{{Dd{Of}}}}{{{b{Ij}}{b{Il}}{b{dIn}}}h}{{{b{Hb}}{b{Hd}}{b{J`}}}h}{{{b{I`}}{b{c}}e}{{b{I`}}}{JlOd}Ij}{{{b{Ih}}{b{Hd}}{b{J`}}}h}{{{b{I`}}{b{AFb}}}{{b{I`}}}}{{{b{Hb}}{b{Hd}}{b{Hd}}}h}{{{b{Ih}}{b{Hd}}{b{Hd}}}h}{{{b{Hb}}{b{Hh}}}Jb}{{{b{Ih}}{b{Hh}}}Jb}{{{b{Id}}Jb}h}````{{{b{Hh}}}{{b{B`}}}}{{{b{c}}}e{}{}}000{{{b{c}}}Dh{}}{{{b{c}}}Dj{}}``{{{b{Hb}}Hd}A`}{{{b{Ih}}Hd}A`}{c{{Aj{e}}}{}{}}000000000{{{b{c}}}Al{}}0000``{{{b{I`}}e}{{Dd{c}}}{}{{Jj{{Df{{b{Hd}}{b{Ih}}}}}{{Jd{c}}}}}}```{{{b{c}}}{{b{e}}}{}{}}0{{{b{dc}}}{{b{de}}}{}{}}0{{{b{AF`}}}AF`}{{{b{c}}{b{de}}}h{}{}}{{{b{c}}}h{}}{f{{b{c}}}{}}0{f{{b{dc}}}{}}0{fh}0{{{b{AF`}}{b{AF`}}}A`}{{{b{AF`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AGb}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}0{{{b{AF`}}{b{dc}}}hCb}{{}f}0{{{b{AGb}}}Jb}{ce{}{}}0{{{b{Id}}}{{b{Hh}}}}{{{b{AGb}}}{{b{Hh}}}}{{{b{Hh}}}AGb}{{}h}{{{b{Id}}}h}6{{{b{Id}}Jb}h}{{{b{AGb}}Jb}h}{{{b{c}}}e{}{}}{c{{Aj{e}}}{}{}}000{{{b{c}}}Al{}}0````{{{b{c}}}{{b{e}}}{}{}}{{{b{dc}}}{{b{de}}}{}{}}{{{b{AFd}}}AFd}{{{b{c}}{b{de}}}h{}{}}{{{b{c}}}h{}}{f{{b{c}}}{}}{f{{b{dc}}}{}}{fh}{{{b{AFd}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}{ec{}{{Af{{b{Ih}}}{{Jd{c}}}}}}{{}f}{ce{}{}}{{{b{Ih}}}Jf}{Ih{{Aj{hJh}}}}{{{b{c}}}e{}{}}{c{{Aj{e}}}{}{}}0{{{b{c}}}Al{}}{{{b{AFd}}}{{Dd{Ih}}}}{{{b{Ih}}e}c{}{{Jj{}{{Jd{c}}}}}}`{{{b{c}}}{{b{e}}}{}{}}{{{b{dc}}}{{b{de}}}{}{}}{{c{b{Hh}}{b{AFb}}}h{{Cn{{Dd{Hd}}}}}}{f{{b{c}}}{}}{f{{b{dc}}}{}}{{{b{Hh}}{b{AFb}}}h}{fh}{{{b{Hj}}}AGd}{{{b{Hj}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}{{}f}{ce{}{}}{{{b{Hj}}}A`}0{{{b{Hj}}}{{b{Hh}}}}{{{b{Hh}}{b{AFb}}}Hj}{{c{b{Hh}}{b{AFb}}}Hj{{Cn{{Dd{Hd}}}}}}{{{b{Hj}}}{{Dd{{b{Hd}}}}}}{{{b{Hj}}{b{dIn}}}h}{c{{Aj{e}}}{}{}}0{{{b{c}}}Al{}}``````````{{{b{Jl}}{b{Hh}}}{{Dd{Il}}}}{{{b{Il}}{b{Hh}}}{{Dd{Il}}}}{{{b{{b{Il}}}}{b{Hh}}}{{Dd{Il}}}}{{{b{Il}}}{{b{B`}}}}{{{b{c}}}{{b{e}}}{}{}}000000{{{b{dc}}}{{b{de}}}{}{}}000000{{{b{AFb}}}AF`}{{{b{Il}}}AF`}{{{b{Il}}}Il}{{{b{{Kb{c}}}}}{{Kb{c}}}{AGfKd}}{{{b{{Jn{c}}}}}{{Jn{c}}}{AGfK`}}{{{b{c}}{b{de}}}h{}{}}00{{{b{c}}}h{}}00{{{b{AFj}}{b{Il}}}A`}{c{{Jn{c}}}K`}{f{{b{c}}}{}}000000{f{{b{dc}}}{}}000000{c{{Kb{c}}}Kd}{fh}000000{{{b{AFj}}{b{AFj}}}A`}{{{b{Il}}{b{Il}}}A`}{{{b{AGh}}{b{AGh}}}A`}{{{b{AFj}}{b{c}}}{{Dd{Il}}}{{AGj{B`}}Od}}{{{b{AFj}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AFb}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Il}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AGh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AGd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{{Kb{c}}}}{b{dBl}}}{{Aj{hBn}}}Kd}0{{{b{{Jn{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{cc{}}000000{{{b{Il}}{b{dc}}}hCb}{{}f}000000{ce{}{}}000000{{{b{AFj}}}}1{{{b{AFj}}}A`}{{{b{AFb}}}A`}{{{b{AFj}}}AGd}{{{b{AFj}}}f}{{{b{AFb}}}f}{{{b{Il}}}{{b{B`}}}}{{{b{{AGl{{b{B`}}}}}}AF`}AFj}{{{b{dAGd}}}{{Dd{Il}}}}{c{{AGn{e}}}{}{}}{{{b{Ij}}{b{Il}}{b{dIn}}}h}{{{b{AFb}}{b{dIn}}}h}{{{b{AGh}}{b{Il}}{b{dIn}}}h}{{{b{{Kb{c}}}}{b{Il}}{b{dIn}}}hKd}{{{b{{Jn{c}}}}{b{Il}}{b{dIn}}}hK`}{{{b{dIn}}{b{Il}}A`}h}{{{b{dIn}}{b{Il}}{b{K`}}}h}{{{b{dIn}}{b{Il}}{b{Kf}}}h}{{{b{dIn}}{b{Il}}Kh}h}{{{b{dIn}}{b{Il}}Kj}h}{{{b{dIn}}{b{Il}}Kl}h}{{{b{dIn}}{b{Il}}{b{B`}}}h}{{{b{dIn}}{b{Il}}Kn}h}{{{b{dIn}}{b{Il}}Gl}h}{{{b{c}}}e{}{}}00{{{b{c}}}Dh{}}000{{{b{c}}}Dj{}}000{c{{Aj{e}}}{}{}}0000000000000{{{b{c}}}Al{}}000000````{{{b{c}}}{{b{e}}}{}{}}0{{{b{dc}}}{{b{de}}}{}{}}0{{{b{{Lb{c}}}}}{{Lb{c}}}AGf}{{{b{{Hn{c}}}}}{{Hn{c}}}AGf}{{{b{c}}{b{de}}}h{}{}}0{{{b{c}}}h{}}0{f{{b{c}}}{}}0{f{{b{dc}}}{}}0{{{b{{Lb{c}}}}}{{b{Ih}}}{}}{fh}{{{b{d{Hn{c}}}}}h{}}1{{{b{{Lb{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{{{b{{Hn{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{cc{}}0{Hl{{Hn{Hl}}}}{{}f}0{{{b{{Lb{c}}}}}{{b{c}}}{}}{{{b{{Hn{c}}}}}{{b{c}}}{}}{{{b{d{Lb{c}}}}}{{b{dc}}}{}}{{{b{d{Hn{c}}}}}{{b{dc}}}{}}{{{AH`{{b{d{Lb{c}}}}}}}{{AH`{{b{dc}}}}}{}}{{{AH`{{b{d{Hn{c}}}}}}}{{AH`{{b{dc}}}}}{}}{{{AH`{{b{{Lb{c}}}}}}}{{AH`{{b{c}}}}}{}}{{{AH`{{b{{Hn{c}}}}}}}{{AH`{{b{c}}}}}{}}{{HlI`}{{Hn{Hl}}}}{ce{}{}}0{c{}{}}0{{{Lb{c}}}c{}}{{{Hn{c}}}c{}}{{{AH`{{b{d{Lb{c}}}}}}{b{dAHb}}}AHdADf}{{{AH`{{b{d{Hn{c}}}}}}{b{dAHb}}}AHdADf}{{{b{{Hn{c}}}}}{{b{I`}}}{}}{{{b{d{Hn{c}}}}}{{b{dI`}}}{}}{{{b{c}}}e{}{}}0{c{{Aj{e}}}{}{}}000{{{b{c}}}Al{}}0{L`{{Lb{L`}}}}{{L`c}{{Lb{L`}}}{{Cn{Ih}}}}``````````````````{{{b{c}}}{{b{e}}}{}{}}000{{{b{dc}}}{{b{de}}}{}{}}000{{{b{AG`}}}AG`}{{{b{Ib}}}Ib}{{{b{AHf}}}AHf}{{{b{c}}{b{de}}}h{}{}}00{{{b{c}}}h{}}000{{{b{Ib}}{b{Ib}}}Of}{{}Ib}{f{{b{c}}}{}}000{f{{b{dc}}}{}}000{fh}000{{{b{AG`}}{b{AG`}}}A`}{{{b{Ib}}{b{Ib}}}A`}{{{b{Ib}}{b{AEn}}}A`}{{{b{AG`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ib}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AHf}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AFn}}{b{dBl}}}{{Aj{hBn}}}}0{cc{}}0{{{Dd{AEn}}}Ib}{AEnIb}220{{{b{B`}}}{{Aj{Ib}}}}8989{{{b{Ib}}{b{dc}}}hCb}{AG`AG`}{{}f}000{ce{}{}}000{Ib{{Dd{AEn}}}}{{{b{AG`}}}A`}00>?>?{{{b{Ib}}{b{AEn}}}{{Dd{Of}}}}{{{b{Ib}}{b{Ib}}}{{Dd{Of}}}}{{{b{c}}}e{}{}}00{{{b{c}}}Dh{}}00{{{b{c}}}Dj{}}00{c{{Aj{e}}}{}{}}0000000{{{b{c}}}Al{}}000```````{{{b{Ld}}}{{Dd{{b{Hd}}}}}}{{{b{c}}}{{b{e}}}{}{}}000{{{b{dc}}}{{b{de}}}{}{}}000{{Hd{b{Hh}}{b{AFb}}}If}{{{b{If}}{b{Il}}}A`}{{{b{J`}}{b{Il}}}A`}{f{{b{c}}}{}}{{{b{AFh}}}{{b{I`}}}}111{f{{b{dc}}}{}}000{{{b{dAFf}}}h}{fh}0{{{b{dAFh}}}h}11{AFhI`}{{{b{If}}}{{b{AFj}}}}{{{b{AFf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AFh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{If}}{b{dBl}}}{{Aj{hBn}}}}{{{b{J`}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}000{{{b{AFh}}}{{Dd{Hd}}}}{{}f}000{ce{}{}}000{{{b{If}}}A`}0{{{b{J`}}}A`}1{{{b{J`}}}f}{{{b{If}}}{{b{Hh}}}}{{{b{Hh}}{b{AFb}}}If}{{{b{AFb}}}J`}1{{{b{If}}}{{Dd{{b{Hd}}}}}}{{{b{If}}{b{dIn}}}h}{{{b{J`}}{b{dIn}}}h}{c{{Aj{e}}}{}{}}0000000{{{b{c}}}Al{}}000{{{b{If}}}{{b{AFb}}}}`````{{}Jb}{{{b{c}}}{{b{e}}}{}{}}000{{{b{dc}}}{{b{de}}}{}{}}000{{{b{Jb}}}Jb}{{{b{AHh}}}AHh}{{{b{c}}{b{de}}}h{}{}}0{{{b{Hb}}{b{Hd}}}Hd}{{{b{c}}}h{}}00{{{b{Hb}}}Hf}{{}AHh}{f{{b{c}}}{}}000{f{{b{dc}}}{}}000{{{b{Hb}}Al}{{Dd{h}}}}{fh}{{{b{dJf}}}h}111{{{b{Hb}}Hd}h}{{{b{Hb}}{b{Hh}}}A`}{{{b{AHh}}{b{Hh}}}A`}{{{b{Hb}}{b{Hd}}}h}{{{b{AHh}}{b{Hd}}}h}{{{b{Hb}}{b{Hj}}}h}{{{b{AHh}}{b{Hj}}}h}{{{b{Hb}}{b{Hj}}}A`}43{{{b{Jh}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Jf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Jb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AHh}}{b{dBl}}}{{Aj{hBn}}}}{cc{}}000{{}f}000{ce{}{}}000{{{b{Jb}}}A`}00{{{b{Hb}}}{{Dd{Ib}}}}{{}Jb}{{}AHh}{{{b{Hb}}{b{If}}}Hd}{{{b{AHh}}{b{If}}}Hd}{{{b{Hb}}{b{Ih}}}h}{{{b{Hb}}{b{Hd}}{b{J`}}}h}{{{b{AHh}}{b{Hd}}{b{J`}}}h}{{{b{Hb}}{b{Hd}}{b{Hd}}}h}{{{b{AHh}}{b{Hd}}{b{Hd}}}h}{{{b{Hb}}{b{Hh}}}Jb}{{{b{AHh}}{b{Hh}}}Jb}{cJf{HbEhEj}}{c{{Aj{hJh}}}{HbEhEj}}<{{{b{c}}}e{}{}}0{{{b{c}}}Dh{}}{{{b{c}}}Dj{}}{{{b{Hb}}Hd}A`}{c{{Aj{e}}}{}{}}0000000{{{b{c}}}Al{}}000{{cg}e{HbEhEj}{}{{Jj{}{{Jd{e}}}}}}`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{b{Cd}}}D`}`{{{b{Oj}}}A`}{{CdCd}}{{AHjCf}}{{AHjAD`}}{{AHjGb}}{{C`AD`}}{{C`Gb}}{{GbCf}}{{GbAD`}}{{GbGb}}{{OnGb}}{{AD`Cf}}{{AD`AD`}}{{{b{dCd}}Cd}h}{{{b{dAHj}}Gb}h}{{{b{dAHj}}AD`}h}{{{b{dAHj}}Cf}h}{{{b{dC`}}AD`}h}{{{b{dC`}}Gb}h}{{{b{dGb}}Cf}h}{{{b{dGb}}Gb}h}{{{b{dGb}}AD`}h}{{{b{dOn}}Gb}h}{{{b{dAD`}}Cf}h}{{{b{dAD`}}AD`}h}{{{b{d{AHl{c}}}}e}h{}Ef}{{{b{d{AHl{c}}}}{b{dc}}{Ah{Af}}AEl}h{}}{{{ABn{ce}}g}{{ABn{ce}}}{}{}{{Af{{b{dNl}}{b{dc}}}}}}{{{ACd{ce}}g}{{ACd{ce}}}{}{}{{Af{{b{dOj}}{b{dc}}{b{n}}}}}}``{{ce}{{A@j{e}}}{{Cn{A@l}}}{}}{{A@lGbGb}AD`}{{AHnCfCf}Cf}{{{ABf{c}}e}{{ABf{c}}}{}{{Cn{AHn}}}}{{ADhc}ADh{{Cn{{Lj{AI`}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AI`}}}}}}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{AHn}}}}`````````{CfAIb}{CfAId}{CfACl}{CfAHj}{CfGb}{CfAD`}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cd}}}}}}```{{{AB`{c}}Cf}{{AB`{c}}}{}}`{AD`Cf}{{AD`AD`}Cf}{i{{A@n{egc}}}{}{}{}{{Af{{b{dc}}{b{dOj}}{b{de}}{b{n}}}{{Jd{{Dd{g}}}}}}}}{{{b{dNl}}}h}{{{b{dOj}}}h}{{{b{dLh}}}h}``{e{{Ah{Nd}}}{}{{Nd{c}}}}{{{b{AIf}}}A`}{AIh{{ABf{{O`{{Ah{Nd}}}}}}}}{AIh{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABf{{O`{{Ah{Nd}}}}}}}}0{C`Cf}{{{b{Nd}}}{{b{Ef}}}}{{{b{c}}}{{b{Ef}}}{}}0000000000000000000000000000000000{{{b{dOj}}}Nl}{{{b{dLh}}}Nl}{Fn{{Dd{AIj}}}}{{{b{AIl}}}AIn}{{{b{dLh}}}Ol}{{{b{dAJ`}}}{{b{dAJb}}}}{{{b{dOj}}}Lh}{{{b{AJ`}}}{{b{AJb}}}}{{{b{AJd}}}Gl}`{{{ABd{c}}e}{{ABd{c}}}{}{{Cn{AIh}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{AIh}}}}{{{ABf{c}}e}{{ABf{c}}}{}{{Cn{AIh}}}}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{AIh}}}}`````{{{b{Cd}}}D`}{{ce}{{AA`{e}}}{{Cn{{Lj{Cd}}}}}{}}{{AAdc}AAd{{Cn{{Lj{Cd}}}}}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{Cd}}}}}}{{{AA`{c}}e}{{AA`{c}}}{}{{Cn{{Lj{Cd}}}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{Cd}}}}}}```````````{{{ACd{ce}}g}{{ACd{ce}}}{}{}{{Af{{b{dOj}}{b{dc}}{b{n}}}}}}`{{C`C`}}{{OnOn}}{{{b{dC`}}C`}h}{{{b{dOn}}On}h}`{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{Cd}}}}}}98{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cd}}}}}}87``````````````{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{AIb}}}}}}{{AAdc}AAd{{Cn{{Lj{AIb}}}}}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{AIb}}}}}}{{{AA`{c}}e}{{AA`{c}}}{}{{Cn{{Lj{AIb}}}}}}{{{ABd{c}}e}{{ABd{c}}}{}{{Cn{{Lj{AIb}}}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{AIb}}}}}}``````````````{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{AId}}}}}}{{AAdc}AAd{{Cn{{Lj{AId}}}}}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{AId}}}}}}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cf}}}}}}{{{AA`{c}}e}{{AA`{c}}}{}{{Cn{{Lj{AId}}}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{AId}}}}}}``````````````{{{b{c}}}{{b{e}}}{}{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{dc}}}{{b{de}}}{}{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{c{{A@j{c}}}{}}{C`Cf}``{C`AHj}20`20`{{{b{Cj}}}C`}{{{b{AJ`}}}Gb}{{{b{AJb}}}Gb}{{{b{d{Nj{}{{Nh{c}}}}}}{b{dNl}}{b{de}}}{{Df{c{O`{Nn}}}}}{}{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dNl}}{b{de}}}c{}Od}{{}{{AJf{c}}}{}}{{{AJf{c}}Dn}{{AHl{c}}}{}}{{{b{d{A@n{ceg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{dNl}}{b{dc}}}{}{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{dNl}}{b{de}}}{}Ob{}}{{{b{d{ACf{ce}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{dNl}}{b{dc}}}{}{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{dGj}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{A@h{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AJh{e}}}}{b{dNl}}{b{dc}}}{{AJj{ce}}}{}{{Nj{c}}}}{{{b{d{A@j{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AJl{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{dAAd}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{AC`{ceg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AAj{ceg}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}{{Ob{c}}}}{{{b{d{AAl{c}}}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{AAn{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AB`{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ACj{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{AAf{c}}}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{ABd{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ADb{c}}}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{ABf{e}}}}{b{dNl}}{b{dc}}}{}{}{{Nj{c}}}}{{{b{dADh}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{ADj{c}}}}{b{dNl}}{b{dc}}}{}{}}{{{b{d{ADl{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ACn{e}}}}{b{dNl}}{b{dc}}}{}{}{{Ob{c}}}}{{{b{d{ABh{e}}}}{b{dNl}}{b{dc}}}{}{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{dNl}}{b{dc}}}{}{}{{Nj{c}}}}{c{{AAb{c}}}{}}{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{{Dd{AJn}}}}}}````{{{b{dOh}}}{{b{dAK`}}}}`{AHjAHj}{GbGb}{AD`AD`}{c{{A@j{c}}}{}}{C`AHj}00{{AHjGb}C`}{A`AAd}{{AAdc}AAd{{Cn{A`}}}}`{{{b{dNl}}}Nl}{{{b{dOh}}}Oh}{{{b{dOj}}}Oj}{{{b{dOl}}}Ol}{{{b{dLh}}}Lh}{{Cfc}{{AAf{e}}}{{Cn{AAh}}}{}}{{AHjCf}Cj}{{AHjAHjAHj}AHj}{{C`c}C`{{Cn{C`}}}}{{GbGbGb}Gb}{{AD`AD`AD`}AD`}{{{b{dAK`}}}h}{{{b{dCj}}}h}`{{{b{dAKb}}}{{b{dAKd}}}}{{{b{{AKf{c}}}}}{{AKf{c}}}Od}{{{b{AIb}}}AIb}{{{b{AId}}}AId}{{{b{AKh}}}AKh}{{{b{AKj}}}AKj}{{{b{AKl}}}AKl}{{{b{AAh}}}AAh}{{{b{Ch}}}Ch}{{{b{AK`}}}AK`}{{{b{Cd}}}Cd}{{{b{Cj}}}Cj}{{{b{AKn}}}AKn}{{{b{AL`}}}AL`}{{{b{ALb}}}ALb}{{{b{ALd}}}ALd}{{{b{ALf}}}ALf}{{{b{Fn}}}Fn}{{{b{G`}}}G`}{{{b{AIf}}}AIf}{{{b{AJd}}}AJd}{{{b{AJn}}}AJn}{{{b{ALh}}}ALh}{{{b{ALj}}}ALj}{{{b{ALl}}}ALl}{{{b{ALn}}}ALn}{{{b{AM`}}}AM`}{{{b{AMb}}}AMb}{{{b{Gn}}}Gn}{{{b{Gj}}}Gj}{{{b{ADn}}}ADn}{{{b{A@l}}}A@l}{{{b{AIh}}}AIh}{{{b{AHn}}}AHn}{{{b{AMd}}}AMd}{{{b{AMf}}}AMf}{{{b{ACl}}}ACl}{{{b{AHj}}}AHj}{{{b{C`}}}C`}{{{b{Gb}}}Gb}{{{b{On}}}On}{{{b{AD`}}}AD`}{{{b{AMh}}}AMh}{{{b{Ll}}}Ll}{{{b{{Lj{c}}}}}{{Lj{c}}}AGf}{{{b{AIl}}}AIl}{{{b{AMj}}}AMj}{{{b{AMl}}}AMl}{{{b{AMn}}}AMn}{{{b{AI`}}}AI`}{{{b{AN`}}}AN`}{{{b{ANb}}}ANb}{{{b{ANd}}}ANd}{{{b{Mn}}}Mn}{{{b{{A@h{c}}}}}{{A@h{c}}}AGf}{{{b{{AJh{c}}}}}{{AJh{c}}}AGf}{{{b{ANf}}}ANf}{{{b{ANh}}}ANh}{{{b{ANj}}}ANj}{{{b{ANl}}}ANl}{{{b{AEl}}}AEl}{{{b{ANn}}}ANn}{{{b{AO`}}}AO`}{{{b{c}}{b{de}}}h{}{}}0000000000000000000000000000000000000000000000000000000000000{{{b{c}}}h{}}00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{dCj}}}h}{{{b{d{AHl{c}}}}{b{dc}}ANj}A`{}}{{{b{d{l{c}}}}ANj}h{}}{{{b{dAKb}}c}h{EfEh}}{{{b{ALd}}c}h{EfEh}}{{{b{n}}}{{Dd{{b{c}}}}}Ef}{{{b{AKb}}e}h{EfEh}{{ADf{}{{Jd{c}}}}Eh}}{{{b{ALd}}e}h{EfEh}{{ADf{}{{Jd{c}}}}Eh}}{{{b{ALd}}E`}h}`{{ce}{{AAj{gce}}}{}{}{}}{{{b{dGj}}Cd}h}{{AElc}AEl{{Cn{{Dd{Cd}}}}}}{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{Cd}}}}}}{{AAdc}AAd{{Cn{{Lj{Cd}}}}}}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{Cd}}}}{{{ABd{c}}e}{{ABd{c}}}{}{{Cn{{Lj{Cd}}}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{Cd}}}}}}{{ADhc}ADh{{Cn{{Lj{Cd}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{Cd}}}}}}`````````````````{{}{{AAl{c}}}{}}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{Cf}}}}`{e{{Lj{c}}}{}{{Ed{{b{Ll}}}{{Jd{c}}}}EhEj}}{{{b{Mn}}CfA`}A`}{{{b{AMb}}}Gn}{{{b{dCj}}AHjAHjCf}h}{{ce}{{AAn{e}}}{{Cn{On}}}{}}{{OnOn}On}{{C`AHj}AHj}{c{{AA`{c}}}{}}{{{b{Cj}}AHjCh}A`}{{C`AHj}A`}{{{b{AKb}}}A`}{{{b{Nl}}}A`}{{{b{Oh}}}A`}{{{b{Oj}}}A`}{{{b{Ol}}}A`}{{{b{Lh}}}A`}{{{b{Nn}}}A`}{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{{A@h{e}}}}}}``````````````````````{{{b{AKb}}}{{b{c}}}Ef}{{{b{dAKb}}}{{b{dc}}}Ef}{{{b{dAKb}}}{{b{dc}}}{EfEn}}{{{b{AKb}}}{{b{El}}}}{{{b{dAKb}}}{{b{dEl}}}}`{{AD`AD`}Cf}`{{{b{dCj}}AHjAHjAHj}h}{{{b{Nn}}}{{Dd{ANf}}}}``{{}AMh}{{CdCf}Cd}{{{b{AMb}}}{{b{{AGl{D`}}}}}}{{{b{dAMb}}}{{b{d{AGl{D`}}}}}}`{{AElA`}AEl}`{{}{{AJf{c}}}{}}{{}AKd}{{}AIb}{{}AId}{{}AAh}{{}AK`}{{}Cd}{{}Cj}{{}ALb}{{}AIf}{{}AMb}{{}Gj}{{}ADn}{{}A@l}{{}AMf}{{}ACl}{{}AHj}{{}C`}{{}Gb}{{}On}{{}AD`}{{}AMh}{{}Ll}{{}AIl}{{}AMj}{{}AMl}{{}AMn}{{}AI`}{{}AN`}{{}AOb}{{}ANd}{{}Mn}{{}Nn}{{}ANf}{{}ANj}{{}ANl}{{}AEl}{{}{{AAl{c}}}{}}{{}AO`}{{}{{ADj{c}}}{}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{A`}}}}```{{{AJf{c}}e}{{AJf{c}}}{}{{j{c}}}}``{f{{b{c}}}{}}000{{{b{{l{c}}}}}b{}}11{{{b{Nl}}}b}22{{{b{Oh}}}b}3{{{b{Oj}}}b}{{{b{Ol}}}b}5{{{b{Lh}}}b}66{{{b{{AOd{ce}}}}}b{}{{Ob{c}}Od}}77{{{b{{AJj{ce}}}}}b{}{{Nj{c}}}}88888888888888888888888888888888888888{{{b{AMb}}}b}99{{{b{Gj}}}b}::::::::::::::::::::::::::::{{{b{{A@h{c}}}}}b{}}{{{b{{AJh{c}}}}}b{}}<<<<<<<<<<<<<<<<<<<<<<<<<{{{b{{ACj{c}}}}}b{}}==============={f{{b{dc}}}{}}000{{{b{d{l{c}}}}}{{b{d}}}{}}111{{{b{dNl}}}{{b{d}}}}2{{{b{dOh}}}{{b{d}}}}{{{b{dOj}}}{{b{d}}}}44{{{b{dOl}}}{{b{d}}}}5{{{b{dLh}}}{{b{d}}}}6{{{b{d{AOd{ce}}}}}{{b{d}}}{}{{Ob{c}}Od}}77{{{b{d{AJj{ce}}}}}{{b{d}}}{}{{Nj{c}}}}888888888888888888888888888888888888888{{{b{dAMb}}}{{b{d}}}}9999999999999999999999999999{{{b{d{A@h{c}}}}}{{b{d}}}{}}::{{{b{d{AJh{c}}}}}{{b{d}}}{}};;;;;;;;;;;;;;;;;;;;;;;{{{b{d{ACj{c}}}}}{{b{d}}}{}}<<<<<<<<<<<<<<<<{{CdCf}Cd}{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{A`}}}}``{AMfCf}{{AHjAHj}Cf}{{AHjAD`}}{{AHjCf}}{{AHjGb}}{{GbAD`}}{{GbCf}}{{GbGb}}{{AD`Cf}}{{AD`AD`}}{{{b{dAHj}}Gb}h}{{{b{dAHj}}AD`}h}{{{b{dAHj}}Cf}h}{{{b{dGb}}Cf}h}{{{b{dGb}}AD`}h}{{{b{dGb}}Gb}h}{{{b{dAD`}}Cf}h}{{{b{dAD`}}AD`}h}{{AD`AD`}Cf}{{{b{Gj}}}Gd}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOh}}{b{de}}}h{}Od}{{{b{dNl}}}h}{{{b{dOj}}}h}{{{b{dLh}}}h}{{{b{d{A@n{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{d}}{b{dOh}}{b{de}}}hOb{}}{{{b{d{ACf{ce}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{dGj}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{A@h{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{A@j{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AJl{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{dAAd}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{AC`{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AAj{ceg}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}{{Ob{c}}}}{{{b{d{AAl{c}}}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{AAn{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AB`{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ACj{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{AAf{c}}}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{AAf{c}}e}{{AAf{c}}}{}{{Cn{{Ah{Af}}}}}}{{{b{d{ABd{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ADb{c}}}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{ABf{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Nj{c}}}}{{{b{dADh}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{ADj{c}}}}{b{d}}{b{dOh}}{b{dc}}}h{}}{{{b{d{ADl{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ACn{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Ob{c}}}}{{{b{d{ABh{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{d}}{b{dOh}}{b{dc}}}h{}{{Nj{c}}}}`{{{b{dAOb}}{b{dAK`}}{b{AJb}}CdAD`Cf}h}{{{b{dOh}}AK`}h}{{{b{dAK`}}AK`}h}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOh}}{b{de}}}h{}{}}{{{b{d{AJh{e}}}}f{b{d{AJj{ce}}}}{b{dOh}}{b{dc}}}h{}{{Nj{c}}}}{{{b{d{AHl{c}}}}{b{dc}}ANj}{{Dd{AOf}}}{}}{fh}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000`{{{b{dNd}}{b{dNl}}{b{dc}}}{{Ah{Ef}}}{}}{{{b{dc}}{b{dNl}}{b{de}}}{{Ah{Ef}}}{}{}}0000000000000000000000000000000000{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOh}}{b{dc}}}h{}}{{{b{dc}}{b{d{Ah{Ef}}}}{b{dOh}}{b{de}}}h{}{}}0000000000000000000000000000000000{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{dc}}{b{d{Ah{Ef}}}}{b{dOj}}{b{de}}{b{n}}}h{}{}}0000000000000000000000000000000000{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{dc}}{b{d{Ah{Ef}}}}{b{dOl}}{b{de}}On}Gb{}{}}0000000000000000000000000000000000{{{b{dNd}}{b{d{Ah{Ef}}}}{b{dLh}}{b{dc}}{b{Nd}}}h{}}{{{b{dc}}{b{d{Ah{Ef}}}}{b{dLh}}{b{de}}{b{Nd}}}h{}{}}0000000000000000000000000000000000{CfMn}0`{{Gbc}{{AAf{e}}}{{Cn{AAh}}}{}}{C`Cj}{{{b{AIb}}{b{AIb}}}A`}{{{b{AId}}{b{AId}}}A`}{{{b{AKh}}{b{AKh}}}A`}{{{b{AKj}}{b{AKj}}}A`}{{{b{AKl}}{b{AKl}}}A`}{{{b{AAh}}{b{AAh}}}A`}{{{b{Ch}}{b{Ch}}}A`}{{{b{AK`}}{b{AK`}}}A`}{{{b{Cd}}{b{Cd}}}A`}{{{b{Cj}}{b{Cj}}}A`}{{{b{AKn}}{b{AKn}}}A`}{{{b{AL`}}{b{AL`}}}A`}{{{b{ALb}}{b{ALb}}}A`}{{{b{Fn}}{b{Fn}}}A`}{{{b{G`}}{b{G`}}}A`}{{{b{AIf}}{b{AIf}}}A`}{{{b{AJd}}{b{AJd}}}A`}{{{b{AJn}}{b{AJn}}}A`}{{{b{ALh}}{b{ALh}}}A`}{{{b{ALj}}{b{ALj}}}A`}{{{b{ALl}}{b{ALl}}}A`}{{{b{ALn}}{b{ALn}}}A`}{{{b{AM`}}{b{AM`}}}A`}{{{b{AMb}}{b{AMb}}}A`}{{{b{Gn}}{b{Gn}}}A`}{{{b{Gj}}{b{Gj}}}A`}{{{b{ADn}}{b{ADn}}}A`}{{{b{A@l}}{b{A@l}}}A`}{{{b{AIh}}{b{AIh}}}A`}{{{b{AHn}}{b{AHn}}}A`}{{{b{AMd}}{b{AMd}}}A`}{{{b{AMf}}{b{AMf}}}A`}{{{b{ACl}}{b{ACl}}}A`}{{{b{AHj}}{b{AHj}}}A`}{{{b{C`}}{b{C`}}}A`}{{{b{Gb}}{b{Gb}}}A`}{{{b{On}}{b{On}}}A`}{{{b{AD`}}{b{AD`}}}A`}{{{b{AIl}}{b{AIl}}}A`}{{{b{AMj}}{b{AMj}}}A`}{{{b{AMl}}{b{AMl}}}A`}{{{b{AMn}}{b{AMn}}}A`}{{{b{AI`}}{b{AI`}}}A`}{{{b{AN`}}{b{AN`}}}A`}{{{b{ANd}}{b{ANd}}}A`}{{{b{Mn}}{b{Mn}}}A`}{{{b{{A@h{c}}}}{b{{A@h{c}}}}}A`ABl}{{{b{{AJh{c}}}}{b{{AJh{c}}}}}A`ABl}{{{b{ANf}}{b{ANf}}}A`}{{{b{ANh}}{b{ANh}}}A`}{{{b{ANj}}{b{ANj}}}A`}{{{b{ANl}}{b{ANl}}}A`}{{{b{ANn}}{b{ANn}}}A`}`{{ANdCf}Cf}{{{b{dj}}{b{d{l{c}}}}{b{dc}}{b{n}}}A`{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOj}}{b{de}}{b{n}}}h{}Od}{{{b{d{AHl{c}}}}{b{dc}}{b{n}}}A`{}}{{{b{d{A@n{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{d}}{b{dOj}}{b{de}}{b{n}}}hOb{}}{{{b{d{ACf{ce}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{dGj}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{A@h{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{A@j{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AJl{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{dAAd}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{ANn}}}}{{{b{d{AC`{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AAj{ceg}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}{{Ob{c}}}}{{{b{d{AAl{c}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{AAn{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AB`{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ACj{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{AAf{c}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{ABd{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ADb{c}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{ABf{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Nj{c}}}}{{{b{dADh}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{ADj{c}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}}{{{b{d{ADl{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ACn{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Ob{c}}}}{{{b{d{ABh{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{d}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Nj{c}}}}`{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOj}}{b{de}}{b{n}}}h{}{}}{{{b{d{AJh{e}}}}f{b{d{AJj{ce}}}}{b{dOj}}{b{dc}}{b{n}}}h{}{{Nj{c}}}}{c{{AB`{c}}}{}}{{OnGb}On}{{{b{dLl}}c}h{{Cn{Ll}}}}{{CdCf}Cd}{{{ADd{hc}}e}{{ADd{ec}}}{}{}}{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{Cf}}}}}}``{{{b{dOh}}CjChc}h{{Cn{AAh}}}}{{{b{dAK`}}cChe}h{{Cn{{Cl{Cj}}}}}{{Cn{AAh}}}}{{{b{dOh}}C`c}h{{Cn{AAh}}}}{{{b{AMb}}}A`}{GbGb}{{OnGb}Gb}{AElAEl}{{{b{Nn}}}Nb}=`{AHjAHj}4{AD`AD`}{{{b{AKd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AIb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AId}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AKh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AKj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AKl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AAh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Ch}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AK`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Cd}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{Cj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AKn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AL`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{n}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Fn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{G`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AIf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AJd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AJn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ALn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AM`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ADn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{A@l}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AIh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AHn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ACl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AHj}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{C`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Gb}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{On}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AD`}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{AMh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{{Lj{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{{{b{AIl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMj}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AMn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AI`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AN`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AJ`}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AOb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANb}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANd}}{b{dBl}}}{{Aj{hBn}}}}{{{b{Mn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{{A@h{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{{{b{{AJh{c}}}}{b{dBl}}}{{Aj{hBn}}}K`}{{{b{Nn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANf}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANh}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANj}}{b{dBl}}}{{Aj{hBn}}}}0{{{b{ANl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AEl}}{b{dBl}}}{{Aj{hBn}}}}{{{b{ANn}}{b{dBl}}}{{Aj{hBn}}}}{{{b{AO`}}{b{dBl}}}{{Aj{hBn}}}}{{ei}{{ABb{cgi}}}{}{{Af{{b{dc}}{b{dAf}}}}}{}{{Ob{g}}}}{{{b{Oj}}}A`}{{{AJf{c}}e}{{AJf{c}}}{}{{Cn{ANb}}}}`{{ADhc}ADh{{Cn{{Lj{AIl}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AIl}}}}}}``````{{ADhc}ADh{{Cn{{Lj{Cf}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{Cf}}}}}}``````{{ADhc}ADh{{Cn{{Lj{AMl}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AMl}}}}}}``````{{ADhc}ADh{{Cn{{Lj{AMn}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AMn}}}}}}```````{{ADhc}ADh{{Cn{{Lj{AMj}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AMj}}}}}}``````{{{b{dAKb}}}{{b{dAOb}}}}{AHjAHj}{cc{}}00000000000000000000000000{CfAIb}{{{AOh{Cf}}}AIb}{{{Df{CfCfCfCf}}}AIb}{{{AOh{Cf}}}AId}0{CfAId}{{{Df{CfCfCfCf}}}AId}6{{{Df{CfCf}}}AId}7{GjAKh}888{CdAAh}{GjAAh}{AKhAAh};;{{{AOh{Cf}}}Cd}{{{Df{CfCfCfCf}}}Cd}={C`Cj}>>>>{CfALb}???????????????{AMbGj}{cc{}}0{{{Df{CfCf}}}A@l}{{{AOh{Cf}}}A@l}22222{{{AOh{Cf}}}ACl}{{{Df{CfCf}}}ACl}{{{Df{CfCfCfCf}}}ACl}52{CfACl}{AD`AHj}{{{Df{CfCf}}}AHj}{CfAHj}9{GbAHj}{{{AOh{Cf}}}AHj}{GbC`}<{{{AOh{Cf}}}C`}{CfGb}>{AHjGb}{{{Df{CfCf}}}Gb}{AD`Gb}{{{AOh{Cf}}}Gb}{GbOn}{cc{}}{{{AOh{Cf}}}AD`}1{{{Df{CfCf}}}AD`}{AHjAD`}{GbAD`}{CfAD`}5{AOjLl}{AMhLl}7{AOlLl}{AOnLl}{B@`Ll}{B@bLl}{B@dLl}{B@fLl}{B@hLl}{B@jLl}{B@lLl}{c{{Lj{c}}}{}}{Dj{{Lj{AIl}}}}{{{Df{CfCfCfCf}}}{{Lj{ACl}}}}{{{AOh{Cf}}}{{Lj{AId}}}}{Dh{{Lj{AIl}}}}{cc{}}{{{AOh{Cf}}}{{Lj{ACl}}}}{B@nc{}}{{{Df{CfCf}}}{{Lj{ACl}}}}5{Cf{{Lj{AIb}}}}{{{Df{CfCf}}}{{Lj{AId}}}}{{{AKf{c}}}{{Lj{c}}}{}}{Cf{{Lj{AId}}}}{{{Df{CfCfCfCf}}}{{Lj{AId}}}}{{{Df{CfCfCfCf}}}{{Lj{AIb}}}}{{{b{B`}}}{{Lj{AIl}}}}{{{AOh{Cf}}}{{Lj{AIb}}}}:{Cf{{Lj{ACl}}}}<{DjAIl}{DhAIl}{{{b{B`}}}AIl}???????{{{O`{D`}}}ANb}{{{b{B`}}}ANb}{{{b{BA`}}}ANb}{cc{}}{BAbANb}{{{b{{AGl{D`}}}}}ANb}222{B@nc{}}{c{{A@h{c}}}{}}14{c{{AJh{c}}}{}}5555555555555555555555555555555{BAdADh}66666666{CfAMf}{CfAD`}{{{b{c}}}AJdBAf}{D`{{Dd{G`}}}}{AJbAJ`}{AD`AMf}{GbOn}{BAhAJn}{GlAJd}`{{{b{Cd}}}D`}{{{ABf{c}}e}{{ABf{c}}}{}{{Cn{Cf}}}}{{{ABh{c}}Cf}{{ABh{c}}}{}}`{{{b{dAKd}}}Dj}{{{b{Ll}}{AKf{c}}}{{Dd{c}}}AGf}{{{b{{Lj{c}}}}{b{Ll}}}{{Dd{c}}}AGf}{{{b{Mn}}Cf}Cf}{{{b{AKb}}}{{Dd{{b{c}}}}}Ef}{{{b{dAKb}}}{{Dd{{b{dc}}}}}Ef}{{{b{Ll}}c{AKf{c}}}cAGf}{{{b{{Lj{c}}}}{b{Ll}}c}cAGf}{{{b{Ll}}e{AKf{c}}}cAGf{{Jj{}{{Jd{c}}}}}}{{{b{{Lj{c}}}}{b{Ll}}e}cAGf{{Jj{}{{Jd{c}}}}}}{{{b{AMb}}MjMj}{{AOh{D`}}}}{{{b{AEl}}AJd}{{Dd{{b{ANh}}}}}}{{{b{dAEl}}AJd}{{Dd{{b{dANh}}}}}}{{{b{Nl}}}{{Dd{{b{c}}}}}{}}{{{b{Oh}}}{{Dd{{b{c}}}}}{}}{{{b{Oj}}}{{Dd{{b{c}}}}}{}}{{{b{Ol}}}{{Dd{{b{c}}}}}{}}{{{b{Lh}}}{{Dd{{b{c}}}}}{}}{{{b{Nn}}}{{Dd{{b{c}}}}}{}}{{{b{dNl}}}{{Dd{{b{dc}}}}}{}}{{{b{dOh}}}{{Dd{{b{dc}}}}}{}}{{{b{dOj}}}{{Dd{{b{dc}}}}}{}}{{{b{dOl}}}{{Dd{{b{dc}}}}}{}}{{{b{dLh}}}{{Dd{{b{dc}}}}}{}}{{{b{dNn}}}{{Dd{{b{dc}}}}}{}}{{{b{{AHl{c}}}}ANj}{{Dd{{b{AEl}}}}}{}}{{{b{d{AHl{c}}}}ANj}{{Dd{{b{dAEl}}}}}{}}{CfCd}{{{b{Oj}}}A`}00{{{b{d{AHl{c}}}}{b{dc}}}h{}}{{{b{Nl}}}A`}{{{b{Oh}}}A`}3{{{b{Ol}}}A`}{{{b{Lh}}}A`}{{{b{{AJj{ce}}}}}A`{}{{Nj{c}}}}{{{b{Nn}}}A`}754732075473207{{{b{AKh}}{b{dc}}}hCb}{{{b{AKj}}{b{dc}}}hCb}{{{b{AKl}}{b{dc}}}hCb}{{{b{AAh}}{b{dc}}}hCb}{{{b{Ch}}{b{dc}}}hCb}{{{b{Cd}}{b{dc}}}hCb}{{{b{Cj}}{b{dc}}}hCb}{{{b{AKn}}{b{dc}}}hCb}{{{b{AL`}}{b{dc}}}hCb}{{{b{ALb}}{b{dc}}}hCb}{{{b{Fn}}{b{dc}}}hCb}{{{b{G`}}{b{dc}}}hCb}{{{b{AIf}}{b{dc}}}hCb}{{{b{AJd}}{b{dc}}}hCb}{{{b{AJn}}{b{dc}}}hCb}{{{b{ALh}}{b{dc}}}hCb}{{{b{ALj}}{b{dc}}}hCb}{{{b{ALl}}{b{dc}}}hCb}{{{b{ALn}}{b{dc}}}hCb}{{{b{AM`}}{b{dc}}}hCb}{{{b{AMb}}{b{dc}}}hCb}{{{b{Gn}}{b{dc}}}hCb}{{{b{Gj}}{b{dc}}}hCb}{{{b{ADn}}{b{dc}}}hCb}{{{b{AIh}}{b{dc}}}hCb}{{{b{AHn}}{b{dc}}}hCb}{{{b{AMd}}{b{dc}}}hCb}{{{b{AMf}}{b{dc}}}hCb}{{{b{AHj}}{b{dc}}}hCb}{{{b{C`}}{b{dc}}}hCb}{{{b{Gb}}{b{dc}}}hCb}{{{b{On}}{b{dc}}}hCb}{{{b{AD`}}{b{dc}}}hCb}{{{b{AIl}}{b{dc}}}hCb}{{{b{AMj}}{b{dc}}}hCb}{{{b{AMl}}{b{dc}}}hCb}{{{b{AMn}}{b{dc}}}hCb}{{{b{AI`}}{b{dc}}}hCb}{{{b{AN`}}{b{dc}}}hCb}{{{b{ANd}}{b{dc}}}hCb}{{{b{{A@h{c}}}}{b{de}}}hBAfCb}{{{b{{AJh{c}}}}{b{de}}}hBAfCb}{{{b{ANf}}{b{dc}}}hCb}{{{b{ANj}}{b{dc}}}hCb}{{{b{ANn}}{b{dc}}}hCb}{AD`AD`}`{{Cfc}{{AAn{c}}}{}}{{{b{AMb}}}Mj}{C`Cf}{{{b{AEl}}}Mj}{{{AAn{c}}Cf}{{AAn{c}}}{}}`{{{b{B`}}}Cd}0{c{{ABf{c}}}{}}{c{{ABh{c}}}{}}{{}{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABh{{O`{c}}}}}{}}{{{b{Oj}}}A`}{{{b{dOh}}e}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}Nfe}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}`{c{{ABd{c}}}{}}{{CfCfCf}Cd}0{{CfCfCfCf}Cd}09`{{}{{ABf{{O`{{Ah{Nd}}}}}}}}{{}{{ABf{{O`{c}}}}}{}}3322:`98{{AElc}AEl{{Cn{{Dd{Gj}}}}}}`{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{Cd}}}}}}``{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{Cf}}}}}}``{{{b{Nl}}}Nf}{{{b{Oh}}}Nf}{{{b{Oj}}}Nf}{{{b{Ol}}}Nf}{{{b{Lh}}}Nf}{{{b{Gj}}}Gn}{{{b{Nn}}}Nf}{{{b{ANh}}}AJd}{{{b{AEl}}}ANj}````{{{b{d{AHl{c}}}}{b{dc}}}h{}}{{{b{dj}}{b{d{l{c}}}}{b{dc}}}h{}}`{{{b{Nn}}}{{Dd{{b{F`}}}}}}{{C`AHj}C`}`{{C`Cf}C`}``4{{}f}00040000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{dLl}}{b{B`}}{Lj{c}}}h{}}{{{b{dAKb}}c}{{Dd{c}}}Ef}{{{b{dNl}}c}h{}}{{{b{dOh}}c}h{}}{{{b{dOj}}c}h{}}{{{b{dOl}}c}h{}}{{{b{dLh}}c}h{}}{{{b{dNn}}c}h{}}{{{b{dLl}}{b{B`}}{b{B`}}}h}{{{b{dLl}}GlGl}h}{{{b{dLl}}{b{B`}}c}h{}}{{{ABd{c}}e}{{ABd{c}}}{}{{Cn{{Lj{Cf}}}}}}``{{C`C`}C`}{{C`C`}A`}{ce{}{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{Cj}}}}{ADnADn}{AMfAMf}{{{b{Fn}}Fn{Dd{G`}}}A`}{{{b{G`}}Fn{Dd{G`}}}A`}{{{b{Nl}}}A`}{{{b{Oh}}}A`}{{{b{Oj}}}A`}{{{b{Ol}}}A`}{{{b{Lh}}}A`}{{{b{Nn}}}A`}{{{b{Cj}}}A`}{{{b{n}}}A`}`1{{{b{{AJh{e}}}}}A`{}{{Nj{c}}}}{{{b{{ABf{{O`{c}}}}}}}A`{}}{{{b{{ABh{{O`{c}}}}}}}A`{}}{AHjA`}{GbA`}{OnA`}8=<;:98=<;:98{{{b{AEl}}Nf}A`}321{{{b{ALf}}c}A`Fl}{{{b{n}}c}A`Fl}0`5{{{b{AEl}}AJdAJn}A`}{{{b{ANh}}AJn}A`}`{CdA`}0={{{b{Oh}}C`}A`}`{{{b{Cj}}}Db}`{{{ABf{c}}e}{{ABf{c}}}{}{{Cn{AMd}}}}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{AMd}}}}``0`{{{b{B`}}}{{Lj{c}}}{}}`{{{b{d{AHl{c}}}}{b{dc}}ANjFn{Dd{G`}}{Dd{Dj}}A`}h{}}{{{ABd{c}}e}{{ABd{c}}}{}{{Cn{{Lj{Cd}}}}}}``{{{b{Cj}}}{{Dd{AHj}}}}{{{b{dAK`}}ADn{Dd{Bd}}{Dd{Nf}}e}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dOl}}{b{de}}On}Gb{}Od}{{{b{dNl}}}h}{{{b{dOj}}}h}{{{b{dLh}}}h}{{{b{d{A@n{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{d}}{b{dOl}}{b{de}}On}GbOb{}}{{{b{d{ACf{ce}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{dGj}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{AMd{b{{AGl{Cf}}}}CfCf}H`}{{{b{d{A@h{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{A@j{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AJl{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AAb{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{dAAd}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{AC`{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AAj{ceg}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}{{Ob{c}}}}{{{b{d{AAl{c}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{AAn{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AA`{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AB`{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ACj{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{AAf{c}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{ABd{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ADb{c}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{ABf{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Nj{c}}}}{{{b{dADh}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{ADj{c}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}}{{{b{d{ADl{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ACn{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Ob{c}}}}{{{b{d{ABh{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Nj{c}}}}{{{b{d{AEf{e}}}}{b{d}}{b{dOl}}{b{dc}}On}Gb{}{{Nj{c}}}}{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dOl}}{b{de}}On}Gb{}{}}{{{b{d{AJh{e}}}}f{b{d{AJj{ce}}}}{b{dOl}}{b{dc}}On}Gb{}{{Nj{c}}}}{c{{A@j{c}}}{}}{C`Cf}``{{{b{{Nj{}{{Nh{c}}}}}}}f{}}{{{b{Cj}}}f}{{{b{{AJh{e}}}}}f{}{{Nj{c}}}}{{{b{{ABf{{O`{c}}}}}}}f{}}{{{b{{ABh{{O`{c}}}}}}}f{}}{AD`Cf}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{Cf}}}}}}``1{{AHjAHjCf}AHj}{{}AMh}{{CdCf}Cd}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cd}}}}}}``{{ADhc}ADh{{Cn{{Lj{Cf}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{Cf}}}}}}``````{{{b{dCj}}AHj}h}{CfMn}0{{{b{dAOb}}c}{{Aj{hBAj}}}{{Cn{ANb}}}}{{{b{Oj}}AHj}AHj}{OnOn}00{CdCf}{{{b{AIh}}c}Cf{{Cn{{Df{CfCf}}}}}}{{{b{dNn}}}h}00{{{AC`{ceg}}i}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}{{Cn{{BAn{{BAl{}{{Jd{c}}}}}}}}}}{{{AA`{c}}e}{{AA`{c}}}{}{{Cn{{Lj{A`}}}}}}``{{{b{dOh}}cg}e{{Cn{Bd}}}{}{{Jj{{b{dOh}}}{{Jd{e}}}}}}{{{b{dAK`}}Bde}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}`{{AHjAHj}AHj}{{GbGb}Gb}{{AD`AD`}AD`}``{{{b{AIb}}}Cf}{GbCf}{{Cfc}{{AAn{c}}}{}}{{{AAn{c}}Cf}{{AAn{c}}}{}}{{ce}{{AAn{e}}}{{Cn{Gb}}}{}}{{AHjGb}C`}{{{AAn{c}}e}{{AAn{c}}}{}{{Cn{Gb}}}}43{{AElA`}AEl}`{{gk}{{ABj{cie}}}{}ABl{{Jj{{b{dc}}}{{Jd{e}}}}}{{Ob{c}}}{{Jj{{b{dc}}}{{Jd{i}}}}}}`;:9``876543265{{{b{AIh}}c}Cf{{Cn{{Df{CfCf}}}}}}`{{CdCdCf}Cd}0``````{{{b{d{AHl{c}}}}AIf}h{}}{{{b{dGj}}c}h{{Jj{{b{dAMb}}}}}}{{{b{dAEl}}AJdAHj}AD`}{{{b{dCj}}AHj}h}{{CdCd}}{{CdCf}}{{ADnAHj}}{{ADnAD`}}{{ADnADn}}{{AMfAMf}}{{AMfAD`}}{{AMfAHj}}{{AHjCf}}{{AHjAD`}}{{AHjGb}}{{GbCf}}{{GbAD`}}{{GbGb}}{{AD`Cf}}{{AD`AD`}}{{{b{dADn}}ADn}h}{{{b{dAHj}}Gb}h}{{{b{dAHj}}AD`}h}{{{b{dAHj}}Cf}h}{{{b{dGb}}Gb}h}{{{b{dGb}}AD`}h}{{{b{dGb}}Cf}h}{{{b{dAD`}}AD`}h}{{{b{dAD`}}Cf}h}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{A`}}}}`{{{b{dGj}}}h}{ANf{{b{B`}}}}{{{b{Nn}}}A`}00{AHj}{AD`}{{}{{AJf{c}}}{}}{{{Ah{Dl}}}AKd}{{{b{dEl}}{b{dALd}}}AKb}{{{b{dAKb}}{b{dNn}}}Nl}{{{b{dAKb}}{b{dNn}}{b{dAK`}}}Oh}{{{b{dAKb}}{b{dNn}}{b{dA`}}}Oj}{{{b{dAKb}}{b{dNn}}}Ol}{{{b{dAKb}}{b{dNn}}}Lh}{{{b{B`}}}{{AKf{c}}}Od}{i{{A@n{egc}}}{}{}{}{{Af{{b{dc}}{b{dOj}}{b{de}}{b{n}}}{{Jd{{Dd{g}}}}}}}}{c{{ABn{ec}}}{}{}}{c{{ACb{ec}}}{}{}}{c{{ACd{ec}}}{}{}}{{cg}{{ABb{eic}}}{}{}{{Af{{b{de}}{b{dAf}}}}}{}}{{gk}{{ABj{cie}}}{}ABl{{Jj{{b{dc}}}{{Jd{e}}}}}{{Ob{c}}}{{Jj{{b{dc}}}{{Jd{i}}}}}}{c{{ACh{c}}}Ob}{{cg}{{ACf{ec}}}{}{}{{Af{{b{dLh}}{b{de}}}}}}{c{{ADd{hc}}}{ADfEh}}{c{{AE`{c}}}{}}{{ek}{{AEb{gci}}}{}{{Af{}{{Jd{c}}}}}{}{}{{Af{{b{dg}}{b{dc}}}{{Jd{i}}}}}}{{Llc}{{AEd{c}}}{}}{{CfCfCfCf}AIb}{{CfCfCfCf}AId}{{}AK`}{{}Cj}{Dn{{Df{ALdEb}}}}{{{O`{D`}}MjMj}AMb}{{{O`{D`}}MjMj}Gj}{{CfCf}A@l}{{AD`AD`}AMf}{{CfCfCfCf}ACl}{{CfCf}AHj}{{AHjAHj}C`}{{CfCf}Gb}{{GbGb}On}{{CfCf}AD`}{{}Ll}{{{b{dAOb}}CfCf}AJ`}{{}AOb}{c{{A@h{c}}}{}}{c{{AJh{c}}}{}}{NfNn}{{AJdAHj}ANh}{{}ANj}{{}AEl}{{A@lc}{{A@j{c}}}{}}{{cCf}{{AJl{c}}}{}}{c{{AAb{c}}}{}}{A`AAd}{{eANng}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{ce}{{AAj{gce}}}{}{}{}}{{}{{AAl{c}}}{}}{{Onc}{{AAn{c}}}{}}{c{{AA`{c}}}{}}{{CfA`c}{{AB`{c}}}{}}{{ce}{{ACj{e}}}{{Cn{ACl}}}{}}{e{{AAf{c}}}{}{{Af{{b{dOh}}{b{dc}}}}}}{{AIhc}{{ABd{c}}}{}}{Cf{{ADb{c}}}{}}{{AIhc}{{ABf{c}}}{}}{cADh{{Cn{Dh}}}}{{}{{ADj{c}}}{}}{{ce}{{ADl{c}}}{}{{Cn{Dh}}}}{{ADnc}{{ACn{c}}}{}}{{AIhc}{{ABh{c}}}{}}{c{{AEf{c}}}{}}{AD`AD`}{{{b{ACl}}}AD`}{C`AD`}{{CfCfCf}Cd}0{{CfCfCfCf}Cd}0110011001100{{cg}{{ABn{ec}}}{}{}{{Af{{b{dNl}}{b{de}}}}}}{{eg}{{AC`{ceg}}}{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{cg}{{ACb{ec}}}{}{}{{Af{{b{dOh}}{b{de}}}}}}{{{ACb{ce}}g}{{ACb{ce}}}{}{}{{Af{{b{dOh}}{b{dc}}}}}}`{{cg}{{ACd{ec}}}{}{}{{Af{{b{dOj}}{b{de}}{b{n}}}}}}0{{{AAl{c}}e}{{AAl{c}}}{}{{Af{{b{dOj}}{b{dc}}Cd}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Af{{b{dOj}}{b{dc}}Cf}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Af{{b{dOj}}{b{dc}}Dj}}}}```{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Af{{b{dOj}}{b{dc}}A`}}}}`7{{cg}{{ACf{ec}}}{}{}{{Af{{b{dLh}}{b{de}}}}}}82`{c{{ACh{c}}}Ob}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Dd{A`}}}}}}`{{AEle}BB`Ob{{Af{}{{Jd{c}}}}Eh}}{{{b{d{l{c}}}}AElg}h{}{{Nd{c}}}{{Af{{b{dc}}}{{Jd{e}}}}}}`{{{b{dOh}}BBbe}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}BBbe}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}{{{b{AIh}}CfCf}c{{BBd{{Df{CfCf}}}}}}{{ce}{{ACj{e}}}{{Cn{ACl}}}{}}{{Cfc}{{ACj{c}}}{}}000{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{ACl}}}}}}`````{e{{AAf{c}}}{}{{Af{{b{dOh}}{b{dc}}}}}}{{{b{AEl}}}Gb}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{Dj}}}}`{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{Cd}}}}}}``{c{{A@h{c}}}{}}{{{b{d{AHl{c}}}}{b{dc}}ANjAJdAJnA`}A`{}}{{{b{d{AHl{c}}}}{b{dc}}ANjAJd}h{}}{{{b{d{AHl{c}}}}{b{dc}}ANjAJdAHj}A`{}}{{{b{d{AHl{c}}}}{b{dc}}ANjAJdAD`}h{}}{{{b{AEl}}}{{b{{AGl{ANh}}}}}}{{{b{dAEl}}}{{b{d{O`{ANh}}}}}}{{{b{Cj}}}{{b{{AGl{AHj}}}}}}`````{GjGj}{{{b{dNn}}}h}{{{b{dAOb}}{b{AJb}}AD`Cf}h}{{{b{dOl}}{b{AJ`}}AD`}h}{{{b{dOl}}{b{AJb}}AD`}h}{{{b{dANh}}AJn}h}{{{b{dAEl}}AJdAJn}h}`{{{b{AK`}}}{{`{{BBf{}{{A@`{{b{Bf}}}}}}}}}}{{{b{dNn}}{b{dNn}}}h}{{{b{dNl}}c}{{b{dc}}}{}}{{{b{dOh}}c}{{b{dc}}}{}}{{{b{dOj}}c}{{b{dc}}}{}}{{{b{dOl}}c}{{b{dc}}}{}}{{{b{dLh}}c}{{b{dc}}}{}}{{{b{dNn}}c}{{b{dc}}}{}}{{{b{dNl}}}{{b{dc}}}En}{{{b{dOh}}}{{b{dc}}}En}{{{b{dOj}}}{{b{dc}}}En}{{{b{dOl}}}{{b{dc}}}En}{{{b{dLh}}}{{b{dc}}}En}{{{b{dNn}}}{{b{dc}}}En}{{{b{dNl}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dOh}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dOj}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dOl}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dLh}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{dNn}}e}{{b{dc}}}{}{{Jj{}{{Jd{c}}}}}}{{{b{AKb}}}ALd}{CfCf}{{{b{d{ABf{{O`{c}}}}}}c}h{}}{{{b{d{ABh{{O`{c}}}}}}c}h{}}{{{b{dCj}}C`}h}0{{{b{dCj}}C`AIbAId}h}{{{b{dCj}}C`AIb}h}{{{b{dOh}}C`cegi}h{{Cn{AAh}}}{{Cn{AIb}}}{{Cn{AId}}}{{Cn{AAh}}}}{{{b{dCj}}AHjAHj}h}{{{b{d{l{c}}}}}h{}}`{{{b{Cd}}}D`}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{BBh{Cf}}}}}}`{{{b{AJ`}}}{{b{AJb}}}}{{{b{dAJ`}}}{{b{dAJb}}}}{{{b{Lf}}{b{dLh}}{b{Lf}}}h}{{{b{d{Nj{}{{Nh{c}}}}}}{b{dc}}{b{dNl}}{b{de}}{b{{Nj{}{{Nh{c}}}}}}}h{}{}}{{{b{d{Ob{}{{Nh{c}}}}}}{b{dc}}{b{dLh}}{b{de}}{b{{Ob{}{{Nh{c}}}}}}}h{}Od}{{{b{d{AHl{c}}}}{b{dc}}}h{}}8{{{b{dOj}}}h}{{{b{d{A@n{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{A@n{ceg}}}}}h{}{{Ob{c}}}En}{{{b{d{ABn{ce}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABn{ce}}}}}h{}{{Ob{c}}}}{{{b{d{ACb{ce}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACb{ce}}}}}h{}{{Ob{c}}}}{{{b{d{ACd{ce}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACd{ce}}}}}h{}{{Ob{c}}}}{{{b{d{ABb{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABb{ceg}}}}}h{}{}{{Ob{e}}}}{{{b{d{ABj{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABj{ceg}}}}}h{}{{Ob{c}}}ABl}{{{b{d{ACh{c}}}}{b{d}}{b{dLh}}{b{de}}{b{{ACh{c}}}}}hOb{}}{{{b{d{ACf{ce}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACf{ce}}}}}h{}{{Ob{c}}}}{{{b{d{ADd{eg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ADd{eg}}}}}h{}{{Ob{c}}}{ADfEh}}{{{b{d{AE`{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AE`{e}}}}}h{}{{Ob{c}}}}{{{b{d{AEb{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AEb{ceg}}}}}h{}{}{{Ob{{Df{ce}}}}}}{{{b{d{AEd{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AEd{e}}}}}h{}{{Ob{c}}}}{{{b{dGj}}{b{d}}{b{dLh}}{b{dc}}{b{Gj}}}h{}}{{{b{d{A@h{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{A@h{e}}}}}h{}{{Ob{c}}}}{{{b{d{AJh{e}}}}{b{d{AJj{ce}}}}{b{dNl}}{b{dc}}{b{{AJh{e}}}}}h{}{{Nj{c}}}}{{{b{d{A@j{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{A@j{e}}}}}h{}{{Ob{c}}}}{{{b{{A@j{c}}}}{b{dLh}}{b{{A@j{c}}}}}h{}}{{{b{{AJl{c}}}}{b{dLh}}{b{{AJl{c}}}}}h{}}{{{b{d{AJl{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AJl{e}}}}}h{}{{Ob{c}}}}{{{b{{AAb{c}}}}{b{dLh}}{b{{AAb{c}}}}}h{}}{{{b{d{AAb{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAb{e}}}}}h{}{{Ob{c}}}}{{{b{dB@f}}{b{{AAb{c}}}}{b{dLh}}}h{}}{{{b{dAAd}}{b{d}}{b{dLh}}{b{dc}}{b{AAd}}}h{}}{{{b{AAd}}{b{dLh}}{b{AAd}}}h}{{{b{dB@`}}{b{AAd}}{b{dLh}}}h}{{{b{d{AC`{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AC`{ceg}}}}}h{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{{AC`{ceg}}}}{b{dLh}}{b{{AC`{ceg}}}}}h{}{{Ob{c}}}{{Af{{b{dOj}}{b{dc}}}}}}{{{b{d{AAj{ceg}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAj{ceg}}}}}h{}{{Ob{c}}}{{Ob{c}}}}{{{b{{AAj{ceg}}}}{b{dLh}}{b{{AAj{ceg}}}}}h{}{}{}}{{{b{dAOn}}{b{{AAj{ceg}}}}{b{dLh}}}h{}{}{}}{{{b{d{AAl{c}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAl{c}}}}}h{}}{{{b{{AAl{c}}}}{b{dLh}}{b{{AAl{c}}}}}h{}}{{{b{dB@j}}{b{{AAl{c}}}}{b{dLh}}}h{}}{{{b{d{AAn{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAn{e}}}}}h{}{{Ob{c}}}}{{{b{{AAn{c}}}}{b{dLh}}{b{{AAn{c}}}}}h{}}{{{b{d{AA`{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AA`{e}}}}}h{}{{Ob{c}}}}{{{b{{AA`{c}}}}{b{dLh}}{b{{AA`{c}}}}}h{}}{{{b{dB@l}}{b{{AA`{c}}}}{b{dLh}}}h{}}{{{b{d{AB`{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AB`{e}}}}}h{}{{Ob{c}}}}{{{b{{AB`{c}}}}{b{dLh}}{b{{AB`{c}}}}}h{}}{{{b{d{ACj{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACj{e}}}}}h{}{{Ob{c}}}}{{{b{{ACj{c}}}}{b{dLh}}{b{{ACj{c}}}}}h{}}{{{b{d{AAf{c}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AAf{c}}}}}h{}}{{{b{{AAf{c}}}}{b{dLh}}{b{{AAf{c}}}}}h{}}{{{b{d{ABd{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABd{e}}}}}h{}{{Ob{c}}}}{{{b{{ABd{c}}}}{b{dLh}}{b{{ABd{c}}}}}h{}}{{{b{dB@h}}{b{{ABd{c}}}}{b{dLh}}}h{}}{{{b{{ADb{c}}}}{b{dLh}}{b{{ADb{c}}}}}h{}}{{{b{d{ADb{c}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ADb{c}}}}}h{}}{{{b{dB@d}}{b{{ADb{c}}}}{b{dLh}}}h{}}{{{b{d{ABf{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABf{e}}}}}h{}{{Nj{c}}}}{{{b{{ABf{c}}}}{b{dLh}}{b{{ABf{c}}}}}h{}}{{{b{dADh}}{b{d}}{b{dLh}}{b{dc}}{b{ADh}}}h{}}{{{b{dB@b}}{b{ADh}}{b{dLh}}}h}{{{b{d{ADj{c}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ADj{c}}}}}h{}}{{{b{dAOj}}{b{{ADj{c}}}}{b{dLh}}}h{}}{{{b{{ADl{c}}}}{b{dLh}}{b{{ADl{c}}}}}h{}}{{{b{d{ADl{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ADl{e}}}}}h{}{{Ob{c}}}}{{{b{dAOl}}{b{{ADl{c}}}}{b{dLh}}}h{}}{{{b{d{ACn{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ACn{e}}}}}h{}{{Ob{c}}}}{{{b{{ACn{c}}}}{b{dLh}}{b{{ACn{c}}}}}h{}}{{{b{d{ABh{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{ABh{e}}}}}h{}{{Nj{c}}}}{{{b{{ABh{c}}}}{b{dLh}}{b{{ABh{c}}}}}h{}}{{{b{d{AEf{e}}}}{b{d}}{b{dLh}}{b{dc}}{b{{AEf{e}}}}}h{}{{Nj{c}}}}`{{{b{d{Nj{}{{Nh{c}}}}}}f{b{dc}}{b{dLh}}{b{de}}{b{{Nj{}{{Nh{c}}}}}}}h{}{}}{{{b{d{AJh{e}}}}f{b{d{AJj{ce}}}}{b{dLh}}{b{dc}}{b{{AJh{e}}}}}h{}{{Nj{c}}}}{{Gbc}{{AAf{e}}}{{Cn{AAh}}}{}}{{{b{Oh}}}C`}{{{b{Oj}}}C`}{{{b{Lh}}}C`}{{{b{dAK`}}C`c}h{{Cn{AAh}}}}{C`Cj}{{{b{AJ`}}}C`}{{{b{Nn}}}C`}{{{b{dANh}}AJn}A`}{{{b{dAEl}}AJdAJn}A`}{{AHjAD`}}{{AHjGb}}{{AHjCf}}{{GbCf}}{{GbAD`}}{{GbGb}}{{AD`Cf}}{{AD`AD`}}{{{b{dAHj}}Gb}h}{{{b{dAHj}}Cf}h}{{{b{dAHj}}AD`}h}{{{b{dGb}}Gb}h}{{{b{dGb}}Cf}h}{{{b{dGb}}AD`}h}{{{b{dAD`}}Cf}h}{{{b{dAD`}}AD`}h}{{{b{dAKb}}}{{Dd{c}}}Ef}{{{b{dAEl}}AJd}h}{{{b{dNl}}}{{Dd{c}}}{}}{{{b{dOh}}}{{Dd{c}}}{}}{{{b{dOj}}}{{Dd{c}}}{}}{{{b{dOl}}}{{Dd{c}}}{}}{{{b{dLh}}}{{Dd{c}}}{}}{{{b{dNn}}}{{Dd{c}}}{}}{{{b{d{AHl{c}}}}ANj}h{}}{{{b{dNn}}}h}00{{AElA`}AEl}`{{CfCfCf}Cd}0{{CfCfCfCf}Cd}0{{D`D`D`D`}Cd}{c{{A@j{c}}}{}}{C`Cf}``{{Cfc}{{ACn{c}}}{}}{CfADn}1{{{b{dOh}}Cfe}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}Cfe}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}{ADnADn}{AHjAHj}{C`C`}{GbGb}{AD`AD`}{{{ABh{c}}e}{{ABh{c}}}{}{{Cn{Cf}}}}`{{CdCf}Cd}{{ce}{{ACn{e}}}{{Cn{AD`}}}{}}{AD`ADn}{{AElCf}AEl}`{{{b{dOh}}AD`e}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}AD`e}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}`{{{b{dAKd}}c}h{{BBj{B`}}}}{{{b{dNl}}A`}A`}{{{b{dOj}}A`}A`}{{{b{dLh}}A`}A`}{{{b{dNn}}A`}h}{{{b{dAJ`}}AI`}h}{{{b{dAJ`}}{b{dAOb}}Gb}h}{{{b{dNl}}{Dd{ANf}}}h}{{{b{dOj}}{Dd{ANf}}}h}{{{b{dLh}}{Dd{ANf}}}h}{{{b{dNn}}{Dd{ANf}}}h}{{{b{dAMb}}A`}h}7:987:987{{{b{dOj}}{Dd{F`}}}h}{{{b{dNn}}{Dd{F`}}}h}{{{b{dAJ`}}{b{dAOb}}CfCf}h}{{{b{dAMb}}MjMj{AOh{D`}}}h}{{{b{dNn}}Gb}h}{{{b{dAJ`}}{b{dAOb}}{b{B`}}M`}h}{{{b{dNn}}ADn}h}{{{b{dAJ`}}{b{dAOb}}AN`}h}``{{C`Cf}C`}{{OnGb}On}{AD`AD`}{{ce}{{AAn{e}}}{{Cn{Gb}}}{}}{{{b{Oh}}}Gb}{{{b{Oj}}}Gb}{{{b{Lh}}}Gb}{{{b{AMb}}}Gb}{{{b{ACl}}}Gb}{C`Gb}{{{b{AJ`}}}Gb}{{{b{Nn}}}Gb}{{AElMjMj}AEl}{{AAdc}AAd{{Cn{{Lj{Cf}}}}}}{{{AAl{c}}e}{{AAl{c}}}{}{{Cn{{Lj{Cf}}}}}}{{{AAf{c}}e}{{AAf{c}}}{}{{Cn{{Dd{Gb}}}}}}``````{{AElANl}AEl}`{Cf{{ADb{c}}}{}}3``{{{b{AEl}}}AEj}`{{{b{dAKb}}c}h{{ADf{}{{Jd{h}}}}Eh}}{{{b{ALd}}c}h{{ADf{}{{Jd{h}}}}Eh}}{{{b{Mn}}{b{dCf}}A`Cf}A`}{{{b{dOh}}Cjce}h{{Cn{ALb}}}{{Cn{AAh}}}}{{{b{dAK`}}ceg}h{{Cn{{Cl{Cj}}}}}{{Cn{ALb}}}{{Cn{AAh}}}}:``{{{b{dCj}}{b{Cj}}ALb}h}`{{{AJf{c}}e}{{AJf{c}}}{}{{Cn{Ll}}}}``{{{b{{AAb{c}}}}{b{Ll}}}B@f{}}{{{b{AAd}}{b{Ll}}}B@`}{{{b{{AAj{ceg}}}}{b{Ll}}}AOn{}{}{}}{{{b{{AAl{c}}}}{b{Ll}}}B@j{}}{{{b{{AA`{c}}}}{b{Ll}}}B@l{}}{{{b{{ABd{c}}}}{b{Ll}}}B@h{}}{{{b{{ADb{c}}}}{b{Ll}}}B@d{}}{{{b{ADh}}{b{Ll}}}B@b}{{{b{{ADj{c}}}}{b{Ll}}}AOj{}}{{{b{{ADl{c}}}}{b{Ll}}}AOl{}}{{{b{Nl}}}{{b{Ll}}}}{{{b{Oh}}}{{b{Ll}}}}{{{b{Oj}}}{{b{Ll}}}}{{{b{Ol}}}{{b{Ll}}}}{{{b{Lh}}}{{b{Ll}}}}{{AHjGb}}{{AHjAHj}}{{AHjAD`}}{{AHjCf}}{{C`Gb}}{{C`AD`}}{{GbCf}}{{GbAD`}}{{GbGb}}{{OnGb}}{{AD`AD`}}{{AD`Cf}}{{{b{dAHj}}AD`}h}{{{b{dAHj}}Gb}h}{{{b{dAHj}}Cf}h}{{{b{dC`}}Gb}h}{{{b{dC`}}AD`}h}{{{b{dGb}}Cf}h}{{{b{dGb}}Gb}h}{{{b{dGb}}AD`}h}{{{b{dOn}}Gb}h}{{{b{dAD`}}AD`}h}{{{b{dAD`}}Cf}h}``{c{{ADd{hc}}}{ADfEh}}`{{{b{d{AHl{c}}}}}{{`{{BBf{}{{A@`{{BBl{c}}}}}}}}}{}}{cADh{{Cn{Dh}}}}{{{b{dOh}}{b{AJ`}}CdAD`}h}{{ADhc}ADh{{Cn{Dh}}}}{{{ADj{c}}e}{{ADj{c}}}{}BBn}`````{{}{{ADj{c}}}{}}{{{b{dOh}}{b{AJb}}CdAD`}h}{{{AJf{c}}AMh}{{AJf{c}}}{}}`{{AElc}AElBBn}`{AI`BC`}{AN`BCb}{AMjBCd}{AMlBCf}{AMnBCh}{CdAn}{Cd{{Df{CfCfCf}}}}{Cd{{Df{CfCfCfCf}}}}1010101010{{{b{c}}}e{}{}}0000000000000000000000000000000000000000000000000000000000000{GbAHj}{AD`AHj}{Cd{{AOh{D`}}}}{AHjGb}{AD`Gb}{{{b{c}}}Dh{}}0000{Cd{{AOh{Cf}}}}{{{b{c}}}Dj{}}0000{AHjAD`}{GbAD`}{{ce}{{ADl{c}}}{}{{Cn{Dh}}}}{c{{A@j{c}}}{}}{C`Cf}``{C`AHj}20`20``{{ADnc}{{ACn{c}}}{}}{{{b{Oh}}}ADn}{{{b{Oj}}}ADn}{{{b{dCj}}ADn}h}{{C`ADn}C`}{{{b{Nn}}}ADn}``{{{b{dOh}}ADne}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}ADne}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}{{MnA`g}{{A@n{ceCf}}}{}{}{{Af{{b{dOj}}{b{dc}}Cf}{{Jd{e}}}}}}{{{AAb{c}}e}{{AAb{c}}}{}{{Cn{{Lj{Mn}}}}}}{{AAdc}AAd{{Cn{{Lj{Mn}}}}}}{{{AAj{ceg}}i}{{AAj{ceg}}}{}{}{}{{Cn{{Lj{Mn}}}}}}{{{ABd{c}}e}{{ABd{c}}}{}{{Cn{{Lj{Mn}}}}}}````````{{Mng}{{A@n{ceCf}}}{}{}{{Af{{b{dOj}}{b{dc}}Cf}{{Jd{e}}}}}}00{{ce}{{ACn{e}}}{{Cn{AD`}}}{}}{AD`ADn}{{{b{dNn}}AD`}h}{{{b{dOh}}AD`e}c{}{{Jj{{b{dOh}}}{{Jd{c}}}}}}{{{b{dAK`}}AD`e}c{}{{Jj{{b{dAK`}}}{{Jd{c}}}}}}`{c{{AE`{c}}}{}}{{{b{dOh}}C`}h}{{{b{dAK`}}C`Nf}h}{c{{Aj{e}}}{}{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{b{B`}}}{{Dd{Cd}}}}{{C`C`}{{Dd{C`}}}}22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222{{{b{c}}}Al{}}0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{c{{AAn{c}}}{}}{{C`C`}C`}{{{b{AIh}}c}{{Df{CfCf}}}{{Cn{{Df{CfCf}}}}}}{{{b{Nn}}}N`}{{{b{d{AHl{c}}}}ANj}A`{}}{{{b{dAEl}}}{{O`{AEh}}}}{e{{Lj{c}}}{}{{Cn{c}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{Cf}}}}`{AIh{{ABf{{O`{c}}}}}{}}{AIh{{ABh{{O`{c}}}}}{}}{{}{{ABf{{O`{c}}}}}{}}0{{{b{Cj}}}{{b{{AGl{Bh}}}}}}{c{{ABf{c}}}{}}{c{{ABh{c}}}{}}{{}{{ABh{{O`{{Ah{Nd}}}}}}}}{{}{{ABh{{O`{c}}}}}{}}{{{b{AK`}}AHj}{{Dd{Nf}}}}{{AElA`}AEl}`{c{{ABd{c}}}{}}6`{{}{{ABf{{O`{{Ah{Nd}}}}}}}}96`54{{{b{ALd}}}h}``{{{b{Oj}}}A`}00`{{Cfc}{{AAn{c}}}{}}{{{b{AMb}}}Mj}{C`Cf}{{{b{AEl}}}Mj}{{{AAn{c}}Cf}{{AAn{c}}}{}}{{{ABd{c}}e}{{ABd{c}}}{}{{Cn{{Lj{Cf}}}}}}{{{ADb{c}}e}{{ADb{c}}}{}{{Cn{{Lj{Cf}}}}}}``````{{{AJf{c}}AEli}{{AJf{c}}}{}{}{}{{Ad{eg}{{Ab{c}}}}}}{{{b{Nl}}}{{b{AEl}}}}{{{b{Oh}}}{{b{AEl}}}}{{{b{Oj}}}{{b{AEl}}}}{{{b{Ol}}}{{b{AEl}}}}{{{b{Lh}}}{{b{AEl}}}}`{{{b{d{AHl{c}}}}{b{dc}}ANj{b{n}}}A`{}}{{{b{d{AHl{c}}}}{b{dc}}ANjA`}h{}}{{{b{dNl}}}{{b{dAEl}}}}{{{b{dOh}}}{{b{dAEl}}}}{{{b{dOj}}}{{b{dAEl}}}}{{{b{dOl}}}{{b{dAEl}}}}{{{b{dLh}}}{{b{dAEl}}}}{{{b{d{AHl{c}}}}{b{dc}}ANjMjMj}h{}}{{{b{d{AHl{c}}}}{b{dc}}ANjCf}h{}}{{{ABf{{O`{c}}}}c}{{ABf{{O`{c}}}}}{}}{{{ABh{{O`{c}}}}c}{{ABh{{O`{c}}}}}{}}{{ei}{{`{{Ob{k}}}}}{}{{Af{}{{Jd{c}}}}}{{Ob{c}}}{{Af{{b{dc}}}{{Jd{g}}}}}{}}{g{{`{{Ob{i}}}}}En{{Ob{c}}}{{Af{{b{dc}}}{{Jd{e}}}}}{}}{{ek}{{AEb{gci}}}{}{{Af{}{{Jd{c}}}}}{}{{Ob{{Df{gc}}}}}{{Af{{b{dg}}{b{dc}}}{{Jd{i}}}}}}{i{{AEb{ceg}}}{}En{{Ob{{Df{ce}}}}}{{Af{{b{dc}}{b{de}}}{{Jd{g}}}}}}{{cg}{{AEd{g}}}{{Cn{Ll}}}{}{{Ob{e}}}}{e{{`{{Ob{{Df{gc}}}}}}}{}{{Ob{c}}}{}}{e{{`{{Ob{{Df{cg}}}}}}}{}{{Ob{c}}}{}}{{ADhc}ADh{{Cn{{Lj{AN`}}}}}}{{{ADj{c}}e}{{ADj{c}}}{}{{Cn{{Lj{AN`}}}}}}``````````````{c{{AEf{c}}}{}}``````````{e{{Lj{c}}}{}{{Ed{{b{Ll}}}{{Jd{c}}}}EhEj}}```{{{b{B`}}}{{Lj{c}}}{}}`````{e{{Lj{c}}}{}{{Cn{c}}}}`","D":"AIKdNf","p":[[1,"reference"],[0,"mut"],[1,"usize"],[1,"unit"],[10,"AppDelegate",2685,7071],[5,"DelegateCx",2685,7071],[6,"Event",2685,7072],[1,"bool"],[17,"Data"],[10,"IntoUiBuilder",6,7073],[10,"FnMut",7074],[5,"Box",7075],[6,"Result",7076],[5,"TypeId",7077],[5,"DisplayHex",76,7078],[1,"str"],[6,"AntiAlias",76,7079],[5,"Mask",76,7079],[6,"Primitive",76,7079],[6,"CurveVerb",76,7080],[6,"CurveSegment",76,7080],[5,"Formatter",7081],[5,"Error",7081],[5,"Rect",2685,7082],[10,"Hasher",7083],[5,"Color",2685,7078],[1,"f32"],[6,"FillRule",2685,7079],[5,"Curve",2685,7080],[5,"Arc",7084],[10,"Into",7085],[1,"u8"],[5,"CurveIter",76,7080],[6,"Option",7086],[1,"tuple"],[5,"SmolStr",7087],[5,"String",7088],[10,"ClipboardBackend",310,7089],[5,"CommandWaker",314,7090],[5,"Command",314,7090],[5,"CommandReceiver",314,7090],[10,"Fn",7074],[10,"Any",7077],[10,"Send",7091],[10,"Sync",7091],[5,"Contexts",367,7092],[10,"Default",7093],[5,"Ime",396,7094],[5,"KeyReleased",396,7095],[5,"PointerLeft",396,7096],[5,"WindowResized",396,7097],[5,"WindowScaled",396,7097],[5,"WindowMaximized",396,7097],[10,"IsKey",396,7095],[6,"Key",2685,7095],[6,"Code",2685,7095],[5,"Size",2685,7098],[5,"WeakImage",772,7099],[5,"TextureId",772,7100],[6,"Texture",772,7100],[5,"Image",2685,7099],[1,"u64"],[5,"ImageId",2685,7099],[5,"JustifyIterator",844,7101],[10,"Subscriber",1860,7102],[5,"Id",1860,7103],[5,"Current",7103],[5,"Metadata",1860,7104],[5,"Event",2155,7105],[10,"Instrument",1860,7106],[5,"Instrumented",2335,7106],[5,"Span",1860,7107],[5,"LevelFilter",2396,7104],[10,"Callsite",1860,7108],[5,"Attributes",2506,7103],[5,"Dispatch",1860,7109],[10,"Value",1860,7110],[5,"Field",2178,7110],[10,"Visit",2178,7110],[5,"Record",2506,7103],[5,"Interest",2584,7102],[17,"Output"],[5,"DefaultGuard",2584,7109],[5,"SetGlobalDefaultError",2584,7109],[10,"FnOnce",7074],[10,"AsField",2178,7111],[5,"DebugValue",2178,7110],[10,"Debug",7081],[5,"DisplayValue",2178,7110],[10,"Display",7081],[10,"Error",7112],[1,"f64"],[1,"i128"],[1,"i64"],[1,"u128"],[10,"WithSubscriber",2335,7106],[5,"WithDispatch",2335,7106],[10,"AsId",2506,7107],[10,"Rebuild",2685,7113],[5,"RebuildCx",2685,7114],[6,"Styled",2685,7115],[5,"Styles",2685,7115],[5,"AtlasGlyph",1074,7116],[5,"TextAttributes",1074,7117],[5,"FontAtlas",1074,7116],[5,"FontSystem",7118],[5,"SwashCache",7119],[5,"CacheKey",7120],[1,"u32"],[5,"Attrs",7121],[5,"Transition",2685,7122],[5,"Update",1182,7123],[5,"ViewFlags",1182,7123],[10,"AnyView",2685,7124],[5,"ViewId",1182,7123],[17,"State"],[10,"ViewSeq",2685,7125],[5,"BuildCx",2685,7126],[5,"ViewState",2685,7123],[5,"Vec",7127],[10,"View",2685,7128],[10,"Sized",7091],[6,"Ordering",7129],[5,"DrawCx",2685,7130],[5,"EventCx",2685,7131],[5,"LayoutCx",2685,7132],[5,"Space",2685,7133],[17,"Item"],[10,"IntoIterator",7134],[5,"Iter",7135],[5,"IterNames",7135],[5,"Pod",2685,7136],[5,"Aligned",2685,7137],[5,"Alignment",2685,7138],[5,"Animate",2685,7139],[5,"Container",2685,7140],[5,"Button",2685,7141],[5,"Checkbox",2685,7142],[5,"Painter",2685,7143],[5,"Paint",2685,7079],[5,"Collapsing",2685,7144],[5,"ColorPicker",2685,7145],[5,"Constrain",2685,7146],[5,"Flexible",2685,7147],[5,"Focus",2685,7148],[5,"Scroll",2685,7149],[5,"Stack",2685,7150],[5,"Wrap",2685,7151],[5,"Memo",2685,7152],[10,"PartialEq",7129],[5,"BuildHandler",2685,7153],[5,"Clickable",2685,7154],[5,"DrawHandler",2685,7155],[5,"EventHandler",2685,7156],[5,"RebuildHandler",2685,7157],[5,"Opaque",2685,7158],[5,"Pad",2685,7159],[5,"Padding",2685,7160],[5,"Transform",2685,7161],[5,"Vector",2685,7162],[5,"Slider",2685,7163],[5,"Suspense",2685,7164],[10,"Future",7165],[5,"Text",2685,7166],[5,"TextInput",2685,7167],[5,"Tooltip",2685,7168],[5,"Affine",2685,7169],[5,"Trigger",2685,7170],[5,"WithState",2685,7171],[5,"WithStyle",2685,7172],[5,"ZStack",2685,7173],[6,"WindowUpdate",1750,7174],[5,"WindowSnapshot",1750,7174],[5,"Window",2685,7174],[5,"Level",1860,7104],[5,"Identifier",2088,7108],[5,"ValueSet",2178,7110],[5,"WeakDispatch",2130,7109],[5,"Entered",2506,7107],[5,"EnteredSpan",2506,7107],[5,"FieldSet",2178,7110],[5,"NonZero",7175],[5,"ParseLevelError",2396,7104],[5,"Kind",2396,7104],[5,"DefaultCallsite",2088,7108],[5,"Iter",2178,7110],[10,"Clone",7176],[5,"Empty",2178,7110],[10,"Borrow",7177],[1,"slice"],[5,"IterBridge",7178],[5,"Pin",7179],[5,"Context",7180],[6,"Poll",7181],[5,"ParseLevelFilterError",2396,7104],[5,"NoSubscriber",2584,7102],[5,"Point",2685,7182],[5,"App",2685,7183],[6,"Align",2685,7101],[6,"TextAlign",2685,7117],[5,"BorderRadius",2685,7184],[5,"BorderWidth",2685,7184],[5,"Modifiers",2685,7185],[6,"Axis",2685,7186],[1,"char"],[6,"FontFamily",2685,7117],[6,"Family",7187],[5,"TextBuffer",2685,7188],[5,"Buffer",7189],[5,"PointerId",2685,7096],[5,"AppBuilder",2685,7190],[5,"PodSeq",2685,7125],[5,"SeqState",2685,7125],[5,"Aspect",2685,7191],[6,"PointerButton",2685,7096],[5,"Canvas",2685,7079],[5,"BaseCx",2685,7192],[5,"Clipboard",2685,7089],[5,"Style",2685,7115],[5,"Pattern",2685,7079],[6,"Shader",2685,7079],[6,"BlendMode",2685,7079],[6,"StrokeCap",2685,7193],[6,"StrokeJoin",2685,7193],[5,"Stroke",2685,7193],[5,"CommandProxy",2685,7090],[5,"KeyPressed",2685,7095],[5,"PointerMoved",2685,7096],[5,"PointerPressed",2685,7096],[5,"PointerReleased",2685,7096],[5,"PointerScrolled",2685,7096],[5,"CloseRequested",2685,7097],[5,"ImageData",2685,7194],[6,"Justify",2685,7101],[5,"Matrix",2685,7195],[5,"Theme",2685,7196],[5,"FontWeight",2685,7117],[6,"FontStretch",2685,7117],[6,"FontStyle",2685,7117],[6,"TextWrap",2685,7117],[6,"FontSource",2685,7197],[6,"Easing",2685,7122],[6,"Cursor",2685,7198],[5,"Pointer",2685,7199],[5,"WindowId",2685,7174],[6,"WindowSizing",2685,7174],[6,"ClickEvent",2685,7154],[5,"Flex",2685,7147],[5,"Fonts",2685,7200],[5,"State",2685,7136],[5,"WindowRenderState",6,7183],[1,"array"],[5,"TextInputStyle",2685,7167],[5,"TooltipStyle",2685,7168],[5,"CollapsingStyle",2685,7144],[5,"CheckboxStyle",2685,7142],[5,"TextStyle",2685,7166],[5,"SliderStyle",2685,7163],[5,"ButtonStyle",2685,7141],[5,"ScrollStyle",2685,7149],[5,"ColorPickerStyle",2685,7145],[5,"ContainerStyle",2685,7140],[1,"never"],[5,"Path",7201],[5,"PathBuf",7201],[5,"Arguments",7081],[10,"Hash",7083],[1,"u16"],[5,"Error",7202],[1,"fn"],[5,"PhantomData",7091],[6,"AppCommand",2685,7203],[1,"i32"],[10,"From",7085],[10,"Iterator",7204],[5,"RangeInclusive",7205],[10,"AsRef",7085],[6,"AppRequest",6,7206],[10,"ToString",7088],[6,"Align",7207],[6,"Wrap",7207],[5,"Weight",7187],[6,"Width",7208],[6,"Style",7187],[15,"Fill",300],[15,"Stroke",300],[15,"Layer",300]],"r":[[3,7209],[5,7209],[6,7183],[7,7190],[8,7203],[9,7071],[10,7206],[14,7071],[17,7073],[23,7073],[25,7183],[55,7210],[56,7210],[57,7210],[58,7210],[59,7210],[60,7210],[61,7210],[62,7210],[63,7210],[64,7210],[65,7210],[66,7210],[67,7210],[68,7210],[69,7210],[70,7210],[71,7210],[72,7210],[73,7210],[74,7210],[75,7210],[76,7079],[78,7079],[79,7184],[80,7184],[82,7079],[86,7078],[89,7080],[90,7080],[91,7080],[92,7080],[95,7078],[99,7079],[104,7079],[110,7079],[111,7079],[113,7079],[118,7079],[123,7193],[125,7193],[126,7193],[224,7078],[225,7078],[226,7078],[227,7078],[228,7078],[251,7078],[252,7078],[253,7078],[254,7078],[255,7078],[256,7078],[257,7078],[258,7078],[261,7078],[262,7078],[310,7089],[311,7089],[314,7090],[315,7090],[316,7090],[317,7090],[367,7192],[368,7126],[369,7092],[370,7130],[371,7131],[372,7132],[373,7114],[418,7097],[420,7095],[444,7072],[499,7094],[502,7095],[509,7095],[520,7095],[522,7095],[534,7185],[560,7096],[561,7096],[562,7096],[564,7096],[566,7096],[568,7096],[570,7096],[609,7097],[611,7097],[613,7097],[773,7099],[775,7194],[776,7099],[777,7100],[778,7100],[779,7099],[844,7169],[845,7101],[846,7138],[847,7186],[852,7211],[855,7101],[856,7101],[857,7195],[858,7160],[859,7182],[860,7082],[861,7098],[862,7133],[869,7162],[889,7211],[905,7108],[906,7109],[907,7105],[908,7103],[909,7106],[910,7104],[911,7104],[912,7107],[913,7102],[914,7110],[915,7212],[918,7213],[919,7213],[920,7213],[924,7213],[926,7213],[927,7213],[928,7212],[930,7213],[932,7213],[934,7213],[936,7213],[937,7213],[938,7213],[940,7214],[941,7213],[943,7212],[945,7212],[953,7213],[954,7213],[955,7213],[956,7213],[957,7213],[958,7213],[960,7213],[961,7213],[962,7108],[963,7108],[964,7108],[966,7108],[967,7108],[969,7109],[970,7109],[971,7109],[972,7109],[973,7109],[974,7109],[975,7109],[976,7109],[977,7105],[978,7111],[979,7110],[980,7110],[981,7110],[982,7110],[983,7110],[984,7110],[985,7110],[986,7110],[987,7110],[989,7110],[990,7110],[1001,7106],[1002,7106],[1003,7106],[1004,7106],[1009,7104],[1010,7104],[1011,7215],[1012,7104],[1013,7104],[1014,7104],[1015,7104],[1016,7104],[1017,7104],[1018,7107],[1019,7103],[1020,7107],[1021,7107],[1022,7103],[1023,7103],[1024,7107],[1026,7109],[1027,7102],[1028,7102],[1029,7109],[1030,7102],[1046,7216],[1047,7216],[1049,7216],[1050,7113],[1051,7209],[1054,7115],[1056,7115],[1057,7115],[1058,7196],[1062,7115],[1066,7115],[1072,7115],[1074,7116],[1085,7116],[1086,7117],[1087,7197],[1088,7117],[1089,7117],[1090,7117],[1091,7200],[1105,7117],[1106,7117],[1107,7188],[1108,7117],[1147,7209],[1175,7122],[1177,7122],[1179,7122],[1181,7122],[1184,7124],[1185,7124],[1186,7124],[1197,7136],[1198,7125],[1199,7125],[1200,7136],[1203,7123],[1204,7128],[1205,7123],[1206,7123],[1207,7125],[1208,7123],[1211,7124],[1344,7136],[1376,7137],[1377,7139],[1378,7191],[1379,7153],[1380,7141],[1381,7141],[1382,7142],[1383,7142],[1385,7154],[1386,7154],[1387,7144],[1388,7144],[1389,7145],[1390,7145],[1391,7146],[1392,7140],[1393,7140],[1394,7155],[1395,7156],[1396,7147],[1397,7147],[1398,7148],[1399,7148],[1400,7152],[1401,7158],[1402,7159],[1403,7143],[1405,7157],[1407,7149],[1408,7149],[1409,7163],[1410,7163],[1411,7150],[1412,7164],[1413,7166],[1414,7167],[1415,7167],[1416,7166],[1417,7168],[1418,7168],[1419,7161],[1420,7170],[1421,7171],[1422,7172],[1423,7151],[1424,7173],[1427,7137],[1440,7139],[1447,7140],[1501,7137],[1502,7137],[1503,7137],[1504,7141],[1507,7137],[1508,7142],[1510,7143],[1511,7144],[1527,7145],[1529,7146],[1530,7140],[1558,7143],[1560,7147],[1563,7147],[1565,7148],[1598,7146],[1599,7149],[1600,7150],[1601,7210],[1602,7150],[1603,7150],[1604,7151],[1605,7210],[1606,7151],[1607,7151],[1620,7137],[1633,7146],[1634,7146],[1635,7146],[1636,7152],[1637,7146],[1638,7146],[1639,7146],[1641,7153],[1642,7154],[1643,7155],[1645,7156],[1646,7156],[1651,7154],[1652,7157],[1653,7154],[1655,7158],[1657,7159],[1658,7159],[1659,7159],[1660,7159],[1661,7159],[1667,7143],[1673,7143],[1674,7137],[1675,7161],[1676,7161],[1678,7161],[1679,7146],[1685,7163],[1692,7164],[1693,7166],[1698,7167],[1700,7168],[1701,7137],[1702,7137],[1703,7137],[1704,7161],[1706,7139],[1715,7139],[1716,7139],[1717,7139],[1718,7161],[1719,7170],[1721,7149],[1722,7150],[1723,7210],[1724,7150],[1725,7150],[1726,7151],[1727,7210],[1728,7151],[1729,7151],[1730,7146],[1735,7171],[1736,7171],[1737,7171],[1738,7171],[1739,7172],[1740,7171],[1741,7171],[1748,7173],[1749,7210],[1760,7198],[1782,7199],[1798,7174],[1799,7174],[1800,7174],[1801,7174],[1802,7174],[1860,7108],[1862,7109],[1864,7105],[1866,7103],[1867,7106],[1868,7104],[1869,7104],[1870,7107],[1871,7102],[1873,7110],[1886,7212],[1908,7213],[1909,7213],[1921,7213],[1939,7213],[1949,7213],[1950,7213],[1951,7212],[1954,7213],[1956,7213],[1959,7213],[1992,7213],[1993,7213],[1999,7213],[2001,7214],[2021,7213],[2026,7212],[2029,7212],[2055,7213],[2056,7213],[2057,7213],[2058,7213],[2066,7213],[2067,7213],[2085,7213],[2086,7213],[2088,7108],[2089,7108],[2090,7108],[2118,7108],[2119,7108],[2130,7109],[2131,7109],[2132,7109],[2133,7109],[2144,7109],[2147,7109],[2148,7109],[2154,7109],[2155,7105],[2178,7111],[2179,7110],[2180,7110],[2181,7110],[2182,7110],[2183,7110],[2184,7110],[2185,7110],[2186,7110],[2187,7110],[2218,7110],[2233,7110],[2335,7106],[2336,7106],[2337,7106],[2338,7106],[2393,7104],[2394,7104],[2395,7215],[2401,7104],[2402,7104],[2403,7104],[2404,7104],[2406,7104],[2407,7104],[2506,7107],[2507,7103],[2508,7107],[2509,7107],[2510,7103],[2511,7103],[2512,7107],[2584,7109],[2585,7102],[2586,7102],[2587,7109],[2588,7102],[2664,7216],[2665,7216],[2684,7216],[2693,7169],[2696,7101],[2697,7137],[2698,7138],[2703,7139],[2705,7124],[2707,7183],[2708,7190],[2709,7203],[2710,7071],[2712,7191],[2713,7186],[2754,7192],[2756,7079],[2757,7184],[2758,7184],[2760,7124],[2763,7209],[2764,7126],[2765,7153],[2768,7141],[2769,7141],[2783,7079],[2791,7142],[2792,7142],[2796,7154],[2797,7154],[2798,7089],[2799,7097],[2802,7095],[2805,7144],[2806,7144],[2807,7078],[2808,7145],[2809,7145],[2812,7090],[2816,7146],[2817,7140],[2818,7140],[2827,7198],[2828,7080],[2837,7071],[2845,7130],[2846,7155],[2852,7122],[2865,7072],[2866,7131],[2867,7156],[2911,7211],[2931,7079],[2934,7147],[2935,7147],[2938,7148],[2939,7117],[2940,7197],[2941,7117],[2942,7117],[2943,7117],[2944,7200],[2971,7099],[2972,7194],[2973,7099],[2979,7101],[2985,7095],[2996,7095],[3011,7132],[3015,7148],[3021,7195],[3022,7152],[3027,7185],[3068,7158],[3077,7159],[3078,7160],[3083,7079],[3084,7143],[3087,7079],[3092,7136],[3093,7125],[3094,7182],[3095,7199],[3097,7096],[3098,7096],[3100,7096],[3102,7096],[3104,7096],[3106,7096],[3121,7113],[3122,7209],[3123,7114],[3124,7157],[3125,7082],[3153,7149],[3156,7149],[3163,7125],[3165,7079],[3167,7098],[3169,7163],[3170,7163],[3174,7133],[3181,7150],[3185,7136],[3189,7193],[3190,7193],[3191,7193],[3192,7115],[3194,7115],[3195,7209],[3196,7115],[3198,7164],[3215,7166],[3217,7117],[3218,7188],[3219,7167],[3220,7167],[3221,7166],[3222,7117],[3223,7196],[3224,7168],[3225,7168],[3227,7161],[3228,7122],[3229,7170],[3242,7162],[3245,7128],[3246,7125],[3247,7123],[3259,7174],[3260,7174],[3264,7174],[3265,7171],[3266,7172],[3268,7151],[3284,7173],[3323,7137],[3353,7139],[3359,7124],[3422,7140],[3749,7137],[3754,7137],[3757,7137],[3803,7141],[3814,7137],[3819,7142],[3827,7143],[4076,7144],[4103,7145],[4106,7115],[4110,7146],[4113,7140],[4162,7213],[4484,7209],[4855,7122],[4858,7143],[4913,7213],[4957,7147],[4973,7147],[5048,7148],[5417,7146],[5423,7078],[5433,7149],[5434,7078],[5436,7078],[5438,7150],[5439,7210],[5440,7150],[5441,7150],[5442,7078],[5444,7078],[5446,7151],[5447,7210],[5448,7151],[5449,7151],[5476,7209],[5479,7213],[5755,7209],[5783,7209],[5792,7209],[5801,7115],[5851,7137],[5880,7122],[5906,7146],[5908,7146],[5911,7146],[5915,7152],[5924,7146],[5926,7146],[5929,7146],[5935,7209],[6048,7078],[6050,7078],[6052,7078],[6054,7078],[6056,7078],[6058,7078],[6060,7078],[6062,7078],[6064,7153],[6065,7154],[6066,7155],[6069,7156],[6070,7156],[6079,7154],[6080,7157],[6081,7154],[6084,7158],[6093,7159],[6094,7159],[6095,7159],[6096,7159],[6097,7159],[6104,7143],[6111,7136],[6153,7211],[6242,7143],[6282,7078],[6284,7078],[6287,7137],[6291,7161],[6293,7161],[6304,7161],[6345,7146],[6366,7163],[6381,7210],[6384,7210],[6425,7164],[6428,7166],[6437,7167],[6541,7168],[6542,7137],[6547,7137],[6550,7137],[6553,7213],[6554,7161],[6564,7139],[6577,7139],[6578,7139],[6579,7139],[6580,7161],[6586,7170],[6963,7115],[6978,7149],[6979,7150],[6980,7210],[6981,7150],[6982,7150],[6983,7151],[6984,7210],[6985,7151],[6986,7151],[6988,7213],[6993,7209],[6994,7146],[7025,7171],[7026,7171],[7027,7171],[7028,7171],[7029,7172],[7030,7171],[7031,7171],[7048,7173],[7049,7210],[7051,7115],[7053,7115],[7054,7115],[7055,7196],[7059,7115],[7063,7115],[7069,7115]],"b":[[209,"impl-Debug-for-DisplayHex"],[210,"impl-Display-for-DisplayHex"],[816,"impl-From%3CImage%3E-for-Texture"],[817,"impl-From%3CTextureId%3E-for-Texture"],[1222,"impl-Update"],[1223,"impl-Flags-for-Update"],[1224,"impl-ViewFlags"],[1225,"impl-Flags-for-ViewFlags"],[1285,"impl-Binary-for-Update"],[1286,"impl-UpperHex-for-Update"],[1287,"impl-Octal-for-Update"],[1288,"impl-Debug-for-Update"],[1289,"impl-LowerHex-for-Update"],[1290,"impl-Binary-for-ViewFlags"],[1291,"impl-Octal-for-ViewFlags"],[1292,"impl-UpperHex-for-ViewFlags"],[1293,"impl-Debug-for-ViewFlags"],[1294,"impl-LowerHex-for-ViewFlags"],[1295,"impl-Display-for-ViewId"],[1296,"impl-Debug-for-ViewId"],[1302,"impl-Flags-for-Update"],[1303,"impl-Update"],[1304,"impl-ViewFlags"],[1305,"impl-Flags-for-ViewFlags"],[1923,"impl-dyn+Subscriber+%2B+Sync"],[1924,"impl-dyn+Subscriber"],[1925,"impl-dyn+Subscriber+%2B+Send"],[1926,"impl-dyn+Subscriber+%2B+Send+%2B+Sync"],[1946,"impl-PartialEq%3CLevelFilter%3E-for-Level"],[1947,"impl-PartialEq-for-Level"],[1963,"impl-Display-for-dyn+Value"],[1964,"impl-Debug-for-dyn+Value"],[1968,"impl-Display-for-Level"],[1969,"impl-Debug-for-Level"],[1981,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[1982,"impl-PartialOrd-for-Level"],[1983,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[1984,"impl-PartialOrd-for-Level"],[2009,"impl-dyn+Subscriber+%2B+Send"],[2010,"impl-dyn+Subscriber+%2B+Send+%2B+Sync"],[2011,"impl-dyn+Subscriber"],[2012,"impl-dyn+Subscriber+%2B+Sync"],[2018,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[2019,"impl-PartialOrd-for-Level"],[2023,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[2024,"impl-PartialOrd-for-Level"],[2043,"impl-PartialOrd-for-Level"],[2044,"impl-PartialOrd%3CLevelFilter%3E-for-Level"],[2189,"impl-AsField-for-Field"],[2190,"impl-AsField-for-%26Field"],[2245,"impl-Debug-for-FieldSet"],[2246,"impl-Display-for-FieldSet"],[2247,"impl-Display-for-ValueSet%3C\'a%3E"],[2248,"impl-Debug-for-ValueSet%3C\'a%3E"],[2249,"impl-Debug-for-Field"],[2250,"impl-Display-for-Field"],[2253,"impl-Debug-for-DisplayValue%3CT%3E"],[2254,"impl-Display-for-DisplayValue%3CT%3E"],[2444,"impl-PartialEq-for-LevelFilter"],[2445,"impl-PartialEq%3CLevel%3E-for-LevelFilter"],[2447,"impl-Debug-for-LevelFilter"],[2448,"impl-Display-for-LevelFilter"],[2449,"impl-Debug-for-ParseLevelFilterError"],[2450,"impl-Display-for-ParseLevelFilterError"],[2451,"impl-Display-for-ParseLevelError"],[2452,"impl-Debug-for-ParseLevelError"],[2455,"impl-From%3COption%3CLevel%3E%3E-for-LevelFilter"],[2456,"impl-From%3CLevel%3E-for-LevelFilter"],[2461,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2462,"impl-PartialOrd-for-LevelFilter"],[2463,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2464,"impl-PartialOrd-for-LevelFilter"],[2479,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2480,"impl-PartialOrd-for-LevelFilter"],[2481,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2482,"impl-PartialOrd-for-LevelFilter"],[2483,"impl-PartialOrd%3CLevel%3E-for-LevelFilter"],[2484,"impl-PartialOrd-for-LevelFilter"],[2632,"impl-Debug-for-SetGlobalDefaultError"],[2633,"impl-Display-for-SetGlobalDefaultError"],[3294,"impl-Add%3Cf32%3E-for-Point"],[3295,"impl-Add%3CVector%3E-for-Point"],[3296,"impl-Add%3CSize%3E-for-Point"],[3297,"impl-Add%3CVector%3E-for-Rect"],[3298,"impl-Add%3CSize%3E-for-Rect"],[3299,"impl-Add%3Cf32%3E-for-Size"],[3300,"impl-Add%3CVector%3E-for-Size"],[3301,"impl-Add-for-Size"],[3303,"impl-Add%3Cf32%3E-for-Vector"],[3304,"impl-Add-for-Vector"],[3306,"impl-AddAssign%3CSize%3E-for-Point"],[3307,"impl-AddAssign%3CVector%3E-for-Point"],[3308,"impl-AddAssign%3Cf32%3E-for-Point"],[3309,"impl-AddAssign%3CVector%3E-for-Rect"],[3310,"impl-AddAssign%3CSize%3E-for-Rect"],[3311,"impl-AddAssign%3Cf32%3E-for-Size"],[3312,"impl-AddAssign-for-Size"],[3313,"impl-AddAssign%3CVector%3E-for-Size"],[3315,"impl-AddAssign%3Cf32%3E-for-Vector"],[3316,"impl-AddAssign-for-Vector"],[4487,"impl-Div%3CVector%3E-for-Point"],[4488,"impl-Div%3Cf32%3E-for-Point"],[4489,"impl-Div%3CSize%3E-for-Point"],[4490,"impl-Div%3CVector%3E-for-Size"],[4491,"impl-Div%3Cf32%3E-for-Size"],[4492,"impl-Div-for-Size"],[4493,"impl-Div%3Cf32%3E-for-Vector"],[4494,"impl-Div-for-Vector"],[4495,"impl-DivAssign%3CSize%3E-for-Point"],[4496,"impl-DivAssign%3CVector%3E-for-Point"],[4497,"impl-DivAssign%3Cf32%3E-for-Point"],[4498,"impl-DivAssign%3Cf32%3E-for-Size"],[4499,"impl-DivAssign%3CVector%3E-for-Size"],[4500,"impl-DivAssign-for-Size"],[4501,"impl-DivAssign%3Cf32%3E-for-Vector"],[4502,"impl-DivAssign-for-Vector"],[4534,"impl-View%3CT%3E-for-Painter%3CT%3E"],[4535,"impl-Painter%3CT%3E"],[4936,"impl-Clickable%3CT,+V,+F%3E"],[4937,"impl-View%3CT%3E-for-Clickable%3CT,+V,+F%3E"],[4987,"impl-Display-for-Color"],[4988,"impl-Debug-for-Color"],[5016,"impl-Debug-for-Point"],[5017,"impl-Display-for-Point"],[5019,"impl-Display-for-Size"],[5020,"impl-Debug-for-Size"],[5022,"impl-Display-for-Vector"],[5023,"impl-Debug-for-Vector"],[5042,"impl-Display-for-WindowId"],[5043,"impl-Debug-for-WindowId"],[5122,"impl-From%3Cf32%3E-for-BorderRadius"],[5123,"impl-From%3C%5Bf32;+4%5D%3E-for-BorderRadius"],[5124,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-BorderRadius"],[5125,"impl-From%3C%5Bf32;+4%5D%3E-for-BorderWidth"],[5126,"impl-From%3C%5Bf32;+2%5D%3E-for-BorderWidth"],[5127,"impl-From%3Cf32%3E-for-BorderWidth"],[5128,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-BorderWidth"],[5130,"impl-From%3C(f32,+f32)%3E-for-BorderWidth"],[5136,"impl-From%3CColor%3E-for-Paint"],[5137,"impl-From%3CImage%3E-for-Paint"],[5138,"impl-From%3CPattern%3E-for-Paint"],[5141,"impl-From%3C%5Bf32;+4%5D%3E-for-Color"],[5142,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Color"],[5168,"impl-From%3C(f32,+f32)%3E-for-Alignment"],[5169,"impl-From%3C%5Bf32;+2%5D%3E-for-Alignment"],[5175,"impl-From%3C%5Bf32;+2%5D%3E-for-Padding"],[5176,"impl-From%3C(f32,+f32)%3E-for-Padding"],[5177,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Padding"],[5179,"impl-From%3C%5Bf32;+4%5D%3E-for-Padding"],[5180,"impl-From%3Cf32%3E-for-Padding"],[5181,"impl-From%3CVector%3E-for-Point"],[5182,"impl-From%3C(f32,+f32)%3E-for-Point"],[5183,"impl-From%3Cf32%3E-for-Point"],[5185,"impl-From%3CSize%3E-for-Point"],[5186,"impl-From%3C%5Bf32;+2%5D%3E-for-Point"],[5187,"impl-From%3CSize%3E-for-Rect"],[5189,"impl-From%3C%5Bf32;+4%5D%3E-for-Rect"],[5190,"impl-From%3Cf32%3E-for-Size"],[5192,"impl-From%3CPoint%3E-for-Size"],[5193,"impl-From%3C(f32,+f32)%3E-for-Size"],[5194,"impl-From%3CVector%3E-for-Size"],[5195,"impl-From%3C%5Bf32;+2%5D%3E-for-Size"],[5198,"impl-From%3C%5Bf32;+2%5D%3E-for-Vector"],[5200,"impl-From%3C(f32,+f32)%3E-for-Vector"],[5201,"impl-From%3CPoint%3E-for-Vector"],[5202,"impl-From%3CSize%3E-for-Vector"],[5203,"impl-From%3Cf32%3E-for-Vector"],[5205,"impl-From%3CTextInputStyle%3E-for-Styles"],[5206,"impl-From%3CTheme%3E-for-Styles"],[5208,"impl-From%3CTooltipStyle%3E-for-Styles"],[5209,"impl-From%3CCollapsingStyle%3E-for-Styles"],[5210,"impl-From%3CCheckboxStyle%3E-for-Styles"],[5211,"impl-From%3CTextStyle%3E-for-Styles"],[5212,"impl-From%3CSliderStyle%3E-for-Styles"],[5213,"impl-From%3CButtonStyle%3E-for-Styles"],[5214,"impl-From%3CScrollStyle%3E-for-Styles"],[5215,"impl-From%3CColorPickerStyle%3E-for-Styles"],[5216,"impl-From%3CContainerStyle%3E-for-Styles"],[5217,"impl-From%3CT%3E-for-Styled%3CT%3E"],[5218,"impl-From%3CString%3E-for-Styled%3CFontFamily%3E"],[5219,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CPadding%3E"],[5220,"impl-From%3C%5Bf32;+2%5D%3E-for-Styled%3CBorderWidth%3E"],[5221,"impl-From%3CSmolStr%3E-for-Styled%3CFontFamily%3E"],[5223,"impl-From%3C%5Bf32;+2%5D%3E-for-Styled%3CPadding%3E"],[5225,"impl-From%3C(f32,+f32)%3E-for-Styled%3CPadding%3E"],[5226,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CBorderWidth%3E"],[5227,"impl-From%3Cf32%3E-for-Styled%3CBorderRadius%3E"],[5228,"impl-From%3C(f32,+f32)%3E-for-Styled%3CBorderWidth%3E"],[5229,"impl-From%3CStyle%3CT%3E%3E-for-Styled%3CT%3E"],[5230,"impl-From%3Cf32%3E-for-Styled%3CBorderWidth%3E"],[5231,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CBorderWidth%3E"],[5232,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CBorderRadius%3E"],[5233,"impl-From%3C%26str%3E-for-Styled%3CFontFamily%3E"],[5234,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CBorderRadius%3E"],[5235,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CPadding%3E"],[5236,"impl-From%3Cf32%3E-for-Styled%3CPadding%3E"],[5238,"impl-From%3CString%3E-for-FontFamily"],[5239,"impl-From%3CSmolStr%3E-for-FontFamily"],[5240,"impl-From%3C%26str%3E-for-FontFamily"],[5248,"impl-From%3CVec%3Cu8%3E%3E-for-FontSource%3C\'_%3E"],[5249,"impl-From%3C%26str%3E-for-FontSource%3C\'a%3E"],[5250,"impl-From%3C%26Path%3E-for-FontSource%3C\'a%3E"],[5252,"impl-From%3CPathBuf%3E-for-FontSource%3C\'_%3E"],[5253,"impl-From%3C%26%5Bu8%5D%3E-for-FontSource%3C\'a%3E"],[5945,"impl-Mul-for-Color"],[5946,"impl-Mul%3Cf32%3E-for-Color"],[5947,"impl-Mul%3CPoint%3E-for-Affine"],[5948,"impl-Mul%3CVector%3E-for-Affine"],[5949,"impl-Mul-for-Affine"],[5950,"impl-Mul-for-Matrix"],[5951,"impl-Mul%3CVector%3E-for-Matrix"],[5952,"impl-Mul%3CPoint%3E-for-Matrix"],[5953,"impl-Mul%3Cf32%3E-for-Point"],[5954,"impl-Mul%3CVector%3E-for-Point"],[5955,"impl-Mul%3CSize%3E-for-Point"],[5956,"impl-Mul%3Cf32%3E-for-Size"],[5957,"impl-Mul%3CVector%3E-for-Size"],[5958,"impl-Mul-for-Size"],[5959,"impl-Mul%3Cf32%3E-for-Vector"],[5960,"impl-Mul-for-Vector"],[5962,"impl-MulAssign%3CSize%3E-for-Point"],[5963,"impl-MulAssign%3CVector%3E-for-Point"],[5964,"impl-MulAssign%3Cf32%3E-for-Point"],[5965,"impl-MulAssign-for-Size"],[5966,"impl-MulAssign%3CVector%3E-for-Size"],[5967,"impl-MulAssign%3Cf32%3E-for-Size"],[5968,"impl-MulAssign-for-Vector"],[5969,"impl-MulAssign%3Cf32%3E-for-Vector"],[6190,"impl-View%3CT%3E-for-Aligned%3CV%3E"],[6191,"impl-Rebuild-for-Aligned%3CV%3E"],[6192,"impl-Rebuild-for-Aspect%3CV%3E"],[6193,"impl-View%3CT%3E-for-Aspect%3CV%3E"],[6194,"impl-Rebuild-for-Button%3CV%3E"],[6195,"impl-View%3CT%3E-for-Button%3CV%3E"],[6197,"impl-View%3CT%3E-for-Checkbox"],[6198,"impl-Rebuild-for-Checkbox"],[6200,"impl-View%3CT%3E-for-Clickable%3CT,+V,+F%3E"],[6201,"impl-Rebuild-for-Clickable%3CT,+V,+F%3E"],[6202,"impl-View%3CT%3E-for-Collapsing%3CT,+H,+V%3E"],[6203,"impl-Rebuild-for-Collapsing%3CT,+H,+V%3E"],[6205,"impl-View%3CT%3E-for-ColorPicker%3CT%3E"],[6206,"impl-Rebuild-for-ColorPicker%3CT%3E"],[6208,"impl-View%3CT%3E-for-Constrain%3CV%3E"],[6209,"impl-Rebuild-for-Constrain%3CV%3E"],[6210,"impl-View%3CT%3E-for-Container%3CV%3E"],[6211,"impl-Rebuild-for-Container%3CV%3E"],[6213,"impl-View%3CT%3E-for-Flexible%3CV%3E"],[6214,"impl-Rebuild-for-Flexible%3CV%3E"],[6215,"impl-View%3CT%3E-for-Pad%3CV%3E"],[6216,"impl-Rebuild-for-Pad%3CV%3E"],[6217,"impl-View%3CT%3E-for-Painter%3CT%3E"],[6218,"impl-Rebuild-for-Painter%3CT%3E"],[6219,"impl-View%3CT%3E-for-Scroll%3CV%3E"],[6220,"impl-Rebuild-for-Scroll%3CV%3E"],[6222,"impl-Rebuild-for-Slider%3CT%3E"],[6223,"impl-View%3CT%3E-for-Slider%3CT%3E"],[6225,"impl-View%3CT%3E-for-Stack%3CV%3E"],[6226,"impl-Rebuild-for-Stack%3CV%3E"],[6231,"impl-Rebuild-for-Tooltip%3CV%3E"],[6232,"impl-View%3CT%3E-for-Tooltip%3CV%3E"],[6234,"impl-View%3CT%3E-for-Transform%3CV%3E"],[6235,"impl-Rebuild-for-Transform%3CV%3E"],[6236,"impl-View%3CT%3E-for-Wrap%3CV%3E"],[6237,"impl-Rebuild-for-Wrap%3CV%3E"],[6252,"impl-Rem%3CVector%3E-for-Point"],[6253,"impl-Rem%3CSize%3E-for-Point"],[6254,"impl-Rem%3Cf32%3E-for-Point"],[6255,"impl-Rem%3Cf32%3E-for-Size"],[6256,"impl-Rem%3CVector%3E-for-Size"],[6257,"impl-Rem-for-Size"],[6258,"impl-Rem%3Cf32%3E-for-Vector"],[6259,"impl-Rem-for-Vector"],[6260,"impl-RemAssign%3CSize%3E-for-Point"],[6261,"impl-RemAssign%3Cf32%3E-for-Point"],[6262,"impl-RemAssign%3CVector%3E-for-Point"],[6263,"impl-RemAssign-for-Size"],[6264,"impl-RemAssign%3Cf32%3E-for-Size"],[6265,"impl-RemAssign%3CVector%3E-for-Size"],[6266,"impl-RemAssign%3Cf32%3E-for-Vector"],[6267,"impl-RemAssign-for-Vector"],[6400,"impl-Sub%3CSize%3E-for-Point"],[6401,"impl-Sub-for-Point"],[6402,"impl-Sub%3CVector%3E-for-Point"],[6403,"impl-Sub%3Cf32%3E-for-Point"],[6404,"impl-Sub%3CSize%3E-for-Rect"],[6405,"impl-Sub%3CVector%3E-for-Rect"],[6406,"impl-Sub%3Cf32%3E-for-Size"],[6407,"impl-Sub%3CVector%3E-for-Size"],[6408,"impl-Sub-for-Size"],[6410,"impl-Sub-for-Vector"],[6411,"impl-Sub%3Cf32%3E-for-Vector"],[6412,"impl-SubAssign%3CVector%3E-for-Point"],[6413,"impl-SubAssign%3CSize%3E-for-Point"],[6414,"impl-SubAssign%3Cf32%3E-for-Point"],[6415,"impl-SubAssign%3CSize%3E-for-Rect"],[6416,"impl-SubAssign%3CVector%3E-for-Rect"],[6417,"impl-SubAssign%3Cf32%3E-for-Size"],[6418,"impl-SubAssign-for-Size"],[6419,"impl-SubAssign%3CVector%3E-for-Size"],[6421,"impl-SubAssign-for-Vector"],[6422,"impl-SubAssign%3Cf32%3E-for-Vector"]],"c":"OjAAAAEAAAAAAAQAEAAAAJsDCwSQB5EHPwo=","e":"OzAAAAEAAFIOTAEbAAMAIQAFACsAAAAtAAAAMgAFAIIAAACHAA0AmQAVALIAGwDPAAYA2QAAAN8AAQDnAAYA9QAAAPsAAAAKAQgAFwEUAD8BFABXAQAAWQECAGQBBgBsAQIAdwEBAHoBBACDAQAAigEIAJQBAQCXAQsApgEBAKkBEwC+ASgA6AELAPUBAQD4AQUA/wEJAA0CCQAYAg4AKAIIAD4CDQBNAgsAWgIEAGACAQBoAgQAbgILAH0CFACWAgAAmQIcALwCAwDGAgUA6AIXAA0DIAAxAwEANAMBADcDAgBAAwsAaAMBAGsDAgBwAwAAcgMAAHkDAAB+AwIAWQQMAGcECgBzBAIAfQQCAIoECgDIBAAAygQAAM8EBQDXBAwA6AQIAPUEAgD/BAIABgULABcFAAAaBQAAIQUFADAFAQBABQAATwUEAFYFCADXBgQA3gYCAOQGAgDoBgIA7gYIAPgGAQD7BgEA/gYAAAAHAQADBwAABQcBAAwHCwAcBwMAIQcEACsHAQA7BwcAVQcJAGIHBwBsBwUAeAcJAIoHBQCZBwQArAcHALgHAAC8BwAAvgcDAMMHAgDLBwQA4wcBAOgHAQD8BwEADQgFABcIDgAsCA8APggCAEUIAABLCAcAVwgIAGIIAABmCAMAbQgBAHAIAQBzCAAAdQgAAHcIAACACAIAjggQAKEICACsCA0AuwgJAMYICgDYCAcA5wgBAPAIAQD0CAIAAAkfACQJDQAzCQQAOwkBAEgJAQBMCQEAUAkHAGwJEgCACRUAmAkBAJ0JBQCkCQMAsAkaANMJBwDeCQ4A7wkDAPgJAwAMCgsAHwoLACwKAgAwCggAOgoEAEEKAABDCgAARQoAAEgKBQBSCgMAYQoAAGQKAABmCgAAaAoAAGwKAwBxCgsAfgoCAIUKAACHCgEAjAoDAJMKAACYCgAAmwoBAKIKAACkCgAAvwoDAMgKAADKCgEA0woAANwKAwDhCgIA5woAAOsKAAD0CgEA+woAAP4KAAAFCwUADgsDABQLAQAXCwEAGwsBACALAQAmCwIALAsEADULAQA6CyQAdQsAAHkLAQCDCw0AkgsBAJkLAQCfCwEAogsBAKULAACnCwIAqwsJALgLAgDCCwEAxQsCAMoLAQDQCwIA1gsBAN0LAADfCwIA5gsRAPoLAQAADAAABAwBAAgMAwAODAAAEgwCABkMAAAnDAIAKwwDADAMAQA3DAAAOQwDAD8MAwBHDAAASQwHAFMMAQBWDAAAWAwAAFsMAABfDAAAYQwAAGgMAQB+DAAAgAwDAIwMAgCRDAAAmwwAAJ8MAACkDAMAqQwAAK0MAACxDAMAugwBAMYMAADJDAAAzAwBANYMAwDeDBcAKA0iAFANAABSDQAAcQ0DALIN8wC4Dg0Axw4UAP4O5ABGECcAdRAMAYgRDwCeERkAuREIAMkReQBFEiIAaRIiAI0SIgCxEiIA1RIiAP0SNAA3ExEAShMQAHMTRQADFAYACxQAAA0UAAARFAIAFhQBABkUAAAeFAAALhQAADEUAQA4FAIAPBQEAEIUAgBGFAEASRQEAE8UAABRFAMAVhQBAFkUDQBoFA0AdxQCAIEUAgCFFAEAihQCAI4UAACuFAAA+xQsAGoVAwBvFXUAbxYAAHIWAQC2FgwAxBYVADoXGABaFwEAIBgNAC8YBQA2GAEAORgDAD4YAQBBGAMARhgHAE8YAQBSGAIAVhgAAFgYAQBbGAQAbRgPAAEZFgA+GT0AgRkEAIcZBAC+GXkAOhrzAA=="}],\
["ori_app",{"t":"FFGKGPPRFPPKPPPPPIPFNNNNNNNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN","n":["App","AppBuilder","AppCommand","AppDelegate","AppRequest","CloseWindow","CloseWindow","Data","DelegateCx","DragWindow","DragWindow","IntoUiBuilder","OpenWindow","OpenWindow","Quit","Quit","RequestRedraw","UiBuilder","UpdateWindow","WindowRenderState","add_context","add_window","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","build","build","canvas","clear_color","close_requested","close_window","default","delegate","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","draw_window","drop","drop","drop","drop","drop","drop","event","event","font","from","from","from","from","from","from","get_window","get_window_mut","handle_commands","idle","idle","idle","init","init","init","init","init","init","init","init","init","into","into","into","into","into","into","into_ui_builder","keyboard_key","logical_size","modifiers_changed","new","open_window","open_window","pointer_button","pointer_left","pointer_moved","pointer_scrolled","quit","rebuild","rebuild","remove_window","style","take_requests","theme","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","update_hovered","window","window_event","window_maximized","window_resized","window_scaled"],"q":[[0,"ori_app"],[135,"ori_app::app"],[136,"core::any"],[137,"ori_core::window::window"],[138,"ori_app::builder"],[139,"ori_core::command"],[140,"ori_app::delegate"],[141,"core::option"],[142,"ori_core::event::event"],[143,"ori_core::text::source"],[144,"core::convert"],[145,"ori_core::event::keyboard"],[146,"alloc::string"],[147,"ori_core::event::modifiers"],[148,"ori_app::command"],[149,"ori_core::view::view"],[150,"core::ops::function"],[151,"core::marker"],[152,"ori_core::view::any"],[153,"ori_core::event::pointer"],[154,"ori_core::layout::point"],[155,"ori_core::layout::vector"],[156,"ori_core::style::style"],[157,"ori_app::request"],[158,"core::iter::traits::iterator"],[159,"ori_core::style::palette"],[160,"core::result"]],"i":[0,0,0,0,0,26,38,21,0,26,38,0,26,38,26,38,38,0,38,0,2,2,15,2,8,26,12,38,15,2,8,26,12,38,2,8,15,15,2,12,8,8,15,2,8,26,12,12,38,15,2,8,26,12,12,38,2,15,2,8,26,12,38,13,2,8,15,2,8,26,12,38,2,2,2,2,13,13,15,2,2,8,26,12,13,13,38,15,2,8,26,12,38,21,2,15,2,8,26,12,2,2,2,2,12,2,12,2,8,2,8,15,2,8,26,12,38,15,2,8,26,12,38,15,2,8,26,12,38,2,8,2,2,2,2],"f":"````````````````````{{{f{b{d{c}}}}e}h{}j}{{{f{b{d{c}}}}{f{bc}}{l{c}}n}h{}}{{{f{c}}}{{f{e}}}{}{}}00000{{{f{bc}}}{{f{be}}}{}{}}00000{{}{{A`{c}}}{}}{{{A`{c}}Ab}{{d{c}}}{}}``{{{f{b{d{c}}}}{f{bc}}Ad}Af{}}{{{f{b{Ah{c}}}}Ad}h{}}3{{{A`{c}}e}{{A`{c}}}{}{{Aj{c}}}}{Al{{f{c}}}{}}000{{{f{{Ah{c}}}}}{{f{e}}}{}{}}11{Al{{f{bc}}}{}}000{{{f{b{Ah{c}}}}}{{f{be}}}{}{}}11{{{f{b{d{c}}}}{f{bc}}Ad}{{B`{An}}}{}}{Alh}00000{{{f{bAj}}{f{b{Ah{c}}}}{f{bc}}{f{Bb}}}Af{}}{{{f{b{d{c}}}}{f{bc}}{f{Bb}}}Af{}}{{{A`{c}}e}{{A`{c}}}{}{{Bf{Bd}}}}{cc{}}00000{{{f{{d{c}}}}Ad}{{B`{{f{n}}}}}{}}{{{f{b{d{c}}}}Ad}{{B`{{f{bn}}}}}{}}{{{f{b{d{c}}}}{f{bc}}}h{}}0{{{f{bAj}}{f{b{Ah{c}}}}{f{bc}}}h{}}0{{}Al}02000110{ce{}{}}00000{{{Bj{}{{Bh{c}}}}}{{l{c}}}{}}{{{f{b{d{c}}}}{f{bc}}AdBl{B`{Bn}}{B`{C`}}Af}h{}}`{{{f{b{d{c}}}}Cb}h{}}{{}{{A`{c}}}{}}{{ne}CdCf{{Cj{}{{Ch{c}}}}Cl}}{{{f{b{Ah{c}}}}ng}h{}{{Cn{c}}}{{Cj{{f{bc}}}{{Ch{e}}}}}}{{{f{b{d{c}}}}{f{bc}}AdD`DbAf}Af{}}{{{f{b{d{c}}}}{f{bc}}AdD`}h{}}{{{f{b{d{c}}}}{f{bc}}AdD`Dd}Af{}}{{{f{b{d{c}}}}{f{bc}}AdD`Df}h{}}{{{f{b{Ah{c}}}}}h{}}>0{{{f{b{d{c}}}}Ad}h{}}{{{A`{c}}e}{{A`{c}}}{}{{Bf{Dh}}}}{{{f{b{d{c}}}}}{{`{{Dn{}{{Dj{{Dl{c}}}}}}}}}{}}{{{A`{c}}E`}{{A`{c}}}{}}{c{{Eb{e}}}{}{}}00000000000{{{f{c}}}Ed{}}00000{{{f{b{d{c}}}}Ad}Af{}}{{{A`{c}}ni}{{A`{c}}}{}{}{}{{Bj{eg}{{Bh{c}}}}}}{{{f{b{d{c}}}}{f{bc}}Ad{f{Bb}}}Af{}}{{{f{b{d{c}}}}{f{bc}}AdAf}h{}}{{{f{b{d{c}}}}{f{bc}}AdEfEf}h{}}{{{f{b{d{c}}}}{f{bc}}AdEh}h{}}","D":"In","p":[[0,"mut"],[5,"App",0,135],[1,"reference"],[1,"unit"],[10,"Any",136],[8,"UiBuilder",0],[5,"Window",137],[5,"AppBuilder",0,138],[5,"CommandWaker",139],[5,"WindowId",137],[1,"bool"],[5,"DelegateCx",0,140],[10,"AppDelegate",0,140],[1,"usize"],[5,"WindowRenderState",0,135],[6,"Option",141],[6,"Event",142],[6,"FontSource",143],[10,"Into",144],[17,"Data"],[10,"IntoUiBuilder",0],[6,"Key",145],[6,"Code",145],[5,"String",146],[5,"Modifiers",147],[6,"AppCommand",0,148],[10,"View",149],[17,"Output"],[10,"FnMut",150],[10,"Send",151],[10,"AnyView",152],[5,"PointerId",153],[6,"PointerButton",153],[5,"Point",154],[5,"Vector",155],[5,"Styles",156],[17,"Item"],[6,"AppRequest",0,157],[10,"Iterator",158],[5,"Theme",159],[6,"Result",160],[5,"TypeId",136],[1,"u32"],[1,"f32"]],"r":[[0,135],[1,138],[2,148],[3,140],[4,157],[8,140],[19,135]],"b":[],"c":"OjAAAAAAAAA=","e":"OzAAAAEAADgACAAXAAsAKQAAACsADQA6AAUATwABAFIAAgBXAAAAcAARAA=="}],\
-["ori_core",{"t":"CCCCCQQQCCECCQCCCCQQCQGTTPGFFPTFPPPFPPFFGGPPFPPPGPTPPPTFPPPPPFFPGPPTPPGPPPPFPGGTTTTTONNNNNONNNONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNHNNHNHNHNHNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNONNNNNNNONNNNNNNNNNNNHNHNHNHNHNHNHNHNNNNNNNNNNONNNHNHNNONNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOFKNNNNNNNNNMNNNNMNNNFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFFFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNPPPPPPPPPPPPPPPPPPPPPPFPGPPPPPPPPPPPPPPPPPPPPPPPGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFPPKPPPPPPGPPPPPPPPPPFPFPPPPPPPPPPPFPPPPPPPPPPPPPPPPPPPPPPPPPGFFPFPFPFPFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFPFPFPPPPPPONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOONNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNOOOOOOOOOOOOOOOOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOPFPFFGFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFGFGTTTTPPPPSTTPPTTTGFTFTTTTTTFFTFFFPPPPPPTTTTTFPTTTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNONNNOONNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOKYMTTTTTPTTTTTTTTTTTTTTTTTTFPGFFPTTOONNNNNNNNNNNNNNNNNNNNNNHOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNHNNNOOOQOONNNNNNNNNNNNNNNNHOFTTTPPPPPTTPPPPPFGGGGFFPTTTTPTPPPPPPTTPPPPPTGFFGTPPPNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOPGPFNNNNNNNNNNNNNNNNNNNNNOHNONNNNNNNNNNNNNHNNNNNNNNNNTTIKITTTTTTTTTTFFFFRRFKFFKFNNHMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNMNNNNNNNNNMNMNMNMNMNNNNNNNNMNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNMNMNNNNNNNNNNNNNNHNNNNNMMNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTFFFTTTTTTTTTTTTTTTTTTTTTTTTTTFFFTTTTTTTFFPGFFFFFFFFTFFTTTTTTTTTTTTTTTTFFFTTTTTTTTTITFFTTTFFPFPTTTTFFFFFFTTTTFFFFFFFFTTTTTFFFFNNOOHNNNNOOOOOOOOONOONOHONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNOOOOHNNNNOOOOOOOOOONONNNNNNOOOOOOOOOOOOOONNNNNOOOOOOOOOOOOOONNNNNNOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNOOHHNOHNNNNNNNNHNNNNNNOOOOOOOOOOOOOOOHNOHHNOOOOOOOOOOOOOOOOOOOOOONNNNOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHNNOOHONNHNNOOOOOONNOOOOOONNOOOOOONNOOOOOONNOOOOOOQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONOHNNNNNHHQQHHHQQHHNOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNOONOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNOONOONNOOOOOONNOOHNHNHNHHNHNHNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHNOHHNNNOOONOHHHNOHNOHHHHHNOOOOOHNONOONNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHHHHNOHHNNNOOOOOHNOOONOOONNNNNNNNNNHHNNOOOQHONNHHHHHOHNNNOOOOOOOOHHHHHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNHHQQHHHQQHHHNNOOOONNHHHHHHHNNOOOOOOHQQPPPPPPPPPPGPPPPPPPPPPPPPPPPPPPPPFPPPPPPPPPPPPPPPFFGFGPPNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONOONNNNNNNNNNNNNNNNNNNNOONNNNNNNNONNNNNNOONOONOONONNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOON","n":["canvas","clipboard","command","context","event","format_text","hstack","hwrap","image","layout","log","rebuild","style","style","text","transition","view","views","vstack","vwrap","window","zstack","AntiAlias","BLACK","BLUE","Bevel","BlendMode","BorderRadius","BorderWidth","Butt","CYAN","Canvas","Clear","Close","Close","Color","Cubic","Cubic","Curve","CurveIter","CurveSegment","CurveVerb","Destination","DestinationOver","DisplayHex","EvenOdd","Fast","Fill","FillRule","Full","GREEN","Layer","Line","Line","MAGENTA","Mask","Miter","Move","Move","NonZero","None","Paint","Pattern","Pattern","Primitive","Quad","Quad","RED","Round","Round","Shader","Solid","Source","SourceOver","Square","Stroke","Stroke","StrokeCap","StrokeJoin","TRANSPARENT","WHITE","YELLOW","ZERO","ZERO","a","a8","add","add_assign","all","all","anti_alias","as_ref","as_str","as_str_with_alpha","b","b8","blend","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom_left","bottom_right","bounds","cap","circle","clear","clear","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","close","color","conic_to","contains","count","cubic_to","curve","darken","default","default","default","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","desaturate","draw_canvas","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","ellipse","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","fade","fill","fill","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","g","g8","grayscale","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hex","hex","hoverable","hsl","hsl","hsla","hsla","hsv","hsv","hsva","hsva","image","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into_iter","into_iter","is_closed","is_empty","is_translucent","is_transparent","is_valid","iter","join","last_point","layer","left","len","lighten","line_to","luminocity","masked","max_element","min_element","miter","mix","mix_rgb","move_to","mul","mul","new","new","new","new","new","new","next","okhsl","okhsl","okhsla","okhsla","okhsv","okhsv","okhsva","okhsva","oklab","oklab","oklaba","oklaba","oklch","oklch","oklcha","oklcha","overlay","points","points","primitives","push_oval","push_rect","push_rect_with_borders","push_rect_with_radius","quad_to","r","r8","rect","rect","rgb","rgb","rgba","rgba","rgba8","right","rotated","saturate","scaled","shader","size_hint","stroke","stroke_curve","to_hex","to_hsl","to_hsla","to_hsv","to_hsva","to_okhsl","to_okhsla","to_okhsv","to_okhsva","to_oklab","to_oklaba","to_oklch","to_oklcha","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_rgba8","to_smolstr","to_smolstr","to_srgb","to_string","to_string","top","top_left","top_right","transform","transform","transformed","translated","trigger","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_hex","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","verbs","view_at","width","curve","curve","fill","mask","paint","paint","primitives","stroke","transform","view","Clipboard","ClipboardBackend","borrow","borrow_mut","default","deref","deref_mut","drop","fmt","from","get","get_text","init","into","new","set","set_text","try_from","try_into","type_id","Command","CommandProxy","CommandReceiver","CommandWaker","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","cmd","cmd_async","cmd_silent","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","fmt","fmt","fmt","fmt","from","from","from","from","from","get","init","init","init","init","into","into","into","into","is","name","new","new","new","spawn_async","to_any","to_owned","to_owned","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_recv","type_id","type_id","type_id","type_id","wake","wake","BaseCx","BuildCx","Contexts","DrawCx","EventCx","LayoutCx","RebuildCx","active_changed","animate","animate","animate","as_build_cx","as_build_cx","as_layout_cx","as_rebuild_cx","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","canvas","child","child","child","child","child","clipboard","cmd","cmd_async","contains","contains_context","contains_property","contains_property","contains_property","contains_property","contains_property","context","context_mut","context_or_default","contexts","contexts_mut","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","draw","draw","draw","draw_canvas","drop","drop","drop","drop","drop","drop","drop","fill","fill_rect","fmt","focused_changed","fonts","from","from","from","from","from","from","from","get","get_context","get_context_mut","get_mut","get_or_default","get_property","get_property","get_property","get_property","get_property","get_property_mut","get_property_mut","get_property_mut","get_property_mut","get_property_mut","had_active","had_focused","had_hot","has_active","has_active","has_active","has_active","has_active","has_active_changed","has_focused","has_focused","has_focused","has_focused","has_focused","has_focused_changed","has_hot","has_hot","has_hot","has_hot","has_hot","has_hot_changed","hot_changed","hoverable","id","id","id","id","id","init","init","init","init","init","init","init","insert","insert_context","insert_property","insert_property","insert_property","insert_property","insert_property","into","into","into","into","into","into","into","is_active","is_active","is_active","is_active","is_active","is_empty","is_focused","is_focused","is_focused","is_focused","is_focused","is_hot","is_hot","is_hot","is_hot","is_hot","is_visible","layout","layout","layout","len","local","masked","new","new","new","new","new","new","new","overlay","prepare_text","prepare_text_raw","property_or","property_or","property_or","property_or","property_or","property_or_default","property_or_default","property_or_default","property_or_default","property_or_default","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","proxy","quad","rebuild","rect","rect","rect","remove","remove_context","remove_property","remove_property","remove_property","remove_property","remove_property","rotated","scaled","set_active","set_active","set_active","set_cursor","set_cursor","set_cursor","set_focused","set_focused","set_focused","set_hot","set_hot","set_hot","set_ime","size","size","size","spawn_async","stroke","styles","styles","styles","styles","styles","text","text_raw","transform","transform","transformed","translated","trigger","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","was_active","was_focused","was_hot","window","window","window","window","window","window_mut","window_mut","window_mut","window_mut","window_mut","A","Accept","Again","Alphanumeric","Alt","AltGraph","Animate","Apostrophe","B","Back","Backslash","Backspace","Backspace","Backtick","BracketLeft","BracketRight","C","Cancel","CapsLock","CapsLock","Character","Clear","CloseRequested","CloseRequested","Code","CodeInput","Comma","Command","Compose","Control","Convert","Copy","Cut","D","Dead","Delete","Delete","Down","Down","E","Eisu","End","End","Enter","Enter","Equal","Escape","Escape","Event","Execute","F","F1","F1","F10","F10","F11","F11","F12","F12","F13","F14","F15","F16","F17","F18","F19","F2","F2","F20","F21","F22","F23","F24","F3","F3","F4","F4","F5","F5","F6","F6","F7","F7","F8","F8","F9","F9","Find","Fn","FnLock","Forward","G","H","HangulMode","HanjaMode","Hankaku","Help","Hiragana","HiraganaKatakana","Home","Home","Hyper","I","Ime","Insert","Insert","IsKey","J","JunjaMode","K","KanaMode","KanjiMode","Katakana","Key","Key0","Key1","Key2","Key3","Key4","Key5","Key6","Key7","Key8","Key9","KeyPressed","KeyPressed","KeyReleased","KeyReleased","L","LAlt","LCtrl","LMeta","LShift","Left","Left","M","Meta","Minus","Modifiers","N","NumLock","NumLock","NumStar","Numpad0","Numpad1","Numpad2","Numpad3","Numpad4","Numpad5","Numpad6","Numpad7","Numpad8","Numpad9","O","Other","P","PageDown","PageDown","PageUp","PageUp","Paste","Pause","Period","Play","PointerButton","PointerId","PointerLeft","PointerLeft","PointerMoved","PointerMoved","PointerPressed","PointerPressed","PointerReleased","PointerReleased","PointerScrolled","PointerScrolled","Primary","PrintScreen","Q","R","RAlt","RCtrl","RMeta","RShift","Redo","Right","Right","Romaji","S","ScrollLock","ScrollLock","Secondary","Select","Semicolon","Shift","Slash","Space","Space","Super","Symbol","SymbolLock","T","Tab","Tab","Tertiary","U","Undo","Unidentified","Up","Up","Update","V","W","WindowMaximized","WindowMaximized","WindowResized","WindowResized","WindowScaled","WindowScaled","X","Y","Z","Zenkaku","ZenkakuHankaku","alt","any","as_char","as_u64","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","button","button","clicked","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmd","code","code","compose","ctrl","default","default","delta","delta","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from_hash","from_linux_scancode","from_u16","from_u64","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","height","id","id","id","id","id","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","is","is","is","is_cmd","is_key","is_key","is_key_pressed","is_key_released","key","key","maximized","meta","modifiers","modifiers","modifiers","modifiers","modifiers","modifiers","position","position","position","position","scale_factor","selection","shift","size","text","text","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","width","window","window","window","window","Backend","Image","Image","ImageData","ImageId","Texture","TextureId","WeakImage","as_any","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","build","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","color","compute_id","data","data_mut","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","downgrade","draw","drop","drop","drop","drop","drop","drop","dyn_build","dyn_draw","dyn_event","dyn_layout","dyn_rebuild","eq","eq","eq","eq","eq","eq","event","filter","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","from","from_index","get_pixel","hash","hash","hash","hash","hash","height","id","id","init","init","init","init","init","init","into","into","into","into","into","into","layout","modify","multiply_alpha","new","new","new","premultiplied","rebuild","set_filter","set_pixel","size","strong_count","to_index","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","weak_count","width","Affine","Align","Alignment","Axis","BOTTOM","BOTTOM_LEFT","BOTTOM_RIGHT","CENTER","Center","Center","End","End","FILL","FILL","FILL","Fill","Horizontal","IDENTITY","IDENTITY","INFINITY","Justify","JustifyIterator","LEFT","Matrix","NEG_X","NEG_X","NEG_Y","NEG_Y","ONE","ONE","Padding","Point","RIGHT","Rect","Size","Space","SpaceAround","SpaceBetween","SpaceEvenly","Start","Start","Stretch","TOP","TOP_LEFT","TOP_RIGHT","UNBOUNDED","UNBOUNDED","Vector","Vertical","X","X","Y","Y","ZERO","ZERO","ZERO","ZERO","ZERO","add","add","add","add","add","add","add","add","add","add","add","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","align","align","all","all","all","all","angle","angle_between","area","bitand","bitand","bitand_assign","bitand_assign","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom","bottom_center","bottom_left","bottom_right","ceil","ceil","ceil","center","center_left","center_right","center_size","clamp","clamp","clamp","clamp","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","constrain","contain","contains","cross","default","default","default","default","default","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","determinant","distance","div","div","div","div","div","div","div","div","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","dot","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","expand","finite_or_zero","fit","floor","floor","floor","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fract","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from_angle","from_angle","from_scale","from_size","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hat","height","height","include","inflate","init","init","init","init","init","init","init","init","init","init","init","init","init","intersection","intersects","into","into","into","into","into","into","into","into","into","into","into","into","into","into_iter","inverse","inverse","is_finite","is_finite","is_finite","is_infinite","is_infinite","is_infinite","is_nan","layout","left","left","length","length_squared","lerp","loosen","loosen_height","loosen_width","major","matrix","max","max","max","max","max","max_element","max_size","min","min","min","min","min","min_element","min_size","minor","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","neg","neg","new","new","new","new","new","new","new","new","next","normalize","offset","offset","pack","pt","rem","rem","rem","rem","rem","rem","rem","rem","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","right","right","rotate","round","round","round","round","round","scale","shrink","shrink","signum","size","size","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_point","to_point","to_size","to_size","to_smolstr","to_smolstr","to_smolstr","to_string","to_string","to_string","to_vector","to_vector","top","top","top_center","top_left","top_right","transform","translate","translation","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_intersection","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","union","unpack","width","width","x","x","x","x","y","y","y","y","Rebuild","Rebuild","rebuild","ACCENT","ACCENT_LOW","BACKGROUND","CONTRAST","CONTRAST_LOW","Computed","DANGER","DANGER_LOW","INFO","INFO_LOW","OUTLINE","OUTLINE_LOW","PRIMARY","PRIMARY_LOW","SECONDARY","SECONDARY_LOW","SUCCESS","SUCCESS_LOW","SURFACE","SURFACE_HIGH","SURFACE_HIGHER","SURFACE_HIGHEST","SURFACE_LOW","SURFACE_LOWER","Style","Style","Styled","Styles","Theme","Value","WARNING","WARNING_LOW","accent","background","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","comp","contrast","danger","dark","default","default","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","extend","fmt","fmt","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","get","get","get_or","get_or","get_or_else","get_or_else","info","init","init","init","init","insert","insert_style","insert_style_keys","insert_value","into","into","into","into","key","light","new","new","outline","primary","secondary","style","success","surface","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","val","warning","AtlasGlyph","BLACK","BOLD","Bottom","Bundle","Center","Condensed","Cursive","Data","EXTRA_BOLD","EXTRA_LIGHT","End","Expanded","ExtraCondensed","ExtraExpanded","Fantasy","FontAtlas","FontFamily","FontSource","FontStretch","FontStyle","FontWeight","Fonts","Italic","LIGHT","Left","MEDIUM","Middle","Monospace","NORMAL","Name","None","Normal","Normal","Oblique","Path","Right","SEMI_BOLD","SansSerif","SemiCondensed","SemiExpanded","Serif","Start","THIN","TextAlign","TextAttributes","TextBuffer","TextWrap","Top","UltraCondensed","UltraExpanded","Word","as_fontdb","as_mut","as_ref","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bounds","buffer_size","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","curve_cache","default","default","default","default","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","draw_buffer","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","eq","eq","family","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","font_atlas","font_system","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from_raw","hash","hash","hash","hash","hash","hash","image","include_font","init","init","init","init","init","init","init","init","init","init","init","init","insert","into","into","into","into","into","into","into","into","into","into","into","into","layout","load_font","new","new","new","prepare_buffer","raw","raw_mut","rect","set_align","set_bounds","set_metrics","set_text","set_wrap","size","stretch","style","swash_cache","to_cosmic_text","to_cosmic_text","to_cosmic_text","to_fontdb","to_fontdb","to_fontdb","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","uv","weight","Ease","Easing","Linear","Transition","borrow","borrow","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","complete","default","default","deref","deref","deref_mut","deref_mut","drop","drop","duration","ease","ease","easing","eq","eq","evaluate","fmt","fmt","from","from","get","hash","init","init","into","into","linear","linear","step","to_owned","to_owned","try_from","try_from","try_into","try_into","type_id","type_id","ACTIVE","ANIMATE","AnyState","AnyView","BoxedView","DRAW","FOCUSABLE","FOCUSED","HAS","HAS_ACTIVE","HAS_FOCUSED","HAS_HOT","HOT","IS","LAYOUT","Pod","PodSeq","SeqState","State","State","State","Update","View","ViewFlags","ViewId","ViewSeq","ViewState","all","all","any","as_any","as_any","as_u64","bitand","bitand","bitand_assign","bitand_assign","bitor","bitor","bitor_assign","bitor_assign","bits","bits","bits","bits","bitxor","bitxor","bitxor_assign","bitxor_assign","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","build","build","build","build","build","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmp","complement","complement","contains","contains","contains_property","cursor","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","difference","difference","draw","draw","draw","draw_nth","draw_nth","drop","drop","drop","drop","drop","drop","drop","drop","dyn_build","dyn_build","dyn_draw","dyn_draw","dyn_event","dyn_event","dyn_layout","dyn_layout","dyn_rebuild","dyn_rebuild","empty","empty","eq","eq","eq","eq","eq","event","event","event","event_nth","event_nth","extend","extend","flags","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","from","from","from","from","from_bits","from_bits","from_bits_retain","from_bits_retain","from_bits_retain","from_bits_retain","from_bits_truncate","from_bits_truncate","from_iter","from_iter","from_name","from_name","get_property","get_property_mut","has_active","has_active","has_focused","has_hot","hash","hash","hash","hash","hash","id","ime","init","init","init","init","init","init","init","init","insert","insert","insert_property","intersection","intersection","intersects","intersects","into","into","into","into","into","into","into","into","into_iter","into_iter","is_active","is_all","is_all","is_empty","is_empty","is_empty","is_focusable","is_focused","is_hot","iter","iter","iter_names","iter_names","layout","layout","layout","layout_nth","layout_nth","len","len","mark_animated","mark_drawn","mark_layed_out","needs_animate","needs_draw","needs_layout","new","new","new","new","not","not","partial_cmp","pod","prepare","propagate","property_or","property_or_default","property_or_insert_with","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild_nth","rebuild_nth","rect","remove","remove","remove_property","request_animate","request_draw","request_layout","set","set","set_active","set_cursor","set_focusable","set_focused","set_hot","set_ime","set_size","set_transform","size","sub","sub","sub_assign","sub_assign","symmetric_difference","symmetric_difference","to_owned","to_owned","to_owned","to_owned","to_owned","to_smolstr","to_string","toggle","toggle","transform","translate","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","union","union","update","ALIGN","ALIGN","ALIGN","ALPHA_COLOR","Aligned","Animate","Aspect","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BuildHandler","Button","ButtonStyle","COLOR","COLOR","COLOR","COLOR","COLOR","COLOR","COLOR","Checkbox","CheckboxStyle","Click","ClickEvent","Clickable","Collapsing","CollapsingStyle","ColorPicker","ColorPickerStyle","Constrain","Container","ContainerStyle","DELAY","DrawHandler","EventHandler","FANCY","FONT_FAMILY","FONT_FAMILY","FONT_FAMILY","FONT_SIZE","FONT_SIZE","FONT_SIZE","FONT_STRETCH","FONT_STRETCH","FONT_STRETCH","FONT_STYLE","FONT_STYLE","FONT_STYLE","FONT_WEIGHT","FONT_WEIGHT","FONT_WEIGHT","Flex","Flexible","Focus","ICON_COLOR","ICON_SIZE","INSET","KNOB_COLOR","LENGTH","LIGHTNESS_COLOR","LINE_HEIGHT","LINE_HEIGHT","LINE_HEIGHT","Lens","MASK","Memo","Opaque","PADDING","PADDING","PLACEHOLDER_COLOR","Pad","Painter","Press","RebuildHandler","Release","SIZE","SIZE","SLIDER_WIDTH","STROKE","Scroll","ScrollStyle","Slider","SliderStyle","Stack","Suspense","TRANSITION","TRANSITION","TRANSITION","TRANSITION","Text","TextInput","TextInputStyle","TextStyle","Tooltip","TooltipStyle","Transform","Trigger","WIDTH","WIDTH","WRAP","WRAP","WRAP","WithState","WithStyle","Wrap","ZStack","after","after","after","after","align","align","align","align","align","align","align","align","align","align","align","align","align","alignment","alpha_color","alpha_color","alpha_color","amount","amount","animate","animate","any","any","any_horizontal","any_vertical","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","aspect","axis","axis","axis","axis","axis","axis","axis","background","background","background","background","background","background","background","background","background","background","background","background","background","background","background","before","before","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom_left","bottom_right","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","button","button","button","callback","center","checkbox","checked","checked","circle","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","collapsing","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color_picker","column_gap","column_gap","constrain","container","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","default","default","default","default_open","default_open","delay","delay","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","descendants","descendants","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","ellipse","eq","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","expand","fallback","fancy","fancy","fancy","flex","flex","fmt","fmt","focus","font_family","font_family","font_family","font_family","font_family","font_family","font_family","font_family","font_size","font_size","font_size","font_size","font_size","font_size","font_size","font_size","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_style","font_style","font_style","font_style","font_style","font_style","font_style","font_style","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","format_text","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","gap","gap","gap","hash","header","height","height","horizontal","horizontal","horizontal_any","horizontal_vec","hscroll","hstack","hstack","hstack","hstack_any","hstack_vec","hwrap","hwrap","hwrap","hwrap_any","hwrap_vec","icon_color","icon_color","icon_color","icon_size","icon_size","icon_size","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","inset","inset","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","is_empty","is_empty","is_tight","justify","justify","justify","justify","justify_cross","justify_cross","knob_color","knob_color","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","left","len","len","length","length","length","lightness_color","lightness_color","lightness_color","line_height","line_height","line_height","line_height","line_height","line_height","line_height","line_height","marker","mask","mask","mask","max_height","max_height","max_size","max_size","max_width","max_width","memo","min_height","min_height","min_size","min_size","min_width","min_width","multiline","multiline","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","on_build","on_click","on_draw","on_draw","on_draw","on_event","on_event_before","on_input","on_input","on_input","on_input","on_input","on_input","on_open","on_open","on_press","on_rebuild","on_release","on_submit","on_submit","opaque","open","open","pad","pad_bottom","pad_left","pad_right","pad_top","padding","padding","padding","padding","padding","padding","painter","placeholder","placeholder","placeholder_color","placeholder_color","placeholder_color","push","push","range","range","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rect","right","rotate","rotate_degrees","row_gap","row_gap","scale","size","size","size","size","size","size","size","size","size","slider","slider_width","slider_width","slider_width","space","stroke","stroke","stroke","style","styled","styled","styled","styled","styled","styled","styled","styled","styled","styled","suspense","text","text","text","text","text","text","text","text_input","tight","to_owned","to_owned","tooltip","top","top_left","top_right","transform","transform","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition_active","transition_focused","transition_hot","translate","trigger","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","unbounded","value","value","vec","vec","vec_horizontal","vec_vertical","vertical","vertical","vertical_any","vertical_vec","vscroll","vstack","vstack","vstack","vstack_any","vstack_vec","vwrap","vwrap","vwrap","vwrap_any","vwrap_vec","width","width","width","width","width","width","width","with","with","with_data","with_data_default","with_state","with_state_default","with_style","without_data","without_state","wrap","wrap","wrap","wrap","wrap","wrap","wrap","wrap","zstack","zstack","zstack","Alias","AllScroll","Arrow","Cell","ColResize","Color","Content","ContextMenu","Copy","Crosshair","Cursor","Cursor","Decorated","Default","EResize","EwResize","Fixed","Grab","Grabbing","Help","Icon","Ime","Maximized","Move","NResize","NeResize","NeswResize","NoDrop","NotAllowed","NsResize","NwResize","NwseResize","Pointer","Pointer","Progress","Resizable","RowResize","SResize","Scale","SeResize","Size","SwResize","Text","Title","VerticalText","Visible","WResize","Wait","Window","WindowId","WindowSizing","WindowSnapshot","WindowUpdate","ZoomIn","ZoomOut","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","color","color","color","decorated","decorated","decorated","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","difference","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","fit_content","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","get_pointer","get_pointer_mut","hash","hash","height","hovering","icon","icon","icon","id","id","init","init","init","init","init","init","init","into","into","into","into","into","into","into","is_hovered","is_pointer_held","is_pressed","maximized","maximized","maximized","move_pointer","name","new","new","new","physical_size","pointers","pointers_mut","position","press","press_pointer","release","release_pointer","remove_pointer","resizable","resizable","resizable","scale","scale","scale","size","size","size","sizing","sizing","snapshot","title","title","title","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_smolstr","to_string","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","updates","visible","visible","visible","width"],"q":[[0,"ori_core"],[22,"ori_core::canvas"],[624,"ori_core::canvas::Primitive"],[634,"ori_core::clipboard"],[654,"ori_core::command"],[729,"ori_core::context"],[1018,"ori_core::event"],[1623,"ori_core::image"],[1785,"ori_core::layout"],[2370,"ori_core::rebuild"],[2373,"ori_core::style"],[2531,"ori_core::text"],[2838,"ori_core::transition"],[2891,"ori_core::view"],[3241,"ori_core::views"],[4782,"ori_core::window"],[5023,"ori_core::canvas::color"],[5024,"ori_core::canvas::border"],[5025,"ori_core::canvas::curve"],[5026,"ori_core::layout::rect"],[5027,"ori_core::layout::point"],[5028,"ori_core::canvas::canvas"],[5029,"ori_core::canvas::stroke"],[5030,"alloc::sync"],[5031,"core::convert"],[5032,"core::fmt"],[5033,"ori_core::image::image"],[5034,"core::hash"],[5035,"ori_core::view::state"],[5036,"core::ops::function"],[5037,"core::option"],[5038,"ori_core::layout::affine"],[5039,"core::iter::traits::iterator"],[5040,"ori_core::layout::vector"],[5041,"smol_str"],[5042,"alloc::string"],[5043,"core::result"],[5044,"core::any"],[5045,"alloc::boxed"],[5046,"core::marker"],[5047,"core::future::future"],[5048,"ori_core::context::event"],[5049,"ori_core::context::build"],[5050,"ori_core::context::rebuild"],[5051,"ori_core::context::layout"],[5052,"ori_core::context::draw"],[5053,"ori_core::context::base"],[5054,"ori_core::context::contexts"],[5055,"core::default"],[5056,"ori_core::text::fonts"],[5057,"ori_core::text::buffer"],[5058,"cosmic_text::buffer"],[5059,"ori_core::window::cursor"],[5060,"ori_core::event::ime"],[5061,"ori_core::layout::size"],[5062,"ori_core::style::style"],[5063,"ori_core::window::window"],[5064,"ori_core::event::modifiers"],[5065,"ori_core::event::keyboard"],[5066,"ori_core::event::pointer"],[5067,"ori_core::event::window"],[5068,"ori_core::event::event"],[5069,"ori_core::image::data"],[5070,"ori_core::image::texture"],[5071,"ori_core::layout::space"],[5072,"ori_core::view::any"],[5073,"alloc::vec"],[5074,"ori_core::layout::alignment"],[5075,"ori_core::layout::justify"],[5076,"ori_core::layout::padding"],[5077,"ori_core::layout::axis"],[5078,"ori_core::layout::matrix"],[5079,"ori_core::style::palette"],[5080,"core::clone"],[5081,"ori_core::views::text_input"],[5082,"ori_core::views::color_picker"],[5083,"ori_core::views::text"],[5084,"ori_core::views::collapsing"],[5085,"ori_core::views::scroll"],[5086,"ori_core::views::checkbox"],[5087,"ori_core::views::slider"],[5088,"ori_core::views::tooltip"],[5089,"ori_core::views::button"],[5090,"ori_core::views::container"],[5091,"ori_core::text::attributes"],[5092,"fontdb"],[5093,"ori_core::text::atlas"],[5094,"ori_core::text::source"],[5095,"std::path"],[5096,"cosmic_text::font::system"],[5097,"cosmic_text::swash"],[5098,"cosmic_text::glyph_cache"],[5099,"std::io::error"],[5100,"cosmic_text::layout"],[5101,"cosmic_text::attrs"],[5102,"ttf_parser::tables::os2"],[5103,"ori_core::view::sequence"],[5104,"ori_core::view::view"],[5105,"ori_core::view::pod"],[5106,"core::cmp"],[5107,"core::iter::traits::collect"],[5108,"bitflags::iter"],[5109,"ori_core::views::build_handler"],[5110,"ori_core::views::event_handler"],[5111,"ori_core::views::aligned"],[5112,"ori_core::views::stack"],[5113,"ori_core::views::wrap"],[5114,"ori_core::views::flex"],[5115,"ori_core::views::animate"],[5116,"ori_core::views::draw_handler"],[5117,"ori_core::views::focus"],[5118,"ori_core::views::memorize"],[5119,"ori_core::views::opaque"],[5120,"ori_core::views::rebuild_handler"],[5121,"ori_core::views::suspense"],[5122,"ori_core::views::trigger"],[5123,"ori_core::views::with_state"],[5124,"ori_core::views::with_style"],[5125,"ori_core::views::aspect"],[5126,"ori_core::views::clickable"],[5127,"ori_core::views::constrain"],[5128,"ori_core::views::pad"],[5129,"ori_core::views::painter"],[5130,"ori_core::views::transform"],[5131,"ori_core::views::zstack"],[5132,"core::ops::range"],[5133,"ori_core::window::pointer"],[5134,"ori_macro"]],"i":[0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,1,26,0,0,0,25,1,0,17,23,24,0,23,24,0,0,0,0,17,17,0,20,18,22,0,18,1,22,23,24,1,0,26,23,24,20,18,0,0,16,0,23,24,1,25,26,0,16,17,17,25,0,22,0,0,1,1,1,7,8,1,1,1,1,7,8,19,9,9,9,1,1,19,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,8,7,7,11,27,11,14,11,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,7,7,8,8,15,16,17,17,18,18,19,20,20,21,22,14,1,1,9,9,23,23,11,24,24,25,25,26,26,27,27,11,15,11,11,22,11,21,1,7,8,19,14,1,11,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,9,23,11,24,25,26,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,1,14,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,11,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,1,14,21,7,8,15,16,17,18,19,20,21,22,14,1,1,9,9,23,11,24,25,26,27,41,7,7,7,7,8,8,8,8,8,8,15,15,16,17,18,19,19,19,19,20,21,21,22,14,1,1,1,9,23,11,11,24,25,26,27,27,1,1,1,15,16,17,18,19,20,1,23,11,25,26,27,0,1,14,0,1,0,1,0,1,0,1,15,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,41,11,11,11,1,1,11,11,27,11,14,8,11,1,11,1,14,7,7,27,1,1,11,1,1,7,8,21,14,9,11,41,0,1,0,1,0,1,0,1,0,1,0,1,0,1,0,1,14,23,11,14,11,11,11,11,11,1,1,14,11,0,1,0,1,1,8,14,1,14,19,41,14,11,1,1,1,1,1,1,1,1,1,1,1,1,1,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,1,1,9,1,1,9,8,7,7,11,15,14,14,14,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,1,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,11,14,27,228,229,228,230,228,229,230,229,230,230,0,0,53,53,53,53,53,53,53,53,53,54,53,53,53,53,54,53,53,53,0,0,0,0,62,63,57,58,62,63,57,58,57,58,57,58,57,58,58,58,58,62,63,57,58,62,63,57,58,62,63,57,58,62,63,57,58,62,63,57,57,58,62,62,63,57,58,62,63,57,58,62,62,62,57,58,58,62,57,58,62,63,57,58,62,63,57,58,63,62,63,57,58,57,58,0,0,0,0,0,0,0,66,67,66,68,66,68,68,66,71,67,70,66,69,68,72,71,67,70,66,69,68,72,70,67,70,66,69,68,71,71,71,72,71,67,70,66,69,68,71,71,71,71,71,72,71,67,67,70,70,66,66,69,69,68,68,72,71,67,67,70,70,66,66,69,69,68,68,72,67,66,68,70,71,67,70,66,69,68,72,70,70,72,66,71,71,67,70,66,69,68,72,72,71,71,72,72,67,70,66,69,68,67,70,66,69,68,66,66,66,67,70,66,69,68,66,67,70,66,69,68,66,67,70,66,69,68,66,66,70,67,70,66,69,68,71,67,70,66,69,68,72,72,71,67,70,66,69,68,71,67,70,66,69,68,72,67,70,66,69,68,72,67,70,66,69,68,67,70,66,69,68,70,67,66,68,72,66,70,71,67,70,66,69,68,72,70,69,69,67,70,66,69,68,67,70,66,69,68,67,70,66,69,68,71,70,66,70,66,68,72,71,67,70,66,69,68,70,70,67,66,68,67,66,68,67,66,68,67,66,68,66,70,66,68,71,70,67,70,66,69,68,70,70,70,66,70,70,70,71,67,70,66,69,68,72,71,67,70,66,69,68,72,71,67,70,66,69,68,72,66,66,66,67,70,66,69,68,67,70,66,69,68,90,84,84,84,84,84,101,90,90,91,90,84,90,90,90,90,90,84,84,90,84,84,0,101,0,84,90,101,84,84,84,84,84,90,84,84,90,84,90,90,84,84,90,84,90,90,84,90,0,84,90,84,90,84,90,84,90,84,90,84,84,84,84,84,84,84,84,90,84,84,84,84,84,84,90,84,90,84,90,84,90,84,90,84,90,84,90,84,84,84,91,90,90,84,84,84,84,84,84,84,90,84,90,0,84,90,0,90,84,90,84,84,84,0,90,90,90,90,90,90,90,90,90,90,0,101,0,101,90,90,90,90,90,84,90,90,84,90,0,90,84,90,90,90,90,90,90,90,90,90,90,90,90,90,91,90,84,90,84,90,84,84,90,84,0,0,0,101,0,101,0,101,0,101,0,101,91,84,90,90,90,90,90,90,84,84,90,84,90,84,90,91,84,90,84,90,84,90,84,84,84,90,84,90,91,90,84,84,84,90,101,90,90,0,101,0,101,0,101,90,90,90,84,84,83,83,84,86,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,94,95,95,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,79,88,89,84,84,90,90,83,83,86,86,91,91,92,93,94,95,96,97,97,98,98,99,99,100,100,101,88,89,79,83,79,83,92,96,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,79,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,86,90,91,86,79,84,90,83,86,91,92,93,94,95,96,97,98,100,98,92,93,94,95,96,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,104,84,90,101,88,89,101,101,88,89,100,83,88,89,92,94,95,96,92,94,95,96,99,79,83,98,79,88,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,98,97,98,99,100,109,0,109,0,0,0,0,0,36,105,106,36,107,108,109,105,106,36,107,108,109,36,105,106,36,107,108,109,105,106,36,107,108,109,105,106,106,36,107,108,108,109,36,105,105,105,105,36,108,109,105,105,106,36,36,107,108,109,105,105,106,36,107,108,109,36,36,105,106,36,107,108,109,36,36,36,36,36,105,106,36,107,108,109,36,105,105,106,36,107,108,109,105,106,36,36,107,108,109,109,109,108,105,105,106,36,107,108,105,36,107,105,106,36,107,108,109,105,106,36,107,108,109,36,36,36,105,36,108,36,36,105,105,105,107,108,105,106,36,107,108,109,105,106,36,107,108,109,105,106,36,107,108,109,105,106,36,107,108,109,107,105,0,0,0,0,114,114,114,114,115,118,115,118,0,80,110,115,117,43,119,80,0,0,114,0,13,48,13,48,13,48,0,0,114,0,0,0,118,118,118,115,118,115,114,114,114,80,110,0,117,13,48,13,48,13,12,80,110,48,13,13,13,12,12,80,80,80,110,48,48,13,13,13,12,12,80,80,80,110,48,48,114,115,116,13,80,48,48,48,12,12,110,12,110,120,43,114,117,115,118,119,116,13,12,80,110,48,120,43,114,117,115,118,119,116,13,12,80,110,48,12,116,12,12,12,13,80,48,12,12,12,12,13,12,80,48,43,114,117,115,118,119,116,13,12,80,110,48,43,114,117,115,118,119,116,13,12,80,110,48,43,43,114,114,117,117,115,115,118,118,119,119,116,116,13,13,12,12,80,80,110,110,48,48,110,12,12,48,43,114,119,116,13,12,80,110,48,120,43,114,117,115,118,119,116,13,12,80,110,48,120,43,114,117,115,118,119,116,13,12,80,110,48,119,13,13,13,13,80,80,80,48,48,13,13,13,80,80,80,48,48,48,120,43,114,117,115,118,119,116,13,12,80,110,48,43,114,117,115,118,119,116,13,12,80,110,48,110,80,110,13,80,48,43,114,117,115,118,119,116,13,13,12,80,80,110,48,48,13,120,43,114,114,114,117,115,118,119,116,116,116,116,116,116,13,13,13,13,13,13,12,12,12,80,80,80,80,80,80,110,110,48,48,48,48,48,48,119,48,119,110,43,117,115,118,119,13,12,80,110,48,48,12,80,12,12,120,43,114,117,115,118,119,116,13,12,80,110,48,12,12,120,43,114,117,115,118,119,116,13,12,80,110,48,120,43,119,13,80,110,13,80,110,13,118,12,116,48,48,13,110,110,110,117,43,13,80,48,12,110,80,12,13,80,48,12,110,80,12,117,43,43,43,119,119,119,13,13,13,80,80,80,48,48,43,13,13,13,80,80,80,48,48,13,48,114,119,116,13,12,80,110,48,120,48,116,12,117,0,13,13,13,80,80,80,48,48,13,13,13,80,80,80,48,48,12,116,43,43,13,12,80,48,43,12,110,48,116,12,13,13,13,13,12,12,80,80,80,110,48,48,13,13,13,12,12,80,80,80,110,48,48,43,114,117,115,118,119,116,13,12,80,110,48,80,48,13,48,13,80,48,13,80,48,13,80,12,116,12,12,12,12,43,43,120,43,114,117,115,118,119,116,13,12,80,110,48,12,120,43,114,117,115,118,119,116,13,12,80,110,48,120,43,114,117,115,118,119,116,13,12,80,110,48,12,117,12,80,114,119,13,48,114,119,13,48,0,0,122,125,125,125,125,125,126,125,125,125,125,125,125,125,125,125,125,125,125,125,125,125,125,125,125,0,126,0,0,0,126,125,125,125,125,123,125,81,126,123,125,81,126,123,125,81,126,123,125,81,126,123,123,125,125,81,126,0,125,125,125,125,81,123,125,81,126,123,125,81,126,123,125,81,126,81,125,126,123,125,81,81,81,81,81,81,81,81,81,81,81,81,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,81,126,81,126,81,126,125,123,125,81,126,81,81,81,81,123,125,81,126,0,125,123,81,125,125,125,0,125,125,123,125,81,126,123,125,81,126,123,125,81,126,123,125,81,126,0,125,0,143,143,146,149,146,144,139,149,143,143,146,144,144,144,139,0,0,0,0,0,0,0,145,143,146,143,146,139,143,139,147,144,145,145,149,146,143,139,144,144,139,146,143,0,0,0,0,146,144,144,147,139,76,76,150,142,139,143,144,145,146,147,148,76,74,149,150,142,139,143,144,145,146,147,148,76,74,149,76,74,142,139,143,144,145,146,147,148,149,142,139,143,144,145,146,147,148,149,142,142,139,143,143,144,144,145,145,146,146,147,147,148,149,74,139,143,144,145,146,147,148,74,150,142,139,143,144,145,146,147,148,76,74,149,150,142,139,143,144,145,146,147,148,76,74,149,74,150,142,139,143,144,145,146,147,148,76,74,149,139,143,144,145,146,147,148,148,150,142,139,143,144,145,146,147,148,76,74,149,74,74,150,142,139,139,139,139,143,144,145,146,147,148,76,74,149,149,149,149,149,149,76,139,143,144,145,146,147,150,0,150,142,139,143,144,145,146,147,148,76,74,149,150,150,142,139,143,144,145,146,147,148,76,74,149,142,74,150,76,74,74,76,76,76,76,76,76,76,76,76,148,148,74,146,147,148,143,144,145,142,139,143,144,145,146,147,148,149,150,142,139,143,144,145,146,147,148,76,74,149,150,142,139,143,144,145,146,147,148,76,74,149,150,142,139,143,144,145,146,147,148,76,74,149,142,148,163,0,163,0,163,164,163,164,163,164,163,164,163,163,164,164,164,163,164,163,164,163,164,163,164,164,0,164,164,163,164,163,163,164,163,164,164,163,163,164,163,164,0,164,164,163,164,163,164,163,164,163,164,166,165,0,0,0,165,166,166,166,166,166,166,166,166,165,0,0,0,0,168,169,0,0,0,0,0,0,165,166,0,111,171,38,165,166,165,166,165,166,165,166,165,165,166,166,165,166,165,166,175,173,171,172,165,166,38,75,175,173,171,172,165,166,38,75,168,169,170,171,172,171,172,165,166,38,171,172,165,166,38,171,171,172,172,165,165,166,166,38,38,38,165,166,165,166,75,75,165,166,38,75,175,175,173,173,171,171,172,172,165,166,38,75,175,175,173,173,171,171,172,172,165,166,38,75,165,166,169,170,171,168,172,175,173,171,172,165,166,38,75,111,171,111,171,111,171,111,171,111,171,165,166,171,172,165,166,38,169,170,171,168,172,165,166,75,171,172,165,165,165,165,165,166,166,166,166,166,38,38,75,175,173,171,171,171,172,172,172,165,166,38,75,165,166,165,165,166,166,165,166,165,166,165,166,75,75,173,75,75,75,171,172,165,166,38,75,75,175,173,171,172,165,166,38,75,165,166,75,165,166,165,166,175,173,171,172,165,166,38,75,165,166,75,165,166,172,165,166,75,75,75,165,166,165,166,169,170,171,168,172,168,172,75,75,75,75,75,75,171,172,38,75,165,166,38,0,75,75,75,75,75,168,169,170,171,172,168,172,75,165,166,75,75,75,75,165,166,75,75,75,75,75,75,75,75,75,165,166,165,166,165,166,171,172,165,166,38,38,38,165,166,75,75,175,173,171,172,165,166,38,75,175,173,171,172,165,166,38,75,175,173,171,172,165,166,38,75,165,166,75,131,129,136,130,0,0,0,134,132,138,135,136,137,134,132,130,138,135,136,137,134,132,138,133,135,136,137,134,132,130,138,135,136,0,0,0,137,134,133,135,131,129,136,0,0,215,0,0,0,0,0,0,0,0,0,136,0,0,137,131,129,136,131,129,136,131,129,136,131,129,136,131,129,136,0,0,0,132,132,133,133,135,130,131,129,136,0,138,0,0,137,136,129,0,0,215,0,215,134,130,130,134,0,0,0,0,0,0,137,134,132,133,0,0,0,0,0,0,0,0,133,135,131,129,136,0,0,0,0,181,183,181,183,0,185,186,187,188,185,186,131,187,129,212,136,188,184,189,189,130,190,216,0,191,185,188,185,185,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,206,192,185,188,211,192,185,188,0,194,195,193,192,194,134,195,132,193,138,192,135,212,136,183,183,196,194,195,189,193,192,196,137,194,134,195,132,189,130,193,138,192,135,212,136,196,194,195,193,192,196,137,194,134,195,132,193,138,211,133,192,135,212,136,196,194,195,189,193,192,196,137,194,134,195,132,189,130,193,138,192,135,212,136,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,0,0,0,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,0,207,207,207,0,0,194,194,0,215,216,215,216,215,215,216,216,0,196,194,189,192,186,187,196,137,194,134,189,211,133,192,135,186,131,187,129,212,136,0,188,188,0,0,207,181,197,183,200,201,203,205,184,206,196,207,195,208,193,190,209,211,185,212,213,188,214,189,216,187,195,195,212,136,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,207,207,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,210,211,192,185,186,187,212,213,188,214,210,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,0,215,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,207,0,202,196,196,137,0,190,215,216,0,186,187,186,131,187,129,212,136,186,187,186,131,187,129,212,136,186,187,186,131,187,129,212,136,186,187,186,131,187,129,212,136,186,187,186,131,187,129,212,136,0,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,186,131,187,129,212,136,213,188,214,185,188,185,215,195,0,208,185,188,188,188,0,0,0,0,0,0,0,0,0,0,0,195,195,132,195,195,132,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,211,133,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,185,188,216,185,188,185,188,188,188,211,133,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,0,185,188,192,192,135,189,189,130,186,187,186,131,187,129,212,136,207,193,193,138,0,208,0,208,0,208,0,0,208,0,208,0,208,187,187,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,194,207,195,189,208,193,190,209,210,211,192,185,186,187,212,213,188,214,0,0,0,197,197,0,0,189,192,187,189,192,187,195,195,0,0,0,187,187,0,195,195,0,0,0,0,0,196,196,137,209,212,136,0,187,187,187,187,129,185,188,192,192,191,181,197,183,198,199,200,201,202,203,204,205,184,184,206,206,196,196,137,194,194,134,207,207,195,195,132,189,189,130,208,208,193,193,138,190,190,209,209,210,210,211,211,133,192,192,135,185,185,186,131,187,129,212,212,136,213,213,188,188,214,201,0,0,0,0,188,188,0,0,194,189,210,194,134,189,130,210,0,189,189,130,208,194,194,134,205,137,134,132,130,138,133,135,131,129,136,0,0,186,187,186,187,212,0,0,190,215,216,0,0,0,0,0,213,0,196,194,195,196,137,194,134,195,132,211,133,0,0,0,0,0,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,191,181,197,183,198,199,200,201,202,203,204,205,184,206,196,137,194,134,215,207,195,132,189,130,208,193,138,216,190,209,210,211,133,192,135,185,186,131,187,129,212,136,213,188,214,208,192,192,185,188,185,185,185,188,188,188,0,0,0,0,0,0,0,0,0,0,0,0,208,192,211,133,192,135,185,188,0,0,0,0,0,0,0,186,187,186,131,187,129,212,136,0,0,0,78,78,78,78,78,226,225,78,78,78,0,226,226,78,78,78,225,78,78,78,226,226,226,78,78,78,78,78,78,78,78,78,0,78,78,226,78,78,226,78,226,78,78,226,78,226,78,78,0,0,0,0,0,78,78,78,223,224,225,82,226,227,78,223,224,225,82,226,227,78,223,224,225,82,226,227,78,223,224,225,82,226,227,78,78,223,224,224,225,225,82,226,227,82,82,227,82,82,227,78,224,225,82,78,223,224,225,82,226,227,78,223,224,225,82,226,227,227,78,223,224,225,82,226,227,78,223,224,225,226,82,78,223,224,224,225,82,226,227,78,223,224,225,82,226,227,82,82,78,224,82,223,82,82,227,223,82,78,223,224,225,82,226,227,78,223,224,225,82,226,227,82,82,223,82,82,227,82,78,223,224,82,82,82,82,223,223,82,223,82,82,82,82,227,82,82,227,82,82,227,82,82,82,82,82,227,78,223,224,225,82,226,227,224,224,78,223,224,225,82,226,227,78,223,224,225,82,226,227,78,223,224,225,82,226,227,82,82,82,227,82],"f":"`````````````````````````````````````````````````````````````````````````````````````{{{d{b}}}f}{{bb}c{}}{{{d{hb}}b}j}{ln}{lA`}`{{{d{Ab}}}{{d{Ad}}}}00`5`{{{d{c}}}{{d{e}}}{}{}}0000000000000000000{{{d{hc}}}{{d{he}}}{}{}}0000000000000000000```{{{d{Af}}}Ah}`{{Ajl}Af}{{{d{hAl}}}j}{{{d{hAf}}}j}{{{d{n}}}n}{{{d{A`}}}A`}{{{d{An}}}An}{{{d{B`}}}B`}{{{d{Bb}}}Bb}{{{d{Bd}}}Bd}{{{d{Bf}}}Bf}{{{d{Bh}}}Bh}{{{d{Bj}}}Bj}{{{d{Bl}}}Bl}{{{d{Al}}}Al}{{{d{b}}}b}{{{d{Ab}}}Ab}{{{d{Bn}}}Bn}{{{d{Af}}}Af}{{{d{C`}}}C`}{{{d{Cb}}}Cb}{{{d{Cd}}}Cd}{{{d{Cf}}}Cf}{{{d{c}}{d{he}}}j{}{}}000000000000000000{{{d{c}}}j{}}000000000000000000000000000000{{{d{hAf}}}j}`{{{d{hAf}}AjAjl}j}{{{d{Af}}AjBh}Ch}{{{d{Bl}}}Cj}{{{d{hAf}}AjAjAj}j}`{{bl}b}{{}n}{{}A`}{{}Bf}{{}Al}{{}b}{{}Af}{{}Cf}{Cj{{d{c}}}{}}0000000000000{{{d{Ab}}}{{d{c}}}{}}111111{Cj{{d{hc}}}{}}0000000000000000000:{{{d{hAl}}Al}j}{Cjj}0000000000000000000{AhAf}{{{d{n}}{d{n}}}Ch}{{{d{A`}}{d{A`}}}Ch}{{{d{An}}{d{An}}}Ch}{{{d{B`}}{d{B`}}}Ch}{{{d{Bb}}{d{Bb}}}Ch}{{{d{Bd}}{d{Bd}}}Ch}{{{d{Bf}}{d{Bf}}}Ch}{{{d{Bh}}{d{Bh}}}Ch}{{{d{Bj}}{d{Bj}}}Ch}{{{d{Bl}}{d{Bl}}}Ch}{{{d{Al}}{d{Al}}}Ch}{{{d{b}}{d{b}}}Ch}{{{d{Ab}}{d{Ab}}}Ch}{{{d{Bn}}{d{Bn}}}Ch}{{{d{Af}}{d{Af}}}Ch}{{{d{C`}}{d{C`}}}Ch}{{{d{Cb}}{d{Cb}}}Ch}{{{d{Cd}}{d{Cd}}}Ch}{{{d{Cf}}{d{Cf}}}Ch}{{bl}b}{{{d{hAl}}cBhe}j{{Cn{{Cl{Af}}}}}{{Cn{Bf}}}}`{{{d{n}}{d{hD`}}}Db}{{{d{A`}}{d{hD`}}}Db}{{{d{An}}{d{hD`}}}Db}{{{d{B`}}{d{hD`}}}Db}{{{d{Bb}}{d{hD`}}}Db}{{{d{Bd}}{d{hD`}}}Db}{{{d{Bf}}{d{hD`}}}Db}{{{d{Bh}}{d{hD`}}}Db}{{{d{Bj}}{d{hD`}}}Db}{{{d{Bl}}{d{hD`}}}Db}{{{d{Al}}{d{hD`}}}Db}{{{d{b}}{d{hD`}}}Db}0{{{d{Ab}}{d{hD`}}}Db}0{{{d{Bn}}{d{hD`}}}Db}{{{d{Af}}{d{hD`}}}Db}{{{d{C`}}{d{hD`}}}Db}{{{d{Cb}}{d{hD`}}}Db}{{{d{Cd}}{d{hD`}}}Db}{{{d{Cf}}{d{hD`}}}Db}{cc{}}{{{Dd{l}}}n}{ln}{{{Df{llll}}}n}3{{{Df{ll}}}A`}{{{Dd{l}}}A`}5{{{Df{llll}}}A`}{lA`}27{DhAn}888{bBf}9{DhBf}{AnBf};;{AhBj}<<{{{Df{llll}}}b}={{{Dd{l}}}b}>>{AhAf}?????{lCf}`{{{d{b}}}f}{lb}{{{d{An}}{d{hc}}}jDj}{{{d{B`}}{d{hc}}}jDj}{{{d{Bb}}{d{hc}}}jDj}{{{d{Bd}}{d{hc}}}jDj}{{{d{Bf}}{d{hc}}}jDj}{{{d{Bh}}{d{hc}}}jDj}{{{d{b}}{d{hc}}}jDj}{{{d{Bn}}{d{hc}}}jDj}{{{d{Af}}{d{hc}}}jDj}{{{d{Cb}}{d{hc}}}jDj}{{{d{Cd}}{d{hc}}}jDj}{{{d{Cf}}{d{hc}}}jDj}{{{d{Ad}}}b}0{{{d{hAl}}Dle}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}{{lll}b}0{{llll}b}01100`{{}Cj}0000000000000000000{ce{}{}}00000000000000000000{{{d{Af}}}c{}}{{{d{Af}}}Ch}0{bCh}01{{{d{Af}}}Eb}`{{{d{Af}}}{{Ed{Aj}}}}{{{d{hAl}}Ef{Ed{Bj}}{Ed{Dl}}e}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}`{{{d{Af}}}Cj}{{bl}b}{{{d{hAf}}Aj}j}{bl}{{{d{hAl}}Bje}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}{{{d{n}}}l}0`{{bbl}b}04{{bl}c{}}{{bb}c{}}{{llll}n}{{llll}A`}{{cBh}Bj{{Cn{{Cl{Af}}}}}}{{}Al}{{ffff}Ab}{{}Af}{{{d{hEb}}}{{Ed{c}}}{}}{{lll}b}0{{llll}b}0110011001100{{{d{hAl}}Ehe}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}{{{d{Bn}}}Cj}{{{d{Af}}}{{d{{Ej{Aj}}}}}}{{{d{Al}}}{{`{{En{}{{El{{d{Bl}}}}}}}}}}{{{d{hAf}}Ah}j}0{{{d{hAf}}AhnA`}j}{{{d{hAf}}Ahn}j}{{{d{hAf}}AjAj}j}`{{{d{b}}}f}{{{d{hAl}}Ahc}j{{Cn{Bf}}}}{AhAf}<<;;{{ffff}b}`{{{d{hAl}}le}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}{{bl}b}{{{d{hAl}}F`e}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}`{{{d{Eb}}}{{Df{Cj{Ed{Cj}}}}}}{{{d{hAl}}ceg}j{{Cn{{Cl{Af}}}}}{{Cn{Cf}}}{{Cn{Bf}}}}{{{d{hAf}}{d{Af}}Cf}j}{bAb}{b{{Df{lll}}}}{b{{Df{llll}}}}1010101010{{{d{c}}}e{}{}}000000000000000000{b{{Dd{f}}}}{{{d{c}}}Fb{}}0{b{{Dd{l}}}}{{{d{c}}}Fd{}}0```{{{d{hAf}}Ef}j}`{{{d{hAl}}Efe}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}={{{d{hAl}}AhDl}j}{c{{Ff{e}}}{}{}}0000000000000000000{{{d{Ad}}}{{Ed{b}}}}11111111111111111111{{{d{c}}}Fh{}}0000000000000000000{{{d{Af}}}{{d{{Ej{Bn}}}}}}{{{d{Al}}Aj}{{Ed{Dl}}}}`````````````{{{d{c}}}{{d{e}}}{}{}}{{{d{hc}}}{{d{he}}}{}{}}{{}Fj}{Cj{{d{c}}}{}}{Cj{{d{hc}}}{}}{Cjj}{{{d{Fj}}{d{hD`}}}Db}{cc{}}{{{d{hFj}}}Fd}{{{d{hFl}}}Fd}{{}Cj}{ce{}{}}{{{Fn{Fl}}}Fj}{{{d{hFj}}c}j{{G`{Ad}}}}{{{d{hFl}}{d{Ad}}}j}{c{{Ff{e}}}{}{}}0{{{d{c}}}Fh{}}````{{{d{c}}}{{d{e}}}{}{}}000{{{d{hc}}}{{d{he}}}{}{}}000{{{d{Gb}}}Gb}{{{d{Gd}}}Gd}{{{d{c}}{d{he}}}j{}{}}0{{{d{c}}}j{}}0{{{d{Gd}}c}j{GfGh}}{{{d{Gd}}e}j{GfGh}{{Gj{}{{Dn{c}}}}Gh}}{{{d{Gd}}Gl}j}{Cj{{d{c}}}{}}000{Cj{{d{hc}}}{}}000{Cjj}000{{{d{Gl}}{d{hD`}}}Db}{{{d{Gn}}{d{hD`}}}Db}{{{d{Gb}}{d{hD`}}}Db}{{{d{Gd}}{d{hD`}}}Db}{cc{}}0{{{Cl{H`}}}Gb}11{{{d{Gl}}}{{Ed{{d{c}}}}}Gf}{{}Cj}000{ce{}{}}000{{{d{Gl}}}Ch}{{{d{Gl}}}{{d{Ad}}}}{cGl{GfGh}}{cGb{H`GhHb}}{Gb{{Df{GdGn}}}}{{{d{Gd}}c}j{{Gj{}{{Dn{j}}}}Gh}}{Gl{{Fn{Gf}}}}{{{d{c}}}e{}{}}0{c{{Ff{e}}}{}{}}0000000{{{d{Gn}}}{{Ed{Gl}}}}{{{d{c}}}Fh{}}000{{{d{Gb}}}j}{{{d{Gd}}}j}```````{{{d{Hd}}}Ch}{{{d{hHf}}}j}{{{d{hHd}}}j}{{{d{hHh}}}j}{{{d{hHd}}}Hf}{{{d{hHh}}}Hf}{{{d{hHh}}}Hj}{{{d{hHd}}}Hh}{{{d{c}}}{{d{e}}}{}{}}000000{{{d{hc}}}{{d{he}}}{}{}}000000{{{d{hHl}}}{{d{hAl}}}}{{{d{hHf}}}Hf}{{{d{hHl}}}Hl}{{{d{hHd}}}Hd}{{{d{hHj}}}Hj}{{{d{hHh}}}Hh}{{{d{hHn}}}{{d{hFj}}}}{{{d{hHn}}c}j{GfGh}}{{{d{Hn}}e}j{GfGh}{{Gj{}{{Dn{c}}}}Gh}}{{{d{I`}}}Ch}{{{d{Hn}}}Ch}{{{d{Hf}}}Ch}{{{d{Hl}}}Ch}{{{d{Hd}}}Ch}{{{d{Hj}}}Ch}{{{d{Hh}}}Ch}{{{d{Hn}}}{{d{c}}}Gf}{{{d{hHn}}}{{d{hc}}}Gf}{{{d{hHn}}}{{d{hc}}}{GfIb}}{{{d{Hn}}}{{d{I`}}}}{{{d{hHn}}}{{d{hI`}}}}{{}I`}{Cj{{d{c}}}{}}{{{d{Hf}}}{{d{c}}}{}}11{{{d{Hl}}}{{d{c}}}{}}{{{d{Hd}}}{{d{c}}}{}}3{{{d{Hj}}}{{d{c}}}{}}4{{{d{Hh}}}{{d{c}}}{}}55{Cj{{d{hc}}}{}}0{{{d{hHf}}}{{d{hc}}}{}}1{{{d{hHl}}}{{d{hc}}}{}}2{{{d{hHd}}}{{d{hc}}}{}}{{{d{hHj}}}{{d{hc}}}{}}4{{{d{hHh}}}{{d{hc}}}{}}55{{{d{hHf}}}j}{{{d{hHd}}}j}{{{d{hHh}}}j}{{{d{hHl}}Al}j}{Cjj}000000{{{d{hHl}}AfBhc}j{{Cn{Bf}}}}{{{d{hHl}}Ahc}j{{Cn{Bf}}}}{{{d{I`}}{d{hD`}}}Db}{{{d{Hd}}}Ch}{{{d{hHn}}}{{d{hId}}}}{cc{}}000000{{{d{I`}}}{{Ed{{d{c}}}}}Gf}{{{d{Hn}}}{{Ed{{d{c}}}}}Gf}{{{d{hHn}}}{{Ed{{d{hc}}}}}Gf}{{{d{hI`}}}{{Ed{{d{hc}}}}}Gf}{{{d{hI`}}}{{d{hc}}}{GfIb}}{{{d{Hf}}}{{Ed{{d{c}}}}}{}}{{{d{Hl}}}{{Ed{{d{c}}}}}{}}{{{d{Hd}}}{{Ed{{d{c}}}}}{}}{{{d{Hj}}}{{Ed{{d{c}}}}}{}}{{{d{Hh}}}{{Ed{{d{c}}}}}{}}{{{d{hHf}}}{{Ed{{d{hc}}}}}{}}{{{d{hHl}}}{{Ed{{d{hc}}}}}{}}{{{d{hHd}}}{{Ed{{d{hc}}}}}{}}{{{d{hHj}}}{{Ed{{d{hc}}}}}{}}{{{d{hHh}}}{{Ed{{d{hc}}}}}{}}{{{d{Hd}}}Ch}00{{{d{Hf}}}Ch}{{{d{Hl}}}Ch}2{{{d{Hj}}}Ch}{{{d{Hh}}}Ch}43241043241044{{{d{hHl}}e}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{Hf}}}Dl}{{{d{Hl}}}Dl}{{{d{Hd}}}Dl}{{{d{Hj}}}Dl}{{{d{Hh}}}Dl}{{}Cj}000000{{{d{hI`}}c}{{Ed{c}}}Gf}{{{d{hHn}}c}{{Ed{c}}}Gf}{{{d{hHf}}c}j{}}{{{d{hHl}}c}j{}}{{{d{hHd}}c}j{}}{{{d{hHj}}c}j{}}{{{d{hHh}}c}j{}}{ce{}{}}000000{{{d{Hf}}}Ch}{{{d{Hl}}}Ch}{{{d{Hd}}}Ch}{{{d{Hj}}}Ch}{{{d{Hh}}}Ch}{{{d{I`}}}Ch}5432154321{{{d{Hl}}Ah}Ch}{{{d{hHf}}}j}{{{d{hHd}}}j}{{{d{hHh}}}j}{{{d{I`}}}Cj}{{{d{Hd}}Aj}Aj}{{{d{hHl}}cg}e{{Cn{Bj}}}{}{{E`{{d{hHl}}}{{Dn{e}}}}}}{{{d{hI`}}{d{hGd}}}Hn}{{{d{hHn}}{d{hIf}}}Hf}{{{d{hHn}}{d{hIf}}{d{hAl}}}Hl}{{{d{hHn}}{d{hIf}}{d{hCh}}}Hd}{{{d{hHn}}{d{hIf}}}Hj}{{{d{hHn}}{d{hIf}}}Hh}{{}I`}{{{d{hHl}}Ehe}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHj}}{d{Ih}}F`}j}{{{d{hHj}}{d{Ij}}F`}j}{{{d{hHf}}c}{{d{hc}}}{}}{{{d{hHl}}c}{{d{hc}}}{}}{{{d{hHd}}c}{{d{hc}}}{}}{{{d{hHj}}c}{{d{hc}}}{}}{{{d{hHh}}c}{{d{hc}}}{}}{{{d{hHf}}}{{d{hc}}}Ib}{{{d{hHl}}}{{d{hc}}}Ib}{{{d{hHd}}}{{d{hc}}}Ib}{{{d{hHj}}}{{d{hc}}}Ib}{{{d{hHh}}}{{d{hc}}}Ib}{{{d{hHf}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{hHl}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{hHd}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{hHj}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{hHh}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{Hn}}}Gd}{{{d{hHl}}Ahcegi}j{{Cn{Bf}}}{{Cn{n}}}{{Cn{A`}}}{{Cn{Bf}}}}{{{d{hHd}}}j}{{{d{Hl}}}Ah}{{{d{Hd}}}Ah}{{{d{Hh}}}Ah}{{{d{hI`}}}{{Ed{c}}}Gf}{{{d{hHn}}}{{Ed{c}}}Gf}{{{d{hHf}}}{{Ed{c}}}{}}{{{d{hHl}}}{{Ed{c}}}{}}{{{d{hHd}}}{{Ed{c}}}{}}{{{d{hHj}}}{{Ed{c}}}{}}{{{d{hHh}}}{{Ed{c}}}{}}{{{d{hHl}}le}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHl}}F`e}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHf}}Ch}Ch}{{{d{hHd}}Ch}Ch}{{{d{hHh}}Ch}Ch}{{{d{hHf}}{Ed{Il}}}j}{{{d{hHd}}{Ed{Il}}}j}{{{d{hHh}}{Ed{Il}}}j}543543{{{d{hHd}}{Ed{In}}}j}{{{d{Hl}}}J`}{{{d{Hd}}}J`}{{{d{Hh}}}J`}{{{d{hHn}}c}j{{Gj{}{{Dn{j}}}}Gh}}{{{d{hHl}}Afce}j{{Cn{Cf}}}{{Cn{Bf}}}}{{{d{Hf}}}{{d{Jb}}}}{{{d{Hl}}}{{d{Jb}}}}{{{d{Hd}}}{{d{Jb}}}}{{{d{Hj}}}{{d{Jb}}}}{{{d{Hh}}}{{d{Jb}}}}{{{d{hHl}}{d{Ih}}bF`}j}{{{d{hHl}}{d{Ij}}bF`}j}{{{d{Hl}}}Ef}{{{d{Hd}}}Ef}{{{d{hHl}}Efe}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHl}}F`e}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHl}}Ah}j}{c{{Ff{e}}}{}{}}0000000000000{{{d{c}}}Fh{}}000000{{{d{Hd}}}Ch}00{{{d{Hf}}}{{d{Jd}}}}{{{d{Hl}}}{{d{Jd}}}}{{{d{Hd}}}{{d{Jd}}}}{{{d{Hj}}}{{d{Jd}}}}{{{d{Hh}}}{{d{Jd}}}}{{{d{hHf}}}{{d{hJd}}}}{{{d{hHl}}}{{d{hJd}}}}{{{d{hHd}}}{{d{hJd}}}}{{{d{hHj}}}{{d{hJd}}}}{{{d{hHh}}}{{d{hJd}}}}`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{d{Jf}}}Ch}{Jh{{Ed{Jj}}}}{{{d{Jl}}}Jn}{{{d{c}}}{{d{e}}}{}{}}00000000000000000{{{d{hc}}}{{d{he}}}{}{}}00000000000000000```{{{d{In}}}In}{{{d{K`}}}K`}{{{d{Kb}}}Kb}{{{d{Jh}}}Jh}{{{d{Kd}}}Kd}{{{d{Jf}}}Jf}{{{d{Jl}}}Jl}{{{d{Kf}}}Kf}{{{d{Kh}}}Kh}{{{d{Kj}}}Kj}{{{d{Kl}}}Kl}{{{d{Kn}}}Kn}{{{d{L`}}}L`}{{{d{Lb}}}Lb}{{{d{Ld}}}Ld}{{{d{Lf}}}Lf}{{{d{Lh}}}Lh}{{{d{c}}{d{he}}}j{}{}}0000000000000000{{{d{c}}}j{}}0000000000000000000000000{{{d{Lj}}}{{Ed{{d{c}}}}}Gf}````{{}In}{{}Jf}``{Cj{{d{c}}}{}}00000000000000000{Cj{{d{hc}}}{}}00000000000000000{Cjj}00000000000000000{{{d{In}}{d{In}}}Ch}{{{d{Jh}}{d{Jh}}}Ch}{{{d{Kd}}{d{Kd}}}Ch}{{{d{Jf}}{d{Jf}}}Ch}{{{d{Jl}}{d{Jl}}}Ch}{{{d{Kf}}{d{Kf}}}Ch}{{{d{Kh}}{d{Kh}}}Ch}{{{d{Kj}}{d{Kj}}}Ch}{{{d{Kl}}{d{Kl}}}Ch}{{{d{Kn}}{d{Kn}}}Ch}{{{d{L`}}{d{L`}}}Ch}{{{d{Lb}}{d{Lb}}}Ch}{{{d{Ld}}{d{Ld}}}Ch}{{{d{Lf}}{d{Lf}}}Ch}{{{d{Lh}}{d{Lh}}}Ch}{{{d{Lj}}{d{hD`}}}Db}{{{d{In}}{d{hD`}}}Db}{{{d{K`}}{d{hD`}}}Db}{{{d{Kb}}{d{hD`}}}Db}{{{d{Jh}}{d{hD`}}}Db}{{{d{Kd}}{d{hD`}}}Db}{{{d{Jf}}{d{hD`}}}Db}{{{d{Jl}}{d{hD`}}}Db}{{{d{Kf}}{d{hD`}}}Db}{{{d{Kh}}{d{hD`}}}Db}{{{d{Kj}}{d{hD`}}}Db}{{{d{Kl}}{d{hD`}}}Db}{{{d{Kn}}{d{hD`}}}Db}{{{d{L`}}{d{hD`}}}Db}{{{d{Lb}}{d{hD`}}}Db}{{{d{Ld}}{d{hD`}}}Db}{{{d{Lf}}{d{hD`}}}Db}{{{d{Lh}}{d{hD`}}}Db}{cc{}}00000000000000000{{{d{c}}}JlLl}{f{{Ed{Kd}}}}{LnKf}{JnJl}{{{d{In}}{d{hc}}}jDj}{{{d{Jh}}{d{hc}}}jDj}{{{d{Kd}}{d{hc}}}jDj}{{{d{Jf}}{d{hc}}}jDj}{{{d{Jl}}{d{hc}}}jDj}{{{d{Kf}}{d{hc}}}jDj}{{{d{Kh}}{d{hc}}}jDj}{{{d{Kj}}{d{hc}}}jDj}{{{d{Kl}}{d{hc}}}jDj}{{{d{Kn}}{d{hc}}}jDj}{{{d{L`}}{d{hc}}}jDj}{{{d{Lb}}{d{hc}}}jDj}{{{d{Ld}}{d{hc}}}jDj}{{{d{Lh}}{d{hc}}}jDj}``````{{}Cj}00000000000000000{ce{}{}}00000000000000000{{{d{M`}}Jh{Ed{Kd}}}Ch}{{{d{Jh}}Jh{Ed{Kd}}}Ch}{{{d{Kd}}Jh{Ed{Kd}}}Ch}{{{d{Lj}}}Ch}{{{d{K`}}c}ChM`}{{{d{Kb}}c}ChM`}{{{d{Lj}}c}ChM`}0`````````````````{{{d{Ld}}}J`}``{{{d{c}}}e{}{}}0000000000000000{c{{Ff{e}}}{}{}}00000000000000000000000000000000000{{{d{c}}}Fh{}}00000000000000000`````````````{{{d{c}}}{{d{Gf}}}{}}{{{d{c}}}{{d{e}}}{}{}}00000{{{d{hc}}}{{d{he}}}{}{}}00000{{{d{hDh}}{d{hHf}}{d{hc}}}e{}{}}{{{d{Mb}}}Mb}{{{d{Md}}}Md}{{{d{Dh}}}Dh}{{{d{Mf}}}Mf}{{{d{Mh}}}Mh}{{{d{Mj}}}Mj}{{{d{c}}{d{he}}}j{}{}}00000{{{d{c}}}j{}}0000000{{{d{hDh}}b}j}{{{d{Mb}}}Md}{{{d{Mb}}}{{d{{Ej{f}}}}}}{{{d{hMb}}}{{d{h{Ej{f}}}}}}{{}Mb}{{}Dh}{{}Mh}{{}Mj}{{{d{Mb}}}{{d{c}}}{}}{Cj{{d{c}}}{}}0{{{d{Dh}}}{{d{c}}}{}}1111{Cj{{d{hc}}}{}}{{{d{hMb}}}{{d{hc}}}{}}11111{{{d{Dh}}}Mf}{{{d{hDh}}{d{hc}}{d{hHl}}{d{he}}}j{}{}}{Cjj}00000{{{d{hc}}{d{hHf}}{d{he}}}{{Fn{Gf}}}{}{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHl}}{d{he}}}j{}{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHh}}{d{he}}{d{Mn}}}j{}{}}{{{d{Mb}}{d{Mb}}}Ch}{{{d{Md}}{d{Md}}}Ch}{{{d{Dh}}{d{Dh}}}Ch}{{{d{Mf}}{d{Mf}}}Ch}{{{d{Mh}}{d{Mh}}}Ch}{{{d{Mj}}{d{Mj}}}Ch}{{{d{hDh}}{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{Mb}}}Ch}{{{d{Mb}}{d{hD`}}}Db}{{{d{Md}}{d{hD`}}}Db}{{{d{Dh}}{d{hD`}}}Db}{{{d{Mf}}{d{hD`}}}Db}{{{d{Mh}}{d{hD`}}}Db}{{{d{Mj}}{d{hD`}}}Db}{cc{}}00{MbDh}111{MhMj}{DhMj}{JnMh}{{{d{Mb}}N`N`}{{Dd{f}}}}{{{d{Mb}}{d{hc}}}jDj}{{{d{Md}}{d{hc}}}jDj}{{{d{Dh}}{d{hc}}}jDj}{{{d{Mf}}{d{hc}}}jDj}{{{d{Mh}}{d{hc}}}jDj}{{{d{Mb}}}N`}{{{d{Dh}}}Md}{{{d{Mf}}}Md}{{}Cj}00000{ce{}{}}00000{{{d{hDh}}{d{hc}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{hDh}}c}j{{E`{{d{hMb}}}}}}{{{d{hDh}}}j}{{{Nb{f}}N`N`}Mb}{{{Nb{f}}N`N`}Dh}{{}Mh}{DhDh}{{{d{hDh}}{d{hc}}{d{hHh}}{d{he}}{d{Dh}}}j{}{}}{{{d{hMb}}Ch}j}{{{d{hMb}}N`N`{Dd{f}}}j}{{{d{Mb}}}J`}{{{d{Mf}}}Cj}{MhJn}{{{d{c}}}e{}{}}00000{c{{Ff{e}}}{}{}}00000000000{{{d{c}}}Fh{}}000004{{{d{Mb}}}N`}``````````````````````````````````````````````````````````{{AjF`}c{}}{{Ajl}c{}}{{AjJ`}c{}}{{AhJ`}c{}}{{AhF`}c{}}{{J`F`}c{}}{{J`J`}c{}}{{J`l}c{}}{{MlJ`}c{}}{{F`F`}c{}}{{F`l}c{}}{{{d{hAj}}J`}j}{{{d{hAj}}l}j}{{{d{hAj}}F`}j}{{{d{hAh}}F`}j}{{{d{hAh}}J`}j}{{{d{hJ`}}l}j}{{{d{hJ`}}J`}j}{{{d{hJ`}}F`}j}{{{d{hMl}}J`}j}{{{d{hF`}}l}j}{{{d{hF`}}F`}j}{{NdJ`J`}F`}{{Nfll}l}{lNh}{lAj}{lJ`}{lF`}{F`l}{{F`F`}l}{Ahl}{{AhAh}c{}}{{MlMl}c{}}{{{d{hAh}}Ah}j}{{{d{hMl}}Ml}j}{{{d{c}}}{{d{e}}}{}{}}000000000000{{{d{hc}}}{{d{he}}}{}{}}0000000000006`{AhAj}00{AjAj}{J`J`}{F`F`}333{{AjJ`}Ah}{{AjAjAj}Aj}{{Ahc}Ah{{Cn{Ah}}}}{{J`J`J`}J`}{{F`F`F`}F`}{{{d{Ef}}}Ef}{{{d{Nd}}}Nd}{{{d{Nj}}}Nj}{{{d{Nf}}}Nf}{{{d{Nl}}}Nl}{{{d{Nn}}}Nn}{{{d{Nh}}}Nh}{{{d{Aj}}}Aj}{{{d{Ah}}}Ah}{{{d{J`}}}J`}{{{d{Ml}}}Ml}{{{d{F`}}}F`}{{{d{c}}{d{he}}}j{}{}}00000000000{{{d{c}}}j{}}00000000000000000000000{{MlMl}Ml}{{AhAj}Aj}{{AhAj}Ch}{{F`F`}l}{{}Ef}{{}Nd}{{}Nn}{{}Nh}{{}Aj}{{}Ah}{{}J`}{{}Ml}{{}F`}{Cj{{d{c}}}{}}000000000000{Cj{{d{hc}}}{}}000000000000{Nnl}{{AjAj}l}{{AjJ`}c{}}{{Ajl}c{}}{{AjF`}c{}}{{J`J`}c{}}{{J`l}c{}}{{J`F`}c{}}{{F`l}c{}}{{F`F`}c{}}{{{d{hAj}}l}j}{{{d{hAj}}J`}j}{{{d{hAj}}F`}j}{{{d{hJ`}}F`}j}{{{d{hJ`}}l}j}{{{d{hJ`}}J`}j}{{{d{hF`}}l}j}{{{d{hF`}}F`}j}{{F`F`}l}{Cjj}000000000000{{{d{Ef}}{d{Ef}}}Ch}{{{d{Nd}}{d{Nd}}}Ch}{{{d{Nj}}{d{Nj}}}Ch}{{{d{Nf}}{d{Nf}}}Ch}{{{d{Nl}}{d{Nl}}}Ch}{{{d{Nn}}{d{Nn}}}Ch}{{{d{Nh}}{d{Nh}}}Ch}{{{d{Aj}}{d{Aj}}}Ch}{{{d{Ah}}{d{Ah}}}Ch}{{{d{J`}}{d{J`}}}Ch}{{{d{Ml}}{d{Ml}}}Ch}{{{d{F`}}{d{F`}}}Ch}{{MlJ`}Ml}{J`J`}{{MlJ`}J`}{AjAj}2{F`F`}{{{d{Ef}}{d{hD`}}}Db}{{{d{Nd}}{d{hD`}}}Db}{{{d{Nj}}{d{hD`}}}Db}{{{d{Nf}}{d{hD`}}}Db}{{{d{Nl}}{d{hD`}}}Db}{{{d{Nn}}{d{hD`}}}Db}{{{d{Nh}}{d{hD`}}}Db}{{{d{Aj}}{d{hD`}}}Db}0{{{d{Ah}}{d{hD`}}}Db}{{{d{J`}}{d{hD`}}}Db}0{{{d{Ml}}{d{hD`}}}Db}{{{d{F`}}{d{hD`}}}Db}0={cc{}}00{{{Dd{l}}}Nd}{{{Df{ll}}}Nd}2222{{{Dd{l}}}Nh}{{{Df{ll}}}Nh}1{{{Df{llll}}}Nh}{lNh}6{{{Df{ll}}}Aj}{{{Dd{l}}}Aj}{J`Aj}{lAj}:{F`Aj}{J`Ah}{{{Dd{l}}}Ah}={{{Dd{l}}}J`}{F`J`}?{lJ`}{AjJ`}{{{Df{ll}}}J`}{J`Ml}{cc{}}{lF`}{{{Df{ll}}}F`}{AjF`}3{{{Dd{l}}}F`}{J`F`}{lNn}5{F`Nn}8{{{d{Ef}}{d{hc}}}jDj}{{{d{Nj}}{d{hc}}}jDj}{{{d{Nf}}{d{hc}}}jDj}{{{d{Nl}}{d{hc}}}jDj}{{{d{Nn}}{d{hc}}}jDj}{{{d{Aj}}{d{hc}}}jDj}{{{d{Ah}}{d{hc}}}jDj}{{{d{J`}}{d{hc}}}jDj}{{{d{Ml}}{d{hc}}}jDj}{{{d{F`}}{d{hc}}}jDj}{F`F`}{Ahl}`{{AhAj}Ah}{{Ahl}Ah}{{}Cj}000000000000{{AhAh}Ah}{{AhAh}Ch}{ce{}{}}0000000000000{EfEf}{NnNn}{AjCh}{J`Ch}{MlCh}2102{{Nl{d{{Ej{l}}}}ll}O`}<`{F`l}0{{AjAjl}Aj}{MlMl}00{{{d{Nj}}c}l{{Cn{{Df{ll}}}}}}`{{AjAj}Aj}{{J`J`}J`}{{F`F`}F`}``{J`l}{{AjJ`}Ah}432``105{{EfEf}c{}}{{EfF`}c{}}{{EfAj}c{}}{{NnNn}c{}}{{NnF`}c{}}{{NnAj}c{}}{{AjF`}c{}}{{Ajl}c{}}{{AjJ`}c{}}{{J`J`}c{}}{{J`l}c{}}{{J`F`}c{}}{{F`F`}c{}}{{F`l}c{}}{{{d{hEf}}Ef}j}{{{d{hAj}}F`}j}{{{d{hAj}}J`}j}{{{d{hAj}}l}j}{{{d{hJ`}}J`}j}{{{d{hJ`}}F`}j}{{{d{hJ`}}l}j}{{{d{hF`}}l}j}{{{d{hF`}}F`}j}{Ajc{}}{F`c{}}{{ll}Nd}{{F`F`}Nn}{{llll}Nh}{{ll}Aj}{{AjAj}Ah}{{ll}J`}{{J`J`}Ml}{{ll}F`}{{{d{hO`}}}{{Ed{c}}}{}}{F`F`}{{{d{Nh}}}F`}{AhF`}{{{d{Nj}}ll}c{{Ob{{Df{ll}}}}}}{ll}{{AjJ`}c{}}{{Ajl}c{}}{{AjF`}c{}}{{J`F`}c{}}{{J`l}c{}}{{J`J`}c{}}{{F`F`}c{}}{{F`l}c{}}{{{d{hAj}}F`}j}{{{d{hAj}}J`}j}{{{d{hAj}}l}j}{{{d{hJ`}}F`}j}{{{d{hJ`}}l}j}{{{d{hJ`}}J`}j}{{{d{hF`}}l}j}{{{d{hF`}}F`}j}{Ahl}`{lEf}{EfEf}{AjAj}{AhAh}{J`J`}{F`F`}{F`Ef}{{Ahl}Ah}{{MlJ`}Ml}3{{{d{Nh}}}J`}{AhJ`}{{AjF`}c{}}{{AjAj}c{}}{{Ajl}c{}}{{AjJ`}c{}}{{AhF`}c{}}{{AhJ`}c{}}{{J`F`}c{}}{{J`J`}c{}}{{J`l}c{}}{{MlJ`}c{}}{{F`l}c{}}{{F`F`}c{}}{{{d{hAj}}J`}j}{{{d{hAj}}l}j}{{{d{hAj}}F`}j}{{{d{hAh}}J`}j}{{{d{hAh}}F`}j}{{{d{hJ`}}F`}j}{{{d{hJ`}}J`}j}{{{d{hJ`}}l}j}{{{d{hMl}}J`}j}{{{d{hF`}}F`}j}{{{d{hF`}}l}j}{{{d{c}}}e{}{}}00000000000{J`Aj}{F`Aj}{AjJ`}{F`J`}{{{d{c}}}Fb{}}00{{{d{c}}}Fd{}}00{AjF`}{J`F`}{Ahl}`{AhAj}00{{AhEf}Ah}{F`Ef}`{c{{Ff{e}}}{}{}}000000000000{{AhAh}{{Ed{Ah}}}}1111111111111{{{d{c}}}Fh{}}000000000000{{AhAh}Ah}{{{d{Nj}}c}{{Df{ll}}}{{Cn{{Df{ll}}}}}}8```````````{{{d{Od}}{d{hHh}}{d{Od}}}j}``````````````````````````````````{{{d{c}}}{{d{e}}}{}{}}000{{{d{hc}}}{{d{he}}}{}{}}000{{{d{{Of{c}}}}}{{Of{c}}}Oh}{{{d{Oj}}}Oj}{{{d{Jb}}}Jb}{{{d{{Ol{c}}}}}{{Ol{c}}}On}{{{d{c}}{d{he}}}j{}{}}000{{{d{c}}}j{}}00000{e{{Ol{c}}}{}{{H`{{d{Jb}}}{{Dn{c}}}}GhHb}}``{{}Oj}0{{}Jb}{Cj{{d{c}}}{}}000{Cj{{d{hc}}}{}}000{Cjj}000{{{d{hJb}}c}j{{Cn{Jb}}}}{{{d{Oj}}{d{hD`}}}Db}{{{d{{Ol{c}}}}{d{hD`}}}DbA@`}{cc{}}0{A@bJb}1{A@dJb}{A@fJb}{A@hJb}{A@jJb}{A@lJb}{A@nJb}{AA`Jb}{AAbJb}{AAdJb}{OjJb}{{{Df{llll}}}{{Ol{Nh}}}}{{{d{Ad}}}{{Ol{AAf}}}}{{{Dd{l}}}{{Ol{Nh}}}}{{{Df{llll}}}{{Ol{A`}}}}{{{Df{ll}}}{{Ol{A`}}}}{{{Dd{l}}}{{Ol{n}}}}{cc{}}{Fd{{Ol{AAf}}}}{AAhc{}}{l{{Ol{Nh}}}}{{{Dd{l}}}{{Ol{A`}}}}{{{Of{c}}}{{Ol{c}}}{}}9{{{Df{ll}}}{{Ol{Nh}}}}2{c{{Ol{c}}}{}}{Fb{{Ol{AAf}}}}{l{{Ol{n}}}}{l{{Ol{A`}}}}{{{Df{llll}}}{{Ol{n}}}}{{{d{Jb}}{Of{c}}}{{Ed{c}}}On}{{{d{{Ol{c}}}}{d{Jb}}}{{Ed{c}}}On}{{{d{Jb}}c{Of{c}}}cOn}{{{d{{Ol{c}}}}{d{Jb}}c}cOn}{{{d{Jb}}e{Of{c}}}cOn{{E`{}{{Dn{c}}}}}}{{{d{{Ol{c}}}}{d{Jb}}e}cOn{{E`{}{{Dn{c}}}}}}`{{}Cj}000{{{d{hJb}}{d{Ad}}{Ol{c}}}j{}}{{{d{hJb}}{d{Ad}}{d{Ad}}}j}{{{d{hJb}}JnJn}j}{{{d{hJb}}{d{Ad}}c}j{}}{ce{}{}}000{{{d{Ad}}}{{Ol{c}}}{}}{{}Oj}{{{d{Ad}}}{{Of{c}}}Oh}{{}Jb}``````{{{d{c}}}e{}{}}000{c{{Ff{e}}}{}{}}0000000{{{d{c}}}Fh{}}000{e{{Ol{c}}}{}{{Cn{c}}}}`````````````````````````````````````````````````````{{{d{AAf}}}AAj}{{{d{hIh}}}{{d{hIj}}}}{{{d{Ih}}}{{d{Ij}}}}{{{d{c}}}{{d{e}}}{}{}}00000000000{{{d{hc}}}{{d{he}}}{}{}}00000000000{{{d{Ih}}}J`}{{{d{Ij}}}J`}{{{d{AAl}}}AAl}{{{d{AAf}}}AAf}{{{d{AAn}}}AAn}{{{d{AB`}}}AB`}{{{d{ABb}}}ABb}{{{d{ABd}}}ABd}{{{d{ABf}}}ABf}{{{d{ABh}}}ABh}{{{d{ABj}}}ABj}{{{d{c}}{d{he}}}j{}{}}00000000{{{d{c}}}j{}}00000000000000`{{}AAf}{{}AAn}{{}AB`}{{}ABb}{{}ABd}{{}ABf}{{}ABh}{{}Id}{Cj{{d{c}}}{}}00000000000{Cj{{d{hc}}}{}}00000000000{{{d{hId}}{d{hAl}}{d{Ij}}bF`l}j}{Cjj}00000000000{{{d{AAf}}{d{AAf}}}Ch}{{{d{AAn}}{d{AAn}}}Ch}{{{d{AB`}}{d{AB`}}}Ch}{{{d{ABb}}{d{ABb}}}Ch}{{{d{ABd}}{d{ABd}}}Ch}{{{d{ABf}}{d{ABf}}}Ch}{{{d{ABh}}{d{ABh}}}Ch}`{{{d{ABl}}{d{hD`}}}Db}{{{d{AAl}}{d{hD`}}}Db}{{{d{AAf}}{d{hD`}}}Db}{{{d{AAn}}{d{hD`}}}Db}{{{d{AB`}}{d{hD`}}}Db}{{{d{ABb}}{d{hD`}}}Db}{{{d{ABd}}{d{hD`}}}Db}{{{d{ABf}}{d{hD`}}}Db}{{{d{ABh}}{d{hD`}}}Db}{{{d{Ih}}{d{hD`}}}Db}{{{d{Id}}{d{hD`}}}Db}{{{d{ABj}}{d{hD`}}}Db}``{cc{}}0{FdAAf}1{FbAAf}{{{d{Ad}}}AAf}33333333{{{d{ABn}}}ABj}{{{Nb{f}}}ABj}{{{d{Ad}}}ABj}6{AC`ABj}{{{d{{Ej{f}}}}}ABj}{IjIh}{{{d{AAf}}{d{hc}}}jDj}{{{d{AAn}}{d{hc}}}jDj}{{{d{AB`}}{d{hc}}}jDj}{{{d{ABb}}{d{hc}}}jDj}{{{d{ABd}}{d{hc}}}jDj}{{{d{ABf}}{d{hc}}}jDj}{{{d{ABl}}}{{d{Dh}}}}`{{}Cj}00000000000{{{d{hABl}}{d{hACb}}{d{hACd}}ACf}{{Ed{AAl}}}}{ce{}{}}00000000000`{{{d{hId}}c}{{Ff{jACh}}}{{Cn{ABj}}}}{N`ABl}{{{d{hId}}ll}Ih}{{}Id}{{{d{hId}}{d{Ij}}F`l}j}{{{d{Ih}}}{{d{Ij}}}}{{{d{hIh}}}{{d{hIj}}}}{{{d{Ih}}}Ah}{{{d{hIh}}ABd}j}{{{d{hIh}}{d{hId}}J`}j}{{{d{hIh}}{d{hId}}ll}j}{{{d{hIh}}{d{hId}}{d{Ad}}ABh}j}{{{d{hIh}}{d{hId}}ABf}j}{{{d{Ih}}}J`}```{ABdACj}{ABfACl}{{{d{ABh}}}ACn}{AAnAD`}{AB`ADb}{ABbADd}{{{d{c}}}e{}{}}00000000{c{{Ff{e}}}{}{}}00000000000000000000000{{{d{c}}}Fh{}}00000000000``````{{{d{c}}}{{d{e}}}{}{}}0{{{d{hc}}}{{d{he}}}{}{}}0{{{d{ADf}}}ADf}{{{d{ADh}}}ADh}{{{d{c}}{d{he}}}j{}{}}0{{{d{c}}}j{}}000{{{d{ADh}}lCh}Ch}{{}ADf}{{}ADh}{Cj{{d{c}}}{}}0{Cj{{d{hc}}}{}}0{Cjj}0`{lADh}0`{{{d{ADf}}{d{ADf}}}Ch}{{{d{ADh}}{d{ADh}}}Ch}{{ADfl}l}{{{d{ADf}}{d{hD`}}}Db}{{{d{ADh}}{d{hD`}}}Db}{cc{}}0{{{d{ADh}}l}l}{{{d{ADf}}{d{hc}}}jDj}{{}Cj}0{ce{}{}}0::{{{d{ADh}}{d{hl}}Chl}Ch}{{{d{c}}}e{}{}}0{c{{Ff{e}}}{}{}}000{{{d{c}}}Fh{}}0```````````````````````````{{}ADj}{{}ADl}{e{{Fn{Mn}}}{}{{Mn{c}}}}{{{d{Mn}}}{{d{Gf}}}}{{{d{c}}}{{d{Gf}}}{}}{{{d{Dl}}}Jn}{{ADjADj}ADj}{{ADlADl}ADl}{{{d{hADj}}ADj}j}{{{d{hADl}}ADl}j}3210{{{d{ADj}}}f}0{{{d{ADl}}}f}05432{{{d{c}}}{{d{e}}}{}{}}0000000{{{d{hc}}}{{d{he}}}{}{}}0000000{{{d{h{AE`{}{{ADn{c}}}}}}{d{hHf}}{d{he}}}{{Df{c{Nb{If}}}}}{}{}}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hHf}}{d{he}}}c{}Oh}{{{d{h{AEd{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AEf{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AEh{e}}}}{d{hHf}}{d{hc}}}{{AEj{ce}}}{}{{AE`{c}}}}{{{d{{AEf{c}}}}}{{AEf{c}}}On}{{{d{{AEh{c}}}}}{{AEh{c}}}On}{{{d{ADj}}}ADj}{{{d{ADl}}}ADl}{{{d{Dl}}}Dl}{{{d{c}}{d{he}}}j{}{}}0000{{{d{c}}}j{}}000000000{{{d{Dl}}{d{Dl}}}AEl}{ADjADj}{ADlADl}{{{d{ADj}}ADj}Ch}{{{d{ADl}}ADl}Ch}{{{d{If}}}Ch}{{{d{If}}}{{Ed{Il}}}}{{}ADj}{{}ADl}{{}Dl}{{}If}{{{d{{AEn{ce}}}}}{{d{g}}}{}{{AEb{c}}Oh}{}}{Cj{{d{c}}}{}}0{{{d{{AEj{ce}}}}}{{d{g}}}{}{{AE`{c}}}{}}1{{{d{{AEf{c}}}}}{{d{e}}}{}{}}2{{{d{{AEh{c}}}}}{{d{e}}}{}{}}3333{Cj{{d{hc}}}{}}{{{d{h{AEn{ce}}}}}{{d{hg}}}{}{{AEb{c}}Oh}{}}1{{{d{h{AEj{ce}}}}}{{d{hg}}}{}{{AE`{c}}}{}}{{{d{h{AEf{c}}}}}{{d{he}}}{}{}}3{{{d{h{AEh{c}}}}}{{d{he}}}{}{}}44444{{ADjADj}ADj}{{ADlADl}ADl}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hc}}{d{hHl}}{d{he}}}j{}Oh}{{{d{h{AEd{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AEf{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AE`{}{{ADn{c}}}}}}Cj{d{hc}}{d{hHl}}{d{he}}}j{}{}}{{{d{h{AEh{e}}}}Cj{d{h{AEj{ce}}}}{d{hHl}}{d{hc}}}j{}{{AE`{c}}}}{Cjj}0000000{{{d{hMn}}{d{hHf}}{d{hc}}}{{Fn{Gf}}}{}}{{{d{hc}}{d{hHf}}{d{he}}}{{Fn{Gf}}}{}{}}{{{d{hMn}}{d{hAF`}}{d{hHl}}{d{hc}}}j{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHl}}{d{he}}}j{}{}}{{{d{hMn}}{d{hAF`}}{d{hHd}}{d{hc}}{d{Lj}}}j{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{hMn}}{d{hAF`}}{d{hHj}}{d{hc}}Ml}J`{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{hMn}}{d{hAF`}}{d{hHh}}{d{hc}}{d{Mn}}}j{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHh}}{d{he}}{d{Mn}}}j{}{}}{{}ADj}{{}ADl}{{{d{{AEf{c}}}}{d{{AEf{c}}}}}ChAFb}{{{d{{AEh{c}}}}{d{{AEh{c}}}}}ChAFb}{{{d{ADj}}{d{ADj}}}Ch}{{{d{ADl}}{d{ADl}}}Ch}{{{d{Dl}}{d{Dl}}}Ch}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}Oh}{{{d{h{AEd{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AEf{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AE`{}{{ADn{c}}}}}}Cj{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{h{AEh{e}}}}Cj{d{h{AEj{ce}}}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AE`{c}}}}{{{d{hADj}}c}j{{AFd{}{{El{ADj}}}}}}{{{d{hADl}}c}j{{AFd{}{{El{ADl}}}}}}{{{d{If}}}ADl}{{{d{{AEf{c}}}}{d{hD`}}}DbA@`}{{{d{{AEh{c}}}}{d{hD`}}}DbA@`}{{{d{ADj}}{d{hD`}}}Db}0000{{{d{ADl}}{d{hD`}}}Db}0000{{{d{Dl}}{d{hD`}}}Db}0{{{d{If}}{d{hD`}}}Db}{cc{}}0{c{{AEf{c}}}{}}1{AAhc{}}2{c{{AEh{c}}}{}}13333{f{{Ed{ADj}}}}{f{{Ed{ADl}}}}{fADj}0{fADl}010{cADj{{AFd{}{{El{ADj}}}}}}{cADl{{AFd{}{{El{ADl}}}}}}{{{d{Ad}}}{{Ed{ADj}}}}{{{d{Ad}}}{{Ed{ADl}}}}{{{d{If}}}{{Ed{{d{c}}}}}{}}{{{d{hIf}}}{{Ed{{d{hc}}}}}{}}{{{d{{AEj{ce}}}}}Ch{}{{AE`{c}}}}{{{d{If}}}Ch}00{{{d{{AEf{c}}}}{d{he}}}jLlDj}{{{d{{AEh{c}}}}{d{he}}}jLlDj}{{{d{ADj}}{d{hc}}}jDj}{{{d{ADl}}{d{hc}}}jDj}{{{d{Dl}}{d{hc}}}jDj}{{{d{If}}}Dl}{{{d{If}}}{{Ed{{d{In}}}}}}{{}Cj}0000000{{{d{hADj}}ADj}j}{{{d{hADl}}ADl}j}{{{d{hIf}}c}j{}}{{ADjADj}ADj}{{ADlADl}ADl}{{{d{ADj}}ADj}Ch}{{{d{ADl}}ADl}Ch}{ce{}{}}0000000{ADjc{}}{ADlc{}}{{{d{If}}}Ch}{{{d{ADj}}}Ch}{{{d{ADl}}}Ch}{{{d{{AEh{e}}}}}Ch{}{{AE`{c}}}}21333{{{d{ADj}}}{{AFf{ADj}}}}{{{d{ADl}}}{{AFf{ADl}}}}{{{d{ADj}}}{{AFh{ADj}}}}{{{d{ADl}}}{{AFh{ADl}}}}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hc}}{d{hHj}}{d{he}}Ml}J`{}Oh}{{{d{h{AEd{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AEf{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AE`{}{{ADn{c}}}}}}Cj{d{hc}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{h{AEh{e}}}}Cj{d{h{AEj{ce}}}}{d{hHj}}{d{hc}}Ml}J`{}{{AE`{c}}}}{{{d{{AE`{}{{ADn{c}}}}}}}Cj{}}{{{d{{AEh{e}}}}}Cj{}{{AE`{c}}}}{{{d{hIf}}}j}00???{c{{AEf{c}}}{}}{c{{AEh{c}}}{}}{{}Dl}{DlIf}{ADjADj}{ADlADl}{{{d{Dl}}{d{Dl}}}{{Ed{AEl}}}}67{{{d{hIf}}{d{hIf}}}j}{{{d{hIf}}c}{{d{hc}}}{}}{{{d{hIf}}}{{d{hc}}}Ib}{{{d{hIf}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{h{AE`{}{{ADn{c}}}}}}{d{hc}}{d{hHf}}{d{he}}{d{{AE`{}{{ADn{c}}}}}}}j{}{}}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hc}}{d{hHh}}{d{he}}{d{{AEb{}{{ADn{c}}}}}}}j{}Oh}{{{d{h{AEd{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AEd{c}}}}}j{}{}}{{{d{h{AEf{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AEf{e}}}}}j{}{{AEb{c}}}{}}{{{d{h{AEh{e}}}}{d{h{AEj{ce}}}}{d{hHf}}{d{hc}}{d{{AEh{e}}}}}j{}{{AE`{c}}}}{{{d{h{AE`{}{{ADn{c}}}}}}Cj{d{hc}}{d{hHh}}{d{he}}{d{{AE`{}{{ADn{c}}}}}}}j{}{}}{{{d{h{AEh{e}}}}Cj{d{h{AEj{ce}}}}{d{hHh}}{d{hc}}{d{{AEh{e}}}}}j{}{{AE`{c}}}}{{{d{If}}}Ah}{{{d{hADj}}ADj}j}{{{d{hADl}}ADl}j}{{{d{hIf}}}{{Ed{c}}}{}}{{{d{hIf}}}j}00{{{d{hADj}}ADjCh}j}{{{d{hADl}}ADlCh}j}{{{d{hIf}}Ch}j}{{{d{hIf}}{Ed{Il}}}j}111{{{d{hIf}}{Ed{In}}}j}{{{d{hIf}}J`}j}{{{d{hIf}}Ef}j}{{{d{If}}}J`}{{ADjADj}ADj}{{ADlADl}ADl}=<10{{{d{c}}}e{}{}}0000{{{d{c}}}Fb{}}{{{d{c}}}Fd{}}{{{d{hADj}}ADj}j}{{{d{hADl}}ADl}j}{{{d{If}}}Ef}{{{d{hIf}}F`}j}{c{{Ff{e}}}{}{}}000000000000000{{{d{c}}}Fh{}}0000000:9{{{d{If}}}ADj}`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{AFj{ce}}g}{{AFj{ce}}}{}{}{{AFl{{d{hHf}}{d{hc}}}}}}{{{AFn{ce}}g}{{AFn{ce}}}{}{}{{AFl{{d{hHd}}{d{hc}}{d{Lj}}}}}}``{{ce}{{AG`{e}}}{{Cn{Nd}}}{}}{{{AGb{c}}e}{{AGb{c}}}{}{{Cn{Nf}}}}{{AGdc}AGd{{Cn{{Ol{ABd}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{ABd}}}}}}{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{Nf}}}}`````````{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{b}}}}}}``{{{AGl{c}}l}{{AGl{c}}}{}}`{i{{AGn{egc}}}{}{}{}{{AFl{{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}{{Dn{{Ed{g}}}}}}}}`{Nj{{AGb{{Nb{{Fn{Mn}}}}}}}}{Nj{{AGh{{Nb{{Fn{Mn}}}}}}}}{{}{{AGb{{Nb{{Fn{Mn}}}}}}}}0{{{d{c}}}{{d{Gf}}}{}}00000000000000000000000000000000`{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{Nj}}}}{{{AGb{c}}e}{{AGb{c}}}{}{{Cn{Nj}}}}{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{Nj}}}}````{{ce}{{AHb{e}}}{{Cn{{Ol{b}}}}}{}}{{AHdc}AHd{{Cn{{Ol{b}}}}}}{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{Cn{{Ol{b}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{b}}}}}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{b}}}}}}``````````{{{AFn{ce}}g}{{AFn{ce}}}{}{}{{AFl{{d{hHd}}{d{hc}}{d{Lj}}}}}}`{{{AHh{c}}e}{{AHh{c}}}{}{{Cn{{Ol{b}}}}}}54{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{b}}}}}}43``````````````{{{AHh{c}}e}{{AHh{c}}}{}{{Cn{{Ol{n}}}}}}{{AHdc}AHd{{Cn{{Ol{n}}}}}}{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{Cn{{Ol{n}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{n}}}}}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{n}}}}}}``````````````{{{AHh{c}}e}{{AHh{c}}}{}{{Cn{{Ol{A`}}}}}}{{AHdc}AHd{{Cn{{Ol{A`}}}}}}{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{Cn{{Ol{A`}}}}}}{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{l}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{A`}}}}}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{A`}}}}}}``````````````{{{d{c}}}{{d{e}}}{}{}}00000000000000000000000000000000000000000000{{{d{hc}}}{{d{he}}}{}{}}00000000000000000000000000000000000000000000{c{{AG`{c}}}{}}00{{{d{h{AGn{ceg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHj{ce}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHl{ceg}}}}{d{hHf}}{d{hc}}}i{}{}{{AEb{e}}}{}}{{{d{h{AHn{ceg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}AFb{}}{{{d{h{AI`{c}}}}{d{hHf}}{d{he}}}gAEb{}{}}{{{d{h{AIb{ce}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AId{eg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIf{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AIh{ceg}}}}{d{hHf}}{d{hc}}}i{}{}{{AEb{{Df{ce}}}}}{}}{{{d{h{AIj{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AIl{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHh{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{hAHd}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AIn{ceg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{h{AHf{ceg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{h{AGj{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AJ`{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHb{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AGl{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AJb{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AJd{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AJf{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AH`{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AGb{e}}}}{d{hHf}}{d{hc}}}g{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AGf{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AJh{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AJj{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hHf}}{d{hc}}}g{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hHf}}{d{hc}}}g{}{{AE`{c}}}{}}{c{{AHh{c}}}{}}{{{AIn{ceg}}i}{{AIn{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{{Ed{Kf}}}}}}``{c{{AG`{c}}}{}}{ChAHd}{{AHdc}AHd{{Cn{Ch}}}}`{{lc}{{AJd{e}}}{{Cn{Bf}}}{}}{{{d{AJn}}}AJn}{{{d{AK`}}}AK`}{{{d{c}}{d{he}}}j{}{}}0{{{d{c}}}j{}}000{{ce}{{AHf{gce}}}{}{}{}}{{{AHh{c}}e}{{AHh{c}}}{}{{Cn{{Ol{b}}}}}}{{AHdc}AHd{{Cn{{Ol{b}}}}}}{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{b}}}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{b}}}}}}{{AGdc}AGd{{Cn{{Ol{b}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{b}}}}}}```````````````{{}{{AGj{c}}}{}}{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{l}}}}`{{ce}{{AJ`{e}}}{{Cn{Ml}}}{}}{c{{AHb{c}}}{}}{{{AIn{ceg}}i}{{AIn{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{{AEf{e}}}}}}``````````````````````4{{}AK`}{{}{{AGf{c}}}{}}{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{Cn{Ch}}}}```{Cj{{d{c}}}{}}0000000000000000000000000000{{{d{{AJb{c}}}}}{{d{e}}}{}{}}1111111111111111{Cj{{d{hc}}}{}}0000000000000000000000000000{{{d{h{AJb{c}}}}}{{d{he}}}{}{}}1111111111111111{{{AIn{ceg}}i}{{AIn{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{Ch}}}}`{{{d{h{AGn{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHj{ce}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHl{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{}{{AEb{e}}}{}}{{{d{h{AHn{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}AFb{}}{{{d{h{AI`{c}}}}{d{he}}{d{hHl}}{d{hg}}}jAEb{}{}}{{{d{h{AIb{ce}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AId{eg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIf{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AIh{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{}{{AEb{{Df{ce}}}}}{}}{{{d{h{AIj{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AIl{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHh{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{hAHd}}{d{hc}}{d{hHl}}{d{he}}}j{}{}}{{{d{h{AIn{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{h{AHf{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{h{AGj{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AJ`{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHb{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AGl{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AJb{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{AJd{c}}e}{{AJd{c}}}{}{{Cn{{Fn{AFl}}}}}}{{{d{h{AJd{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AJf{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AH`{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AGb{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hc}}{d{hHl}}{d{he}}}j{}{}}{{{d{h{AGf{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AJh{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AJj{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AE`{c}}}{}}`{Cjj}00000000000000000000000000000000000000000000{{{d{hc}}{d{hHf}}{d{he}}}{{Fn{Gf}}}{}{}}00000000000000000000000000000000{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHl}}{d{he}}}j{}{}}00000000000000000000000000000000{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}00000000000000000000000000000000{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHj}}{d{he}}Ml}J`{}{}}00000000000000000000000000000000{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHh}}{d{he}}{d{Mn}}}j{}{}}00000000000000000000000000000000{{J`c}{{AJd{e}}}{{Cn{Bf}}}{}}{{{d{AJn}}{d{AJn}}}Ch}{{{d{h{AGn{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHj{ce}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHl{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}{{AEb{e}}}{}}{{{d{h{AHn{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}AFb{}}{{{d{h{AI`{c}}}}{d{he}}{d{hHd}}{d{hg}}{d{Lj}}}jAEb{}{}}{{{d{h{AIb{ce}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AId{eg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIf{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AIh{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}{{AEb{{Df{ce}}}}}{}}{{{d{h{AIj{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AIl{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHh{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{hAHd}}{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{AIn{ceg}}i}{{AIn{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{AJn}}}}{{{d{h{AIn{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{h{AHf{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{h{AGj{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AJ`{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHb{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AGl{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AJb{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AJd{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AJf{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AH`{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AGb{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{h{AGf{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AJh{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AJj{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AE`{c}}}{}}`{c{{AGl{c}}}{}}{{{AId{jc}}e}{{AId{ec}}}{}{}}{{{AHh{c}}e}{{AHh{c}}}{}{{Cn{{Ol{l}}}}}}``2`{{{d{AJn}}{d{hD`}}}Db}{{{d{AK`}}{d{hD`}}}Db}{{gi}{{AHl{cei}}}{}{}{{AFl{{d{hc}}{d{h{AKb{e}}}}}}}{{AEb{e}}}}{{AGdc}AGd{{Cn{{Ol{AAf}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{AAf}}}}}}``````{{AGdc}AGd{{Cn{{Ol{l}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{l}}}}}}``````{{AGdc}AGd{{Cn{{Ol{AB`}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{AB`}}}}}}``````{{AGdc}AGd{{Cn{{Ol{ABb}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{ABb}}}}}}``````{{AGdc}AGd{{Cn{{Ol{AAn}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{AAn}}}}}}```````{cc{}}00000000000000000000000000000000000{AKdAGd}111111111{{{AGb{c}}e}{{AGb{c}}}{}{{Cn{l}}}}{{{AGh{c}}l}{{AGh{c}}}{}}`{{{d{AJn}}{d{hc}}}jDj}`{{lc}{{AJ`{c}}}{}}{{{AJ`{c}}l}{{AJ`{c}}}{}}{c{{AGb{c}}}{}}{c{{AGh{c}}}{}}{{}{{AGh{{Nb{{Fn{Mn}}}}}}}}{{}{{AGh{{Nb{c}}}}}{}}{c{{AJf{c}}}{}}4``{{}{{AGb{{Nb{{Fn{Mn}}}}}}}}{{}{{AGb{{Nb{c}}}}}{}}5``43{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{Cn{{Ol{b}}}}}}``{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{Cn{{Ol{l}}}}}}``{{}Cj}00000000000000000000000000000000000000000000``{ce{}{}}00000000000000000000000000000000000000000000{{{d{{AGb{{Nb{c}}}}}}}Ch{}}{{{d{{AGh{{Nb{c}}}}}}}Ch{}}`{{{AGb{c}}e}{{AGb{c}}}{}{{Cn{Nl}}}}{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{Nl}}}}``0```{{{d{h{AGn{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHj{ce}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHl{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{}{{AEb{e}}}{}}{{{d{h{AHn{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}AFb{}}{{{d{h{AI`{c}}}}{d{he}}{d{hHj}}{d{hg}}Ml}J`AEb{}{}}{{{d{h{AIb{ce}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AId{eg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIf{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AIh{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{}{{AEb{{Df{ce}}}}}{}}{{{d{h{AIj{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AIl{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHh{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{hAHd}}{d{hc}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{h{AIn{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{h{AHf{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{h{AGj{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AJ`{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHb{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AGl{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AJb{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AJd{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AJf{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AH`{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AGb{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hc}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{h{AGf{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AJh{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AJj{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AE`{c}}}{}}{c{{AG`{c}}}{}}{{{d{{AGb{{Nb{c}}}}}}}Cj{}}{{{d{{AGh{{Nb{c}}}}}}}Cj{}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{l}}}}}}``{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{b}}}}}}``{{AGdc}AGd{{Cn{{Ol{l}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{l}}}}}}``````{{{AIn{ceg}}i}{{AIn{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{{AKh{{AKf{}{{Dn{c}}}}}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{Ch}}}}}}``{{lc}{{AJ`{c}}}{}}{{{AJ`{c}}l}{{AJ`{c}}}{}}{{ce}{{AJ`{e}}}{{Cn{J`}}}{}}{{{AJ`{c}}e}{{AJ`{c}}}{}{{Cn{J`}}}}32{{gk}{{AHn{cie}}}{}AFb{{E`{{d{hc}}}{{Dn{e}}}}}{{AEb{c}}}{{E`{{d{hc}}}{{Dn{i}}}}}}432143{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{Ch}}}}`{i{{AGn{egc}}}{}{}{}{{AFl{{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}{{Dn{{Ed{g}}}}}}}}{c{{AFj{ec}}}{}{}}{c{{AHj{ec}}}{}{}}{c{{AFn{ec}}}{}{}}{{ci}{{AHl{egc}}}{}{}{}{{AFl{{d{he}}{d{h{AKb{g}}}}}}}}6{c{{AI`{c}}}AEb}{{cg}{{AIb{ec}}}{}{}{{AFl{{d{hHh}}{d{he}}}}}}{c{{AId{jc}}}{GjGh}}{c{{AIf{c}}}{}}{{ek}{{AIh{gci}}}{}{{AFl{}{{Dn{c}}}}}{}{}{{AFl{{d{hg}}{d{hc}}}{{Dn{i}}}}}}{{Jbc}{{AIj{c}}}{}}{{Ndc}{{AG`{c}}}{}}{{cl}{{AIl{c}}}{}}{c{{AHh{c}}}{}}{ChAHd}{{eAJng}{{AIn{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}}{{ce}{{AHf{gce}}}{}{}{}}{{}{{AGj{c}}}{}}{{Mlc}{{AJ`{c}}}{}}{c{{AHb{c}}}{}}{{lChc}{{AGl{c}}}{}}{{ce}{{AJb{e}}}{{Cn{Nh}}}{}}{e{{AJd{c}}}{}{{AFl{{d{hHl}}{d{hc}}}}}}{{Njc}{{AJf{c}}}{}}{l{{AH`{c}}}{}}{{Njc}{{AGb{c}}}{}}{cAGd{{Cn{Fb}}}}{{}{{AGf{c}}}{}}{{ce}{{AJh{c}}}{}{{Cn{Fb}}}}{{Efc}{{AJj{c}}}{}}{{Njc}{{AGh{c}}}{}}{c{{AJl{c}}}{}}{{cg}{{AFj{ec}}}{}{}{{AFl{{d{hHf}}{d{he}}}}}}{{eg}{{AIn{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}}{{cg}{{AHj{ec}}}{}{}{{AFl{{d{hHl}}{d{he}}}}}}{{{AHj{ce}}g}{{AHj{ce}}}{}{}{{AFl{{d{hHl}}{d{hc}}}}}}`{{cg}{{AFn{ec}}}{}{}{{AFl{{d{hHd}}{d{he}}{d{Lj}}}}}}0{{{AGj{c}}e}{{AGj{c}}}{}{{AFl{{d{hHd}}{d{hc}}b}}}}{{{AH`{c}}e}{{AH`{c}}}{}{{AFl{{d{hHd}}{d{hc}}l}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{AFl{{d{hHd}}{d{hc}}Fd}}}}```{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{AFl{{d{hHd}}{d{hc}}Ch}}}}`7{{cg}{{AIb{ec}}}{}{}{{AFl{{d{hHh}}{d{he}}}}}}82`{c{{AI`{c}}}AEb}{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{Cn{{Ed{Ch}}}}}}`{{ce}{{AJb{e}}}{{Cn{Nh}}}{}}{{lc}{{AJb{c}}}{}}000{{{AHh{c}}e}{{AHh{c}}}{}{{Cn{{Ol{Nh}}}}}}`````{e{{AJd{c}}}{}{{AFl{{d{hHl}}{d{hc}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{Fd}}}}`{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{b}}}}}}``{{{d{h{AGb{{Nb{c}}}}}}c}j{}}{{{d{h{AGh{{Nb{c}}}}}}c}j{}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{AKj{l}}}}}}`{{{d{h{AGn{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AGn{ceg}}}}}j{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AFj{ce}}}}}j{}{{AEb{c}}}{}}{{{d{h{AHj{ce}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AHj{ce}}}}}j{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AFn{ce}}}}}j{}{{AEb{c}}}{}}{{{d{h{AHl{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AHl{ceg}}}}}j{}{}{{AEb{e}}}{}}{{{d{h{AHn{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AHn{ceg}}}}}j{}{{AEb{c}}}AFb{}}{{{d{h{AI`{c}}}}{d{he}}{d{hHh}}{d{hg}}{d{{AI`{c}}}}}jAEb{}{}}{{{d{h{AIb{ce}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AIb{ce}}}}}j{}{{AEb{c}}}{}}{{{d{h{AId{eg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AId{eg}}}}}j{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIf{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AIf{e}}}}}j{}{{AEb{c}}}{}}{{{d{h{AIh{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AIh{ceg}}}}}j{}{}{{AEb{{Df{ce}}}}}{}}{{{d{h{AIj{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AIj{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AG`{c}}}}{d{hHh}}{d{{AG`{c}}}}}j{}}{{{d{h{AG`{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AG`{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AIl{c}}}}{d{hHh}}{d{{AIl{c}}}}}j{}}{{{d{h{AIl{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AIl{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AHh{c}}}}{d{hHh}}{d{{AHh{c}}}}}j{}}{{{d{h{AHh{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AHh{e}}}}}j{}{{AEb{c}}}{}}{{{d{hAAb}}{d{{AHh{c}}}}{d{hHh}}}j{}}{{{d{AHd}}{d{hHh}}{d{AHd}}}j}{{{d{hAHd}}{d{hc}}{d{hHh}}{d{he}}{d{AHd}}}j{}{}}{{{d{hA@l}}{d{AHd}}{d{hHh}}}j}{{{d{h{AIn{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AIn{ceg}}}}}j{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{{AIn{ceg}}}}{d{hHh}}{d{{AIn{ceg}}}}}j{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}}{{{d{{AHf{ceg}}}}{d{hHh}}{d{{AHf{ceg}}}}}j{}{}{}}{{{d{h{AHf{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AHf{ceg}}}}}j{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{hA@h}}{d{{AHf{ceg}}}}{d{hHh}}}j{}{}{}}{{{d{h{AGj{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AGj{c}}}}}j{}{}}{{{d{{AGj{c}}}}{d{hHh}}{d{{AGj{c}}}}}j{}}{{{d{hA@d}}{d{{AGj{c}}}}{d{hHh}}}j{}}{{{d{{AJ`{c}}}}{d{hHh}}{d{{AJ`{c}}}}}j{}}{{{d{h{AJ`{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJ`{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AHb{c}}}}{d{hHh}}{d{{AHb{c}}}}}j{}}{{{d{h{AHb{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AHb{e}}}}}j{}{{AEb{c}}}{}}{{{d{hAAd}}{d{{AHb{c}}}}{d{hHh}}}j{}}{{{d{h{AGl{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AGl{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AGl{c}}}}{d{hHh}}{d{{AGl{c}}}}}j{}}{{{d{h{AJb{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJb{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AJb{c}}}}{d{hHh}}{d{{AJb{c}}}}}j{}}{{{d{h{AJd{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AJd{c}}}}}j{}{}}{{{d{{AJd{c}}}}{d{hHh}}{d{{AJd{c}}}}}j{}}{{{d{h{AJf{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJf{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AJf{c}}}}{d{hHh}}{d{{AJf{c}}}}}j{}}{{{d{hA@j}}{d{{AJf{c}}}}{d{hHh}}}j{}}{{{d{{AH`{c}}}}{d{hHh}}{d{{AH`{c}}}}}j{}}{{{d{h{AH`{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AH`{c}}}}}j{}{}}{{{d{hA@n}}{d{{AH`{c}}}}{d{hHh}}}j{}}{{{d{h{AGb{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AGb{e}}}}}j{}{{AE`{c}}}{}}{{{d{{AGb{c}}}}{d{hHh}}{d{{AGb{c}}}}}j{}}{{{d{hAGd}}{d{hc}}{d{hHh}}{d{he}}{d{AGd}}}j{}{}}{{{d{hA@f}}{d{AGd}}{d{hHh}}}j}{{{d{h{AGf{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AGf{c}}}}}j{}{}}{{{d{hA@b}}{d{{AGf{c}}}}{d{hHh}}}j{}}{{{d{h{AJh{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJh{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AJh{c}}}}{d{hHh}}{d{{AJh{c}}}}}j{}}{{{d{hAA`}}{d{{AJh{c}}}}{d{hHh}}}j{}}{{{d{{AJj{c}}}}{d{hHh}}{d{{AJj{c}}}}}j{}}{{{d{h{AJj{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJj{e}}}}}j{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AGh{e}}}}}j{}{{AE`{c}}}{}}{{{d{{AGh{c}}}}{d{hHh}}{d{{AGh{c}}}}}j{}}{{{d{h{AJl{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJl{e}}}}}j{}{{AE`{c}}}{}}`{{J`c}{{AJd{e}}}{{Cn{Bf}}}{}}{c{{AG`{c}}}{}}{{lc}{{AJj{c}}}{}}0{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{l}}}}`{{ce}{{AJj{e}}}{{Cn{F`}}}{}}{{ce}{{AJ`{e}}}{{Cn{J`}}}{}}{{AHdc}AHd{{Cn{{Ol{l}}}}}}{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{l}}}}}}{{{AJd{c}}e}{{AJd{c}}}{}{{Cn{{Ed{J`}}}}}}`````{l{{AH`{c}}}{}}2```3```{{{d{{AHh{c}}}}{d{Jb}}}AAb{}}{{{d{AHd}}{d{Jb}}}A@l}{{{d{{AHf{ceg}}}}{d{Jb}}}A@h{}{}{}}{{{d{{AGj{c}}}}{d{Jb}}}A@d{}}{{{d{{AHb{c}}}}{d{Jb}}}AAd{}}{{{d{{AJf{c}}}}{d{Jb}}}A@j{}}{{{d{{AH`{c}}}}{d{Jb}}}A@n{}}{{{d{AGd}}{d{Jb}}}A@f}{{{d{{AGf{c}}}}{d{Jb}}}A@b{}}{{{d{{AJh{c}}}}{d{Jb}}}AA`{}}{c{{AId{jc}}}{GjGh}}{cAGd{{Cn{Fb}}}}{{AGdc}AGd{{Cn{Fb}}}}{{{AGf{c}}e}{{AGf{c}}}{}AKl}````{{}{{AGf{c}}}{}}`{{{d{c}}}e{}{}}0{{ce}{{AJh{c}}}{}{{Cn{Fb}}}}{c{{AG`{c}}}{}}00{{Efc}{{AJj{c}}}{}}`{{ADhChg}{{AGn{cel}}}{}{}{{AFl{{d{hHd}}{d{hc}}l}{{Dn{e}}}}}}{{{AHh{c}}e}{{AHh{c}}}{}{{Cn{{Ol{ADh}}}}}}{{AHdc}AHd{{Cn{{Ol{ADh}}}}}}{{{AHf{ceg}}i}{{AHf{ceg}}}{}{}{}{{Cn{{Ol{ADh}}}}}}````````{{ADhg}{{AGn{cel}}}{}{}{{AFl{{d{hHd}}{d{hc}}l}{{Dn{e}}}}}}00{{ce}{{AJj{e}}}{{Cn{F`}}}{}}{c{{AIf{c}}}{}}{c{{Ff{e}}}{}{}}00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{d{c}}}Fh{}}00000000000000000000000000000000000000000000{c{{AJ`{c}}}{}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{l}}}}`{Nj{{AGb{{Nb{c}}}}}{}}{Nj{{AGh{{Nb{c}}}}}{}}{{}{{AGb{{Nb{c}}}}}{}}0{c{{AGb{c}}}{}}{c{{AGh{c}}}{}}{{}{{AGh{{Nb{{Fn{Mn}}}}}}}}{{}{{AGh{{Nb{c}}}}}{}}{c{{AJf{c}}}{}}4``{{}{{AGb{{Nb{{Fn{Mn}}}}}}}}64``32{{lc}{{AJ`{c}}}{}}{{{AJ`{c}}l}{{AJ`{c}}}{}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{l}}}}}}````{{{AGb{{Nb{c}}}}c}{{AGb{{Nb{c}}}}}{}}{{{AGh{{Nb{c}}}}c}{{AGh{{Nb{c}}}}}{}}{{ei}{{`{{AEb{k}}}}}{}{{AFl{}{{Dn{c}}}}}{{AEb{c}}}{{AFl{{d{hc}}}{{Dn{g}}}}}{}}{g{{`{{AEb{i}}}}}Ib{{AEb{c}}}{{AFl{{d{hc}}}{{Dn{e}}}}}{}}{{ek}{{AIh{gci}}}{}{{AFl{}{{Dn{c}}}}}{}{{AEb{{Df{gc}}}}}{{AFl{{d{hg}}{d{hc}}}{{Dn{i}}}}}}{i{{AIh{ceg}}}{}Ib{{AEb{{Df{ce}}}}}{{AFl{{d{hc}}{d{he}}}{{Dn{g}}}}}}{{cg}{{AIj{g}}}{{Cn{Jb}}}{}{{AEb{e}}}}{e{{`{{AEb{{Df{gc}}}}}}}{}{{AEb{c}}}{}}{e{{`{{AEb{{Df{cg}}}}}}}{}{{AEb{c}}}{}}{{AGdc}AGd{{Cn{{Ol{ABf}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{ABf}}}}}}``````{c{{AJl{c}}}{}}`````````````````````````````````````````````````````````{{{d{c}}}{{d{e}}}{}{}}000000{{{d{hc}}}{{d{he}}}{}{}}000000{{{d{Il}}}Il}{{{d{AKn}}}AKn}{{{d{AL`}}}AL`}{{{d{ALb}}}ALb}{{{d{Jd}}}Jd}{{{d{ALd}}}ALd}{{{d{ALf}}}ALf}{{{d{c}}{d{he}}}j{}{}}000000{{{d{c}}}j{}}000000000{{Jdc}Jd{{Cn{{Ed{b}}}}}}``{{JdCh}Jd}``{{}Il}{{}AL`}{{}ALb}{{}Jd}{Cj{{d{c}}}{}}000000{Cj{{d{hc}}}{}}000000{{{d{ALf}}{d{Jd}}}{{Nb{ALd}}}}{Cjj}000000{{{d{Il}}{d{Il}}}Ch}{{{d{AKn}}{d{AKn}}}Ch}{{{d{AL`}}{d{AL`}}}Ch}{{{d{ALb}}{d{ALb}}}Ch}{{{d{ALd}}{d{ALd}}}Ch}{JdJd}{{{d{Il}}{d{hD`}}}Db}{{{d{AKn}}{d{hD`}}}Db}{{{d{AL`}}{d{hD`}}}Db}0{{{d{ALb}}{d{hD`}}}Db}{{{d{Jd}}{d{hD`}}}Db}{{{d{ALd}}{d{hD`}}}Db}{{{d{ALf}}{d{hD`}}}Db}{cc{}}000000{{{d{Jd}}Jl}{{Ed{{d{AKn}}}}}}{{{d{hJd}}Jl}{{Ed{{d{hAKn}}}}}}{{{d{Il}}{d{hc}}}jDj}{{{d{AL`}}{d{hc}}}jDj}{{{d{Jd}}}N`}`{{Jdc}Jd{{Cn{{Ed{Dh}}}}}}``{{{d{AKn}}}Jl}{{{d{Jd}}}AL`}{{}Cj}000000{ce{}{}}000000{{{d{Jd}}Dl}Ch}{{{d{Jd}}JlKf}Ch}{{{d{AKn}}Kf}Ch}{{JdCh}Jd}``{{{d{hJd}}JlAj}F`}{Il{{d{Ad}}}}{{JlAj}AKn}{{}AL`}{{}Jd}{{{d{Jd}}}J`}{{{d{Jd}}}{{d{{Ej{AKn}}}}}}{{{d{hJd}}}{{d{h{Nb{AKn}}}}}}`{{{d{hAKn}}Kf}j}{{{d{hJd}}JlKf}j}{{{d{hAKn}}Kf}Ch}{{{d{hJd}}JlKf}Ch}{{{d{hJd}}Jl}j}=``{{Jdl}Jd}``{{JdN`N`}Jd}``{{JdALb}Jd}`{{{d{Jd}}}ALf}{{Jdc}JdAKl}``{{{d{c}}}e{}{}}000000{{{d{c}}}Fb{}}{{{d{c}}}Fd{}}{c{{Ff{e}}}{}{}}0000000000000{{{d{c}}}Fh{}}000000{{{d{hJd}}}{{Nb{ALd}}}}{{JdCh}Jd}``{{{d{Jd}}}N`}","D":"A@Fh","p":[[5,"Color",22,5023],[1,"reference"],[1,"u8"],[0,"mut"],[1,"unit"],[1,"f32"],[5,"BorderRadius",22,5024],[5,"BorderWidth",22,5024],[5,"DisplayHex",22,5023],[1,"str"],[5,"Curve",22,5025],[5,"Rect",1785,5026],[5,"Point",1785,5027],[5,"Canvas",22,5028],[5,"Pattern",22,5028],[6,"Shader",22,5028],[6,"BlendMode",22,5028],[6,"AntiAlias",22,5028],[5,"Paint",22,5028],[6,"FillRule",22,5028],[5,"Mask",22,5028],[6,"Primitive",22,5028],[6,"CurveVerb",22,5025],[6,"CurveSegment",22,5025],[6,"StrokeCap",22,5029],[6,"StrokeJoin",22,5029],[5,"Stroke",22,5029],[1,"bool"],[1,"usize"],[5,"Arc",5030],[10,"Into",5031],[5,"Formatter",5032],[8,"Result",5032],[1,"array"],[1,"tuple"],[5,"Image",1623,5033],[10,"Hasher",5034],[5,"ViewId",2891,5035],[17,"Output"],[10,"FnOnce",5036],[5,"CurveIter",22,5025],[6,"Option",5037],[5,"Affine",1785,5038],[1,"i32"],[1,"slice"],[17,"Item"],[10,"Iterator",5039],[5,"Vector",1785,5040],[5,"SmolStr",5041],[5,"String",5042],[6,"Result",5043],[5,"TypeId",5044],[5,"Clipboard",634],[10,"ClipboardBackend",634],[5,"Box",5045],[10,"AsRef",5031],[5,"CommandWaker",654],[5,"CommandProxy",654],[10,"Any",5044],[10,"Send",5046],[10,"Future",5047],[5,"Command",654],[5,"CommandReceiver",654],[10,"Fn",5036],[10,"Sync",5046],[5,"EventCx",729,5048],[5,"BuildCx",729,5049],[5,"RebuildCx",729,5050],[5,"LayoutCx",729,5051],[5,"DrawCx",729,5052],[5,"BaseCx",729,5053],[5,"Contexts",729,5054],[10,"Default",5055],[5,"Fonts",2531,5056],[5,"ViewState",2891,5035],[5,"TextBuffer",2531,5057],[5,"Buffer",5058],[6,"Cursor",4782,5059],[5,"Ime",1018,5060],[5,"Size",1785,5061],[5,"Styles",2373,5062],[5,"Window",4782,5063],[5,"Modifiers",1018,5064],[6,"Key",1018,5065],[1,"char"],[5,"PointerId",1018,5066],[1,"u64"],[5,"KeyPressed",1018,5065],[5,"KeyReleased",1018,5065],[6,"Code",1018,5065],[6,"PointerButton",1018,5066],[5,"PointerMoved",1018,5066],[5,"PointerLeft",1018,5066],[5,"PointerPressed",1018,5066],[5,"PointerReleased",1018,5066],[5,"PointerScrolled",1018,5066],[5,"CloseRequested",1018,5067],[5,"WindowResized",1018,5067],[5,"WindowScaled",1018,5067],[5,"WindowMaximized",1018,5067],[6,"Event",1018,5068],[10,"Hash",5034],[1,"u16"],[10,"IsKey",1018,5065],[5,"ImageData",1623,5069],[5,"ImageId",1623,5033],[5,"WeakImage",1623,5033],[5,"TextureId",1623,5070],[6,"Texture",1623,5070],[5,"Space",1785,5071],[10,"AnyView",2891,5072],[1,"u32"],[5,"Vec",5073],[5,"Alignment",1785,5074],[6,"Align",1785,5075],[5,"Padding",1785,5076],[6,"Axis",1785,5077],[6,"Justify",1785,5075],[5,"Matrix",1785,5078],[5,"JustifyIterator",1785,5075],[10,"From",5031],[10,"Rebuild",2370],[5,"Style",2373,5062],[10,"Sized",5046],[5,"Theme",2373,5079],[6,"Styled",2373,5062],[10,"Clone",5080],[10,"Debug",5032],[5,"TextInputStyle",3241,5081],[5,"ColorPickerStyle",3241,5082],[5,"TextStyle",3241,5083],[5,"CollapsingStyle",3241,5084],[5,"ScrollStyle",3241,5085],[5,"CheckboxStyle",3241,5086],[5,"SliderStyle",3241,5087],[5,"TooltipStyle",3241,5088],[5,"ButtonStyle",3241,5089],[5,"ContainerStyle",3241,5090],[6,"FontFamily",2531,5091],[1,"never"],[6,"Family",5092],[5,"AtlasGlyph",2531,5093],[5,"FontWeight",2531,5091],[6,"FontStretch",2531,5091],[6,"FontStyle",2531,5091],[6,"TextAlign",2531,5091],[6,"TextWrap",2531,5091],[5,"TextAttributes",2531,5091],[6,"FontSource",2531,5094],[5,"FontAtlas",2531,5093],[5,"Path",5095],[5,"PathBuf",5095],[5,"FontSystem",5096],[5,"SwashCache",5097],[5,"CacheKey",5098],[5,"Error",5099],[6,"Align",5100],[6,"Wrap",5100],[5,"Attrs",5101],[5,"Weight",5092],[6,"Width",5102],[6,"Style",5092],[6,"Easing",2838],[5,"Transition",2838],[5,"Update",2891,5035],[5,"ViewFlags",2891,5035],[17,"State"],[10,"ViewSeq",2891,5103],[10,"View",2891,5104],[8,"BoxedView",2891,5072],[5,"Pod",2891,5105],[5,"PodSeq",2891,5103],[5,"SeqState",2891,5103],[6,"Ordering",5106],[5,"State",2891,5105],[8,"AnyState",2891,5072],[10,"PartialEq",5106],[10,"IntoIterator",5107],[5,"Iter",5108],[5,"IterNames",5108],[5,"BuildHandler",3241,5109],[10,"FnMut",5036],[5,"EventHandler",3241,5110],[5,"Aligned",3241,5111],[5,"Stack",3241,5112],[5,"Text",3241,5083],[5,"TextInput",3241,5081],[5,"Wrap",3241,5113],[5,"ColorPicker",3241,5082],[5,"Flexible",3241,5114],[5,"Animate",3241,5115],[5,"Slider",3241,5087],[5,"Container",3241,5090],[5,"Checkbox",3241,5086],[5,"Collapsing",3241,5084],[5,"Button",3241,5089],[5,"DrawHandler",3241,5116],[5,"Focus",3241,5117],[5,"Memo",3241,5118],[5,"Opaque",3241,5119],[5,"RebuildHandler",3241,5120],[5,"Suspense",3241,5121],[5,"Trigger",3241,5122],[5,"WithState",3241,5123],[5,"WithStyle",3241,5124],[5,"Aspect",3241,5125],[5,"Clickable",3241,5126],[5,"Constrain",3241,5127],[5,"Pad",3241,5128],[5,"Painter",3241,5129],[5,"Scroll",3241,5085],[5,"Tooltip",3241,5088],[5,"Transform",3241,5130],[5,"ZStack",3241,5131],[6,"ClickEvent",3241,5126],[5,"Flex",3241,5114],[8,"Lens",3241,5117],[5,"Arguments",5032],[1,"fn"],[5,"PhantomData",5046],[5,"RangeInclusive",5132],[10,"ToString",5042],[5,"Pointer",4782,5133],[5,"WindowId",4782,5063],[6,"WindowSizing",4782,5063],[6,"WindowUpdate",4782,5063],[5,"WindowSnapshot",4782,5063],[15,"Fill",624],[15,"Stroke",624],[15,"Layer",624]],"r":[[22,5028],[26,5028],[27,5024],[28,5024],[31,5028],[35,5023],[38,5025],[39,5025],[40,5025],[41,5025],[44,5023],[48,5028],[55,5028],[61,5028],[62,5028],[64,5028],[70,5028],[75,5029],[77,5029],[78,5029],[388,5023],[391,5023],[393,5023],[395,5023],[397,5023],[472,5023],[474,5023],[476,5023],[478,5023],[480,5023],[482,5023],[484,5023],[486,5023],[501,5023],[503,5023],[729,5053],[730,5049],[731,5054],[732,5052],[733,5048],[734,5051],[735,5050],[1040,5067],[1042,5065],[1066,5068],[1121,5060],[1124,5065],[1131,5065],[1142,5065],[1144,5065],[1156,5064],[1182,5066],[1183,5066],[1184,5066],[1186,5066],[1188,5066],[1190,5066],[1192,5066],[1231,5067],[1233,5067],[1235,5067],[1624,5033],[1626,5069],[1627,5033],[1628,5070],[1629,5070],[1630,5033],[1785,5038],[1786,5075],[1787,5074],[1788,5077],[1805,5075],[1806,5075],[1808,5078],[1815,5076],[1816,5027],[1818,5026],[1819,5061],[1820,5071],[1832,5040],[2371,5134],[2397,5062],[2399,5062],[2400,5062],[2401,5079],[2429,5062],[2503,5062],[2510,0],[2529,5062],[2531,5093],[2547,5093],[2548,5091],[2549,5094],[2550,5091],[2551,5091],[2552,5091],[2553,5056],[2575,5091],[2576,5091],[2577,5057],[2578,5091],[2741,5134],[2893,5072],[2894,5072],[2895,5072],[2906,5105],[2907,5103],[2908,5103],[2909,5105],[2912,5035],[2913,5104],[2914,5035],[2915,5035],[2916,5103],[2917,5035],[2920,5072],[3166,5105],[3245,5111],[3246,5115],[3247,5125],[3274,5109],[3275,5089],[3276,5089],[3284,5086],[3285,5086],[3287,5126],[3288,5126],[3289,5084],[3290,5084],[3291,5082],[3292,5082],[3293,5127],[3294,5090],[3295,5090],[3297,5116],[3298,5110],[3315,5114],[3316,5114],[3317,5117],[3327,5117],[3329,5118],[3330,5119],[3334,5128],[3335,5129],[3337,5120],[3343,5085],[3344,5085],[3345,5087],[3346,5087],[3347,5112],[3348,5121],[3353,5083],[3354,5081],[3355,5081],[3356,5083],[3357,5088],[3358,5088],[3359,5130],[3360,5122],[3366,5123],[3367,5124],[3368,5113],[3369,5131],[3374,5111],[3393,5115],[3440,5090],[3606,5111],[3607,5111],[3608,5111],[3642,5089],[3646,5111],[3647,5086],[3650,5129],[3659,5084],[3681,5082],[3684,5127],[3685,5090],[4055,5129],[4092,5114],[4097,5114],[4101,5117],[4142,0],[4194,5127],[4200,5085],[4201,5112],[4202,0],[4203,0],[4204,5112],[4205,5112],[4206,5113],[4207,0],[4208,0],[4209,5113],[4210,5113],[4353,5111],[4374,5127],[4376,5127],[4378,5127],[4380,5118],[4381,5127],[4383,5127],[4385,5127],[4422,5109],[4423,5126],[4424,5116],[4427,5110],[4428,5110],[4437,5126],[4438,5120],[4439,5126],[4442,5119],[4445,5128],[4446,5128],[4447,5128],[4448,5128],[4449,5128],[4456,5129],[4528,5129],[4529,5111],[4530,5130],[4531,5130],[4534,5130],[4535,5127],[4544,5087],[4563,5121],[4564,5083],[4571,5081],[4575,5088],[4576,5111],[4577,5111],[4578,5111],[4579,5130],[4581,5115],[4593,5115],[4594,5115],[4595,5115],[4596,5130],[4597,5122],[4744,5085],[4745,5112],[4746,0],[4747,0],[4748,5112],[4749,5112],[4750,5113],[4751,0],[4752,0],[4753,5113],[4754,5113],[4755,5127],[4764,5123],[4765,5123],[4766,5123],[4767,5123],[4768,5124],[4769,5123],[4770,5123],[4779,5131],[4780,0],[4781,0],[4792,5059],[4814,5133],[4830,5063],[4831,5063],[4832,5063],[4833,5063],[4834,5063]],"b":[[326,"impl-Debug-for-Color"],[327,"impl-Display-for-Color"],[328,"impl-Debug-for-DisplayHex"],[329,"impl-Display-for-DisplayHex"],[337,"impl-From%3C%5Bf32;+4%5D%3E-for-BorderRadius"],[338,"impl-From%3Cf32%3E-for-BorderRadius"],[339,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-BorderRadius"],[341,"impl-From%3C(f32,+f32)%3E-for-BorderWidth"],[342,"impl-From%3C%5Bf32;+4%5D%3E-for-BorderWidth"],[344,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-BorderWidth"],[345,"impl-From%3Cf32%3E-for-BorderWidth"],[346,"impl-From%3C%5Bf32;+2%5D%3E-for-BorderWidth"],[352,"impl-From%3CColor%3E-for-Paint"],[354,"impl-From%3CImage%3E-for-Paint"],[355,"impl-From%3CPattern%3E-for-Paint"],[361,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Color"],[363,"impl-From%3C%5Bf32;+4%5D%3E-for-Color"],[463,"impl-Mul%3Cf32%3E-for-Color"],[464,"impl-Mul-for-Color"],[1722,"impl-From%3CTextureId%3E-for-Texture"],[1723,"impl-From%3CImage%3E-for-Texture"],[1843,"impl-Add%3CVector%3E-for-Point"],[1844,"impl-Add%3Cf32%3E-for-Point"],[1845,"impl-Add%3CSize%3E-for-Point"],[1846,"impl-Add%3CSize%3E-for-Rect"],[1847,"impl-Add%3CVector%3E-for-Rect"],[1848,"impl-Add%3CVector%3E-for-Size"],[1849,"impl-Add-for-Size"],[1850,"impl-Add%3Cf32%3E-for-Size"],[1852,"impl-Add-for-Vector"],[1853,"impl-Add%3Cf32%3E-for-Vector"],[1854,"impl-AddAssign%3CSize%3E-for-Point"],[1855,"impl-AddAssign%3Cf32%3E-for-Point"],[1856,"impl-AddAssign%3CVector%3E-for-Point"],[1857,"impl-AddAssign%3CVector%3E-for-Rect"],[1858,"impl-AddAssign%3CSize%3E-for-Rect"],[1859,"impl-AddAssign%3Cf32%3E-for-Size"],[1860,"impl-AddAssign-for-Size"],[1861,"impl-AddAssign%3CVector%3E-for-Size"],[1863,"impl-AddAssign%3Cf32%3E-for-Vector"],[1864,"impl-AddAssign-for-Vector"],[2009,"impl-Div%3CSize%3E-for-Point"],[2010,"impl-Div%3Cf32%3E-for-Point"],[2011,"impl-Div%3CVector%3E-for-Point"],[2012,"impl-Div-for-Size"],[2013,"impl-Div%3Cf32%3E-for-Size"],[2014,"impl-Div%3CVector%3E-for-Size"],[2015,"impl-Div%3Cf32%3E-for-Vector"],[2016,"impl-Div-for-Vector"],[2017,"impl-DivAssign%3Cf32%3E-for-Point"],[2018,"impl-DivAssign%3CSize%3E-for-Point"],[2019,"impl-DivAssign%3CVector%3E-for-Point"],[2020,"impl-DivAssign%3CVector%3E-for-Size"],[2021,"impl-DivAssign%3Cf32%3E-for-Size"],[2022,"impl-DivAssign-for-Size"],[2023,"impl-DivAssign%3Cf32%3E-for-Vector"],[2024,"impl-DivAssign-for-Vector"],[2064,"impl-Debug-for-Point"],[2065,"impl-Display-for-Point"],[2067,"impl-Display-for-Size"],[2068,"impl-Debug-for-Size"],[2070,"impl-Debug-for-Vector"],[2071,"impl-Display-for-Vector"],[2076,"impl-From%3C%5Bf32;+2%5D%3E-for-Alignment"],[2077,"impl-From%3C(f32,+f32)%3E-for-Alignment"],[2082,"impl-From%3C%5Bf32;+4%5D%3E-for-Padding"],[2083,"impl-From%3C(f32,+f32)%3E-for-Padding"],[2084,"impl-From%3C%5Bf32;+2%5D%3E-for-Padding"],[2085,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Padding"],[2086,"impl-From%3Cf32%3E-for-Padding"],[2088,"impl-From%3C(f32,+f32)%3E-for-Point"],[2089,"impl-From%3C%5Bf32;+2%5D%3E-for-Point"],[2090,"impl-From%3CSize%3E-for-Point"],[2091,"impl-From%3Cf32%3E-for-Point"],[2093,"impl-From%3CVector%3E-for-Point"],[2094,"impl-From%3CSize%3E-for-Rect"],[2095,"impl-From%3C%5Bf32;+4%5D%3E-for-Rect"],[2097,"impl-From%3C%5Bf32;+2%5D%3E-for-Size"],[2098,"impl-From%3CVector%3E-for-Size"],[2100,"impl-From%3Cf32%3E-for-Size"],[2101,"impl-From%3CPoint%3E-for-Size"],[2102,"impl-From%3C(f32,+f32)%3E-for-Size"],[2105,"impl-From%3Cf32%3E-for-Vector"],[2106,"impl-From%3C(f32,+f32)%3E-for-Vector"],[2107,"impl-From%3CPoint%3E-for-Vector"],[2109,"impl-From%3C%5Bf32;+2%5D%3E-for-Vector"],[2110,"impl-From%3CSize%3E-for-Vector"],[2194,"impl-Mul-for-Affine"],[2195,"impl-Mul%3CVector%3E-for-Affine"],[2196,"impl-Mul%3CPoint%3E-for-Affine"],[2197,"impl-Mul-for-Matrix"],[2198,"impl-Mul%3CVector%3E-for-Matrix"],[2199,"impl-Mul%3CPoint%3E-for-Matrix"],[2200,"impl-Mul%3CVector%3E-for-Point"],[2201,"impl-Mul%3Cf32%3E-for-Point"],[2202,"impl-Mul%3CSize%3E-for-Point"],[2203,"impl-Mul-for-Size"],[2204,"impl-Mul%3Cf32%3E-for-Size"],[2205,"impl-Mul%3CVector%3E-for-Size"],[2206,"impl-Mul-for-Vector"],[2207,"impl-Mul%3Cf32%3E-for-Vector"],[2209,"impl-MulAssign%3CVector%3E-for-Point"],[2210,"impl-MulAssign%3CSize%3E-for-Point"],[2211,"impl-MulAssign%3Cf32%3E-for-Point"],[2212,"impl-MulAssign-for-Size"],[2213,"impl-MulAssign%3CVector%3E-for-Size"],[2214,"impl-MulAssign%3Cf32%3E-for-Size"],[2215,"impl-MulAssign%3Cf32%3E-for-Vector"],[2216,"impl-MulAssign-for-Vector"],[2233,"impl-Rem%3CSize%3E-for-Point"],[2234,"impl-Rem%3Cf32%3E-for-Point"],[2235,"impl-Rem%3CVector%3E-for-Point"],[2236,"impl-Rem%3CVector%3E-for-Size"],[2237,"impl-Rem%3Cf32%3E-for-Size"],[2238,"impl-Rem-for-Size"],[2239,"impl-Rem-for-Vector"],[2240,"impl-Rem%3Cf32%3E-for-Vector"],[2241,"impl-RemAssign%3CVector%3E-for-Point"],[2242,"impl-RemAssign%3CSize%3E-for-Point"],[2243,"impl-RemAssign%3Cf32%3E-for-Point"],[2244,"impl-RemAssign%3CVector%3E-for-Size"],[2245,"impl-RemAssign%3Cf32%3E-for-Size"],[2246,"impl-RemAssign-for-Size"],[2247,"impl-RemAssign%3Cf32%3E-for-Vector"],[2248,"impl-RemAssign-for-Vector"],[2263,"impl-Sub%3CVector%3E-for-Point"],[2264,"impl-Sub-for-Point"],[2265,"impl-Sub%3Cf32%3E-for-Point"],[2266,"impl-Sub%3CSize%3E-for-Point"],[2267,"impl-Sub%3CVector%3E-for-Rect"],[2268,"impl-Sub%3CSize%3E-for-Rect"],[2269,"impl-Sub%3CVector%3E-for-Size"],[2270,"impl-Sub-for-Size"],[2271,"impl-Sub%3Cf32%3E-for-Size"],[2273,"impl-Sub%3Cf32%3E-for-Vector"],[2274,"impl-Sub-for-Vector"],[2275,"impl-SubAssign%3CSize%3E-for-Point"],[2276,"impl-SubAssign%3Cf32%3E-for-Point"],[2277,"impl-SubAssign%3CVector%3E-for-Point"],[2278,"impl-SubAssign%3CSize%3E-for-Rect"],[2279,"impl-SubAssign%3CVector%3E-for-Rect"],[2280,"impl-SubAssign%3CVector%3E-for-Size"],[2281,"impl-SubAssign-for-Size"],[2282,"impl-SubAssign%3Cf32%3E-for-Size"],[2284,"impl-SubAssign-for-Vector"],[2285,"impl-SubAssign%3Cf32%3E-for-Vector"],[2452,"impl-From%3CTextInputStyle%3E-for-Styles"],[2454,"impl-From%3CColorPickerStyle%3E-for-Styles"],[2455,"impl-From%3CTextStyle%3E-for-Styles"],[2456,"impl-From%3CCollapsingStyle%3E-for-Styles"],[2457,"impl-From%3CScrollStyle%3E-for-Styles"],[2458,"impl-From%3CCheckboxStyle%3E-for-Styles"],[2459,"impl-From%3CSliderStyle%3E-for-Styles"],[2460,"impl-From%3CTooltipStyle%3E-for-Styles"],[2461,"impl-From%3CButtonStyle%3E-for-Styles"],[2462,"impl-From%3CContainerStyle%3E-for-Styles"],[2463,"impl-From%3CTheme%3E-for-Styles"],[2464,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CPadding%3E"],[2465,"impl-From%3C%26str%3E-for-Styled%3CFontFamily%3E"],[2466,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CPadding%3E"],[2467,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CBorderWidth%3E"],[2468,"impl-From%3C(f32,+f32)%3E-for-Styled%3CBorderWidth%3E"],[2469,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CBorderRadius%3E"],[2471,"impl-From%3CString%3E-for-Styled%3CFontFamily%3E"],[2473,"impl-From%3Cf32%3E-for-Styled%3CPadding%3E"],[2474,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CBorderWidth%3E"],[2475,"impl-From%3CStyle%3CT%3E%3E-for-Styled%3CT%3E"],[2476,"impl-From%3C%5Bf32;+2%5D%3E-for-Styled%3CPadding%3E"],[2477,"impl-From%3C(f32,+f32)%3E-for-Styled%3CPadding%3E"],[2478,"impl-From%3C%5Bf32;+2%5D%3E-for-Styled%3CBorderWidth%3E"],[2479,"impl-From%3CT%3E-for-Styled%3CT%3E"],[2480,"impl-From%3CSmolStr%3E-for-Styled%3CFontFamily%3E"],[2481,"impl-From%3Cf32%3E-for-Styled%3CBorderRadius%3E"],[2482,"impl-From%3Cf32%3E-for-Styled%3CBorderWidth%3E"],[2483,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CBorderRadius%3E"],[2715,"impl-From%3CString%3E-for-FontFamily"],[2717,"impl-From%3CSmolStr%3E-for-FontFamily"],[2718,"impl-From%3C%26str%3E-for-FontFamily"],[2727,"impl-From%3C%26Path%3E-for-FontSource%3C\'a%3E"],[2728,"impl-From%3CVec%3Cu8%3E%3E-for-FontSource%3C\'_%3E"],[2729,"impl-From%3C%26str%3E-for-FontSource%3C\'a%3E"],[2731,"impl-From%3CPathBuf%3E-for-FontSource%3C\'_%3E"],[2732,"impl-From%3C%26%5Bu8%5D%3E-for-FontSource%3C\'a%3E"],[2932,"impl-Update"],[2933,"impl-Flags-for-Update"],[2934,"impl-Flags-for-ViewFlags"],[2935,"impl-ViewFlags"],[3058,"impl-UpperHex-for-Update"],[3059,"impl-LowerHex-for-Update"],[3060,"impl-Debug-for-Update"],[3061,"impl-Octal-for-Update"],[3062,"impl-Binary-for-Update"],[3063,"impl-Debug-for-ViewFlags"],[3064,"impl-Octal-for-ViewFlags"],[3065,"impl-UpperHex-for-ViewFlags"],[3066,"impl-LowerHex-for-ViewFlags"],[3067,"impl-Binary-for-ViewFlags"],[3068,"impl-Display-for-ViewId"],[3069,"impl-Debug-for-ViewId"],[3085,"impl-Flags-for-Update"],[3086,"impl-Update"],[3087,"impl-Flags-for-ViewFlags"],[3088,"impl-ViewFlags"],[3833,"impl-Painter%3CT%3E"],[3834,"impl-View%3CT%3E-for-Painter%3CT%3E"],[4073,"impl-Clickable%3CT,+V,+F%3E"],[4074,"impl-View%3CT%3E-for-Clickable%3CT,+V,+F%3E"],[4478,"impl-Rebuild-for-Aligned%3CV%3E"],[4479,"impl-View%3CT%3E-for-Aligned%3CV%3E"],[4480,"impl-Rebuild-for-Aspect%3CV%3E"],[4481,"impl-View%3CT%3E-for-Aspect%3CV%3E"],[4482,"impl-Rebuild-for-Button%3CV%3E"],[4483,"impl-View%3CT%3E-for-Button%3CV%3E"],[4485,"impl-Rebuild-for-Checkbox"],[4486,"impl-View%3CT%3E-for-Checkbox"],[4488,"impl-View%3CT%3E-for-Clickable%3CT,+V,+F%3E"],[4489,"impl-Rebuild-for-Clickable%3CT,+V,+F%3E"],[4490,"impl-Rebuild-for-Collapsing%3CT,+H,+V%3E"],[4491,"impl-View%3CT%3E-for-Collapsing%3CT,+H,+V%3E"],[4493,"impl-View%3CT%3E-for-ColorPicker%3CT%3E"],[4494,"impl-Rebuild-for-ColorPicker%3CT%3E"],[4496,"impl-Rebuild-for-Constrain%3CV%3E"],[4497,"impl-View%3CT%3E-for-Constrain%3CV%3E"],[4498,"impl-Rebuild-for-Container%3CV%3E"],[4499,"impl-View%3CT%3E-for-Container%3CV%3E"],[4501,"impl-View%3CT%3E-for-Flexible%3CV%3E"],[4502,"impl-Rebuild-for-Flexible%3CV%3E"],[4503,"impl-View%3CT%3E-for-Pad%3CV%3E"],[4504,"impl-Rebuild-for-Pad%3CV%3E"],[4505,"impl-View%3CT%3E-for-Painter%3CT%3E"],[4506,"impl-Rebuild-for-Painter%3CT%3E"],[4507,"impl-View%3CT%3E-for-Scroll%3CV%3E"],[4508,"impl-Rebuild-for-Scroll%3CV%3E"],[4510,"impl-Rebuild-for-Slider%3CT%3E"],[4511,"impl-View%3CT%3E-for-Slider%3CT%3E"],[4513,"impl-View%3CT%3E-for-Stack%3CV%3E"],[4514,"impl-Rebuild-for-Stack%3CV%3E"],[4519,"impl-View%3CT%3E-for-Tooltip%3CV%3E"],[4520,"impl-Rebuild-for-Tooltip%3CV%3E"],[4522,"impl-Rebuild-for-Transform%3CV%3E"],[4523,"impl-View%3CT%3E-for-Transform%3CV%3E"],[4524,"impl-View%3CT%3E-for-Wrap%3CV%3E"],[4525,"impl-Rebuild-for-Wrap%3CV%3E"],[4915,"impl-Debug-for-WindowId"],[4916,"impl-Display-for-WindowId"]],"c":"OjAAAAAAAAA=","e":"OzAAAAEAAGsL4AALAAAAGAABAB8AAAAzAAAANwAAAEQAAABQAAIAVwABAFwAAABiACcAkgBEAN8ALwARARMAJgESADwBFABSAQIAVgEBAFkBAgBdAQAAYQEAAGMBAQBnAQAAagEAAGwBAABvAQAAdQEAAHkBCwCRARMAuQEBANABAQDYAQAAAAIAABACEgAkAgEAJwIBADECEwBGAicAfQIGAIcCAACMAgIAkwINAKQCDwC2AgAAugIDAMkCCQDUAgMA6QINAAwDGAApAwYAMgMAAGcDBgDZAxQA+wMFAAIEAQAFBAsAFAQBABcEEwAsBCgAVgQLAGMEAQBmBAUAbQQJAHsECQCGBA4AlgQIAKwEDQC7BAsAyAQEAM4EAQDWBAQA3wQjAAYFOwBHBQEASwVWALgFDQDMBREA8QUBAAwGRgBgBiEAhgYSAJoGEgCuBgUAtwYAALsGAQC/BgQAxwYFANMGAADaBgAA4AYXADQHFQBTBx0AgQcvALUHIgDaBw8A6wcYAAoIDgAdCAEAIwgEACkIAwAuCAIAMggBADUIAwA6CAIAPggBAEQICQBTCAwAbwgAAJMIGAC0CAAAuggPANgIIgD/CAUADwkMAB0JGQBGCQQATAkRAGQJAQBoCRUAggkNAJEJAQCVCQAAlwkPAKgJDAC8CQMA0gkPAOcJAAD9CQAA/wkAAAgKAAAUCgAAGQoZADUKIABXCh8AeAoSAIwKCwCcCgAAngoBAKgKAgCsCgEArwoFALcKCwDoCiwAGwsLACgLBwA0CwEANwsBADwLAgBECwcAawsAAHYLAQB9Cw8AjwsBAJILFACtCxsAzAsBANALBwDZCwAA2wsAAN0LAADfCwAA4QsAAOQLBADqCwEA8QsOAAIMAAAEDAAABgwBAA4MAAAQDAAAHgwEACUMBwA8DAEATAwBAF4MAABnDAEAhAwGAI8MFwBIDSAAvQ1ZABoOIABEDgcAfg4CAIUOWwDjDhYA+w4JAAYP0QDZDxAA6w8QAAQQAQBUEAAAYRAAAHoQLADhECAAcxERAIYRAQCJEQMAjhEBAJERAwCWEQcAnxEBAKIRAgCmEQAAqBEBAKsRBADeEQEA9xGGAK8SBAC2EgIAvBICAMASAgDGEggA0BIBANMSAQDWEgAA2BIBANsSAADdEgEA5BInABITEQAlEwsAMhMHAEMTAQBMEwYAfRMdAA=="}],\
+["ori_core",{"t":"CCCCCQQQCCECCQCCCCQQCQGTTPGFFPTFPPPFPPFFGGPPFPPPGPTPPPTFPPPPPFFPGPPTPPGPPPPFPGGTTTTTONNNNNONNNONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNHNNHNHNHNHNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNONNNNNNNONNNNNNNNNNNNHNHNHNHNHNHNHNHNNNNNNNNNNONNNHNHNNONNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOONONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOFKNNNNNNNNNMNNNNMNNNFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFFFFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNPPPPPPPPPPPPPPPPPPPPPPFPGPPPPPPPPPPPPPPPPPPPPPPPGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFPPKPPPPPPGPPPPPPPPPPFPFPPPPPPPPPPPFPPPPPPPPPPPPPPPPPPPPPPPPPGFFPFPFPFPFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFPFPFPPPPPPONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOONNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNNNNNNOOOOOOOOOOOOOOOOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOPFPFFGFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFGFGTTTTPPPPSTTPPTTTGFTFTTTTTTFFTFFFPPPPPPTTTTTFPTTTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNONNNOONNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOKYMTTTTTPTTTTTTTTTTTTTTTTTTFPGFFPTTOONNNNNNNNNNNNNNNNNNNNNNHOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNHNNNOOOQOONNNNNNNNNNNNNNNNHOFTTTPPPPPTTPPPPPFGGGGFFPTTTTPTPPPPPPTTPPPPPTGFFGTPPPNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOPGPFNNNNNNNNNNNNNNNNNNNNNOHNONNNNNNNNNNNNNHNNNNNNNNNNTTIKITTTTTTTTTTFFFFRRFKFFKFNNHMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNMNNNNNNNNNMNMNMNMNMNNNNNNNNMNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMNNMNMNNNNNNNNNNNNNNHNNNNNMMNNNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTFFFTTTTTTTTTTTTTTTTTTTTTTTTTTFFFTTTTTTTFFPGFFFFFFFFTFFTTTTTTTTTTTTTTTTFFFTTTTTTTTTITFFTTTFFPFPTTTTFFFFFFTTTTFFFFFFFFTTTTTFFFFNNOOHNNNNOOOOOOOOONOONOHONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNOOOOHNNNNOOOOOOOOOONONNNNNNOOOOOOOOOOOOOONNNNNNOOOOOOOOOOOOOONNNNNNOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNOOHHNOHNNNNNNNNHNNNNNNNOOOOOOOOOOOOOOOHNOHHNOOOOOOOOOOOOOOOOOOOOOONNNNOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHNNOOHONNHNNOOOOOONNOOOOOONNOOOOOONNOOOOOONNOOOOOOQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONOHNNNNNHHQQHHHQQHHNOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNOONONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNOONOONNOOOOOONNOOHNHNHNHHNHNHNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHNOHHNNNOOONOHHHNOHNOHHHHHNOOOOOHNONOONNNONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOHHHHNOHHNNNOOOOOHNOOONOOONNNNNNNNNNHHNNOOOQHONNHHHHHOHNNNNOOOOOOOOHHHHHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONNNNNNNNHHQQHHHQQHHHNNNOOOONNHHHHHHHNNOOOOOOHQQPPPPPPPPPPGPPPPPPPPPPPPPPPPPPPPPFPPPPPPPPPPPPPPPFFGFGPPNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOONOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNONOONNNNNNNNNNNNNNNNNNNNOONNNNNNNNONNNNNNOONOONOONONNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOON","n":["canvas","clipboard","command","context","event","format_text","hstack","hwrap","image","layout","log","rebuild","style","style","text","transition","view","views","vstack","vwrap","window","zstack","AntiAlias","BLACK","BLUE","Bevel","BlendMode","BorderRadius","BorderWidth","Butt","CYAN","Canvas","Clear","Close","Close","Color","Cubic","Cubic","Curve","CurveIter","CurveSegment","CurveVerb","Destination","DestinationOver","DisplayHex","EvenOdd","Fast","Fill","FillRule","Full","GREEN","Layer","Line","Line","MAGENTA","Mask","Miter","Move","Move","NonZero","None","Paint","Pattern","Pattern","Primitive","Quad","Quad","RED","Round","Round","Shader","Solid","Source","SourceOver","Square","Stroke","Stroke","StrokeCap","StrokeJoin","TRANSPARENT","WHITE","YELLOW","ZERO","ZERO","a","a8","add","add_assign","all","all","anti_alias","as_ref","as_str","as_str_with_alpha","b","b8","blend","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom_left","bottom_right","bounds","cap","circle","clear","clear","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","close","color","conic_to","contains","count","cubic_to","curve","darken","default","default","default","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","desaturate","draw_canvas","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","ellipse","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","fade","fill","fill","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","g","g8","grayscale","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hex","hex","hoverable","hsl","hsl","hsla","hsla","hsv","hsv","hsva","hsva","image","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into_iter","into_iter","is_closed","is_empty","is_translucent","is_transparent","is_valid","iter","join","last_point","layer","left","len","lighten","line_to","luminocity","masked","max_element","min_element","miter","mix","mix_rgb","move_to","mul","mul","new","new","new","new","new","new","next","okhsl","okhsl","okhsla","okhsla","okhsv","okhsv","okhsva","okhsva","oklab","oklab","oklaba","oklaba","oklch","oklch","oklcha","oklcha","overlay","points","points","primitives","push_oval","push_rect","push_rect_with_borders","push_rect_with_radius","quad_to","r","r8","rect","rect","rgb","rgb","rgba","rgba","rgba8","right","rotated","saturate","scaled","shader","size_hint","stroke","stroke_curve","to_hex","to_hsl","to_hsla","to_hsv","to_hsva","to_okhsl","to_okhsla","to_okhsv","to_okhsva","to_oklab","to_oklaba","to_oklch","to_oklcha","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_rgba8","to_smolstr","to_smolstr","to_srgb","to_string","to_string","top","top_left","top_right","transform","transform","transformed","translated","trigger","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_hex","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","verbs","view_at","width","curve","curve","fill","mask","paint","paint","primitives","stroke","transform","view","Clipboard","ClipboardBackend","borrow","borrow_mut","default","deref","deref_mut","drop","fmt","from","get","get_text","init","into","new","set","set_text","try_from","try_into","type_id","Command","CommandProxy","CommandReceiver","CommandWaker","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","cmd","cmd_async","cmd_silent","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","fmt","fmt","fmt","fmt","from","from","from","from","from","get","init","init","init","init","into","into","into","into","is","name","new","new","new","spawn_async","to_any","to_owned","to_owned","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_recv","type_id","type_id","type_id","type_id","wake","wake","BaseCx","BuildCx","Contexts","DrawCx","EventCx","LayoutCx","RebuildCx","active_changed","animate","animate","animate","as_build_cx","as_build_cx","as_layout_cx","as_rebuild_cx","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","canvas","child","child","child","child","child","clipboard","cmd","cmd_async","contains","contains_context","contains_property","contains_property","contains_property","contains_property","contains_property","context","context_mut","context_or_default","contexts","contexts_mut","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","draw","draw","draw","draw_canvas","drop","drop","drop","drop","drop","drop","drop","fill","fill_rect","fmt","focused_changed","fonts","from","from","from","from","from","from","from","get","get_context","get_context_mut","get_mut","get_or_default","get_property","get_property","get_property","get_property","get_property","get_property_mut","get_property_mut","get_property_mut","get_property_mut","get_property_mut","had_active","had_focused","had_hot","has_active","has_active","has_active","has_active","has_active","has_active_changed","has_focused","has_focused","has_focused","has_focused","has_focused","has_focused_changed","has_hot","has_hot","has_hot","has_hot","has_hot","has_hot_changed","hot_changed","hoverable","id","id","id","id","id","init","init","init","init","init","init","init","insert","insert_context","insert_property","insert_property","insert_property","insert_property","insert_property","into","into","into","into","into","into","into","is_active","is_active","is_active","is_active","is_active","is_empty","is_focused","is_focused","is_focused","is_focused","is_focused","is_hot","is_hot","is_hot","is_hot","is_hot","is_visible","layout","layout","layout","len","local","masked","new","new","new","new","new","new","new","overlay","prepare_text","prepare_text_raw","property_or","property_or","property_or","property_or","property_or","property_or_default","property_or_default","property_or_default","property_or_default","property_or_default","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","property_or_insert_with","proxy","quad","rebuild","rect","rect","rect","remove","remove_context","remove_property","remove_property","remove_property","remove_property","remove_property","rotated","scaled","set_active","set_active","set_active","set_cursor","set_cursor","set_cursor","set_focused","set_focused","set_focused","set_hot","set_hot","set_hot","set_ime","size","size","size","spawn_async","stroke","styles","styles","styles","styles","styles","text","text_raw","transform","transform","transformed","translated","trigger","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","was_active","was_focused","was_hot","window","window","window","window","window","window_mut","window_mut","window_mut","window_mut","window_mut","A","Accept","Again","Alphanumeric","Alt","AltGraph","Animate","Apostrophe","B","Back","Backslash","Backspace","Backspace","Backtick","BracketLeft","BracketRight","C","Cancel","CapsLock","CapsLock","Character","Clear","CloseRequested","CloseRequested","Code","CodeInput","Comma","Command","Compose","Control","Convert","Copy","Cut","D","Dead","Delete","Delete","Down","Down","E","Eisu","End","End","Enter","Enter","Equal","Escape","Escape","Event","Execute","F","F1","F1","F10","F10","F11","F11","F12","F12","F13","F14","F15","F16","F17","F18","F19","F2","F2","F20","F21","F22","F23","F24","F3","F3","F4","F4","F5","F5","F6","F6","F7","F7","F8","F8","F9","F9","Find","Fn","FnLock","Forward","G","H","HangulMode","HanjaMode","Hankaku","Help","Hiragana","HiraganaKatakana","Home","Home","Hyper","I","Ime","Insert","Insert","IsKey","J","JunjaMode","K","KanaMode","KanjiMode","Katakana","Key","Key0","Key1","Key2","Key3","Key4","Key5","Key6","Key7","Key8","Key9","KeyPressed","KeyPressed","KeyReleased","KeyReleased","L","LAlt","LCtrl","LMeta","LShift","Left","Left","M","Meta","Minus","Modifiers","N","NumLock","NumLock","NumStar","Numpad0","Numpad1","Numpad2","Numpad3","Numpad4","Numpad5","Numpad6","Numpad7","Numpad8","Numpad9","O","Other","P","PageDown","PageDown","PageUp","PageUp","Paste","Pause","Period","Play","PointerButton","PointerId","PointerLeft","PointerLeft","PointerMoved","PointerMoved","PointerPressed","PointerPressed","PointerReleased","PointerReleased","PointerScrolled","PointerScrolled","Primary","PrintScreen","Q","R","RAlt","RCtrl","RMeta","RShift","Redo","Right","Right","Romaji","S","ScrollLock","ScrollLock","Secondary","Select","Semicolon","Shift","Slash","Space","Space","Super","Symbol","SymbolLock","T","Tab","Tab","Tertiary","U","Undo","Unidentified","Up","Up","Update","V","W","WindowMaximized","WindowMaximized","WindowResized","WindowResized","WindowScaled","WindowScaled","X","Y","Z","Zenkaku","ZenkakuHankaku","alt","any","as_char","as_u64","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","button","button","clicked","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmd","code","code","compose","ctrl","default","default","delta","delta","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from_hash","from_linux_scancode","from_u16","from_u64","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","height","id","id","id","id","id","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","is","is","is","is_cmd","is_key","is_key","is_key_pressed","is_key_released","key","key","maximized","meta","modifiers","modifiers","modifiers","modifiers","modifiers","modifiers","position","position","position","position","scale_factor","selection","shift","size","text","text","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","width","window","window","window","window","Backend","Image","Image","ImageData","ImageId","Texture","TextureId","WeakImage","as_any","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","build","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","color","compute_id","data","data_mut","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","downgrade","draw","drop","drop","drop","drop","drop","drop","dyn_build","dyn_draw","dyn_event","dyn_layout","dyn_rebuild","eq","eq","eq","eq","eq","eq","event","filter","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","from","from_index","get_pixel","hash","hash","hash","hash","hash","height","id","id","init","init","init","init","init","init","into","into","into","into","into","into","layout","modify","multiply_alpha","new","new","new","premultiplied","rebuild","set_filter","set_pixel","size","strong_count","to_index","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","weak_count","width","Affine","Align","Alignment","Axis","BOTTOM","BOTTOM_LEFT","BOTTOM_RIGHT","CENTER","Center","Center","End","End","FILL","FILL","FILL","Fill","Horizontal","IDENTITY","IDENTITY","INFINITY","Justify","JustifyIterator","LEFT","Matrix","NEG_X","NEG_X","NEG_Y","NEG_Y","ONE","ONE","Padding","Point","RIGHT","Rect","Size","Space","SpaceAround","SpaceBetween","SpaceEvenly","Start","Start","Stretch","TOP","TOP_LEFT","TOP_RIGHT","UNBOUNDED","UNBOUNDED","Vector","Vertical","X","X","Y","Y","ZERO","ZERO","ZERO","ZERO","ZERO","add","add","add","add","add","add","add","add","add","add","add","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","add_assign","align","align","all","all","all","all","angle","angle_between","area","bitand","bitand","bitand_assign","bitand_assign","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom","bottom_center","bottom_left","bottom_right","ceil","ceil","ceil","center","center_left","center_right","center_size","clamp","clamp","clamp","clamp","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","constrain","contain","contains","cross","default","default","default","default","default","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","determinant","distance","div","div","div","div","div","div","div","div","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","div_assign","dot","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","eq","expand","finite_or_zero","fit","floor","floor","floor","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fract","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from_angle","from_angle","from_scale","from_size","hash","hash","hash","hash","hash","hash","hash","hash","hash","hash","hat","height","height","include","inflate","init","init","init","init","init","init","init","init","init","init","init","init","init","intersection","intersects","into","into","into","into","into","into","into","into","into","into","into","into","into","into_iter","inverse","inverse","is_finite","is_finite","is_finite","is_infinite","is_infinite","is_infinite","is_nan","layout","left","left","length","length_squared","lerp","loosen","loosen_height","loosen_width","major","matrix","max","max","max","max","max","max_element","max_size","min","min","min","min","min","min_element","min_size","minor","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","mul_assign","neg","neg","new","new","new","new","new","new","new","new","next","normalize","offset","offset","pack","pt","rem","rem","rem","rem","rem","rem","rem","rem","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","rem_assign","right","right","rotate","round","round","round","round","round","scale","shrink","shrink","signum","size","size","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","sub_assign","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_point","to_point","to_size","to_size","to_smolstr","to_smolstr","to_smolstr","to_string","to_string","to_string","to_vector","to_vector","top","top","top_center","top_left","top_right","transform","translate","translation","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_intersection","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","union","unpack","width","width","x","x","x","x","y","y","y","y","Rebuild","Rebuild","rebuild","ACCENT","ACCENT_LOW","BACKGROUND","CONTRAST","CONTRAST_LOW","Computed","DANGER","DANGER_LOW","INFO","INFO_LOW","OUTLINE","OUTLINE_LOW","PRIMARY","PRIMARY_LOW","SECONDARY","SECONDARY_LOW","SUCCESS","SUCCESS_LOW","SURFACE","SURFACE_HIGH","SURFACE_HIGHER","SURFACE_HIGHEST","SURFACE_LOW","SURFACE_LOWER","Style","Style","Styled","Styles","Theme","Value","WARNING","WARNING_LOW","accent","background","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","comp","contrast","danger","dark","default","default","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","drop","drop","drop","drop","extend","fmt","fmt","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","get","get","get_or","get_or","get_or_else","get_or_else","info","init","init","init","init","insert","insert_style","insert_style_keys","insert_value","into","into","into","into","key","light","new","new","outline","primary","secondary","style","success","surface","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","val","warning","AtlasGlyph","BLACK","BOLD","Bottom","Bundle","Center","Condensed","Cursive","Data","EXTRA_BOLD","EXTRA_LIGHT","End","Expanded","ExtraCondensed","ExtraExpanded","Fantasy","FontAtlas","FontFamily","FontSource","FontStretch","FontStyle","FontWeight","Fonts","Italic","LIGHT","Left","MEDIUM","Middle","Monospace","NORMAL","Name","None","Normal","Normal","Oblique","Path","Right","SEMI_BOLD","SansSerif","SemiCondensed","SemiExpanded","Serif","Start","THIN","TextAlign","TextAttributes","TextBuffer","TextWrap","Top","UltraCondensed","UltraExpanded","Word","as_fontdb","as_mut","as_ref","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bounds","buffer_size","clone","clone","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","curve_cache","default","default","default","default","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","draw_buffer","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","eq","eq","family","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","font_atlas","font_system","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from_raw","hash","hash","hash","hash","hash","hash","image","include_font","init","init","init","init","init","init","init","init","init","init","init","init","insert","into","into","into","into","into","into","into","into","into","into","into","into","layout","load_font","new","new","new","prepare_buffer","raw","raw_mut","rect","set_align","set_bounds","set_metrics","set_text","set_wrap","size","stretch","style","swash_cache","to_cosmic_text","to_cosmic_text","to_cosmic_text","to_fontdb","to_fontdb","to_fontdb","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","uv","weight","Ease","Easing","Linear","Transition","borrow","borrow","borrow_mut","borrow_mut","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","complete","default","default","deref","deref","deref_mut","deref_mut","drop","drop","duration","ease","ease","easing","eq","eq","evaluate","fmt","fmt","from","from","get","hash","init","init","into","into","linear","linear","step","to_owned","to_owned","try_from","try_from","try_into","try_into","type_id","type_id","ACTIVE","ANIMATE","AnyState","AnyView","BoxedView","DRAW","FOCUSABLE","FOCUSED","HAS","HAS_ACTIVE","HAS_FOCUSED","HAS_HOT","HOT","IS","LAYOUT","Pod","PodSeq","SeqState","State","State","State","Update","View","ViewFlags","ViewId","ViewSeq","ViewState","all","all","any","as_any","as_any","as_u64","bitand","bitand","bitand_assign","bitand_assign","bitor","bitor","bitor_assign","bitor_assign","bits","bits","bits","bits","bitxor","bitxor","bitxor_assign","bitxor_assign","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","build","build","build","build","build","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","cmp","complement","complement","contains","contains","contains_property","cursor","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","difference","difference","draw","draw","draw","draw_nth","draw_nth","drop","drop","drop","drop","drop","drop","drop","drop","dyn_build","dyn_build","dyn_draw","dyn_draw","dyn_event","dyn_event","dyn_layout","dyn_layout","dyn_rebuild","dyn_rebuild","empty","empty","eq","eq","eq","eq","eq","event","event","event","event_nth","event_nth","extend","extend","flags","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","from","from","from","from","from","from_bits","from_bits","from_bits_retain","from_bits_retain","from_bits_retain","from_bits_retain","from_bits_truncate","from_bits_truncate","from_iter","from_iter","from_name","from_name","get_property","get_property_mut","has_active","has_active","has_focused","has_hot","hash","hash","hash","hash","hash","id","ime","init","init","init","init","init","init","init","init","insert","insert","insert_property","intersection","intersection","intersects","intersects","into","into","into","into","into","into","into","into","into_iter","into_iter","is_active","is_all","is_all","is_empty","is_empty","is_empty","is_focusable","is_focused","is_hot","iter","iter","iter_names","iter_names","layout","layout","layout","layout_nth","layout_nth","len","len","mark_animated","mark_drawn","mark_layed_out","needs_animate","needs_draw","needs_layout","new","new","new","new","not","not","partial_cmp","pod","prepare","propagate","property_or","property_or_default","property_or_insert_with","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild_nth","rebuild_nth","rect","remove","remove","remove_property","request_animate","request_draw","request_layout","set","set","set_active","set_cursor","set_focusable","set_focused","set_hot","set_ime","set_size","set_transform","size","sub","sub","sub_assign","sub_assign","symmetric_difference","symmetric_difference","to_owned","to_owned","to_owned","to_owned","to_owned","to_smolstr","to_string","toggle","toggle","transform","translate","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","union","union","update","ALIGN","ALIGN","ALIGN","ALPHA_COLOR","Aligned","Animate","Aspect","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BACKGROUND","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_COLOR","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_RADIUS","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BORDER_WIDTH","BuildHandler","Button","ButtonStyle","COLOR","COLOR","COLOR","COLOR","COLOR","COLOR","COLOR","Checkbox","CheckboxStyle","Click","ClickEvent","Clickable","Collapsing","CollapsingStyle","ColorPicker","ColorPickerStyle","Constrain","Container","ContainerStyle","DELAY","DrawHandler","EventHandler","FANCY","FONT_FAMILY","FONT_FAMILY","FONT_FAMILY","FONT_SIZE","FONT_SIZE","FONT_SIZE","FONT_STRETCH","FONT_STRETCH","FONT_STRETCH","FONT_STYLE","FONT_STYLE","FONT_STYLE","FONT_WEIGHT","FONT_WEIGHT","FONT_WEIGHT","Flex","Flexible","Focus","ICON_COLOR","ICON_SIZE","INSET","KNOB_COLOR","LENGTH","LIGHTNESS_COLOR","LINE_HEIGHT","LINE_HEIGHT","LINE_HEIGHT","Lens","MASK","Memo","Opaque","PADDING","PADDING","PLACEHOLDER_COLOR","Pad","Painter","Press","RebuildHandler","Release","SIZE","SIZE","SLIDER_WIDTH","STROKE","Scroll","ScrollStyle","Slider","SliderStyle","Stack","Suspense","TRANSITION","TRANSITION","TRANSITION","TRANSITION","Text","TextInput","TextInputStyle","TextStyle","Tooltip","TooltipStyle","Transform","Trigger","WIDTH","WIDTH","WRAP","WRAP","WRAP","WithState","WithStyle","Wrap","ZStack","after","after","after","after","align","align","align","align","align","align","align","align","align","align","align","align","align","alignment","alpha_color","alpha_color","alpha_color","amount","amount","animate","animate","any","any","any_horizontal","any_vertical","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","as_any","aspect","axis","axis","axis","axis","axis","axis","axis","axis","background","background","background","background","background","background","background","background","background","background","background","background","background","background","background","before","before","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_color","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_radius","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","border_width","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","bottom","bottom_left","bottom_right","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","build","button","button","button","callback","center","checkbox","checked","checked","circle","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","collapsing","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color","color_picker","column_gap","column_gap","constrain","container","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","content","default","default","default","default_open","default_open","delay","delay","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","descendants","descendants","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","draw","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","drop","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_build","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_draw","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_event","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_layout","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","dyn_rebuild","ellipse","eq","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","event","expand","fallback","fancy","fancy","fancy","flex","flex","fmt","fmt","focus","font_family","font_family","font_family","font_family","font_family","font_family","font_family","font_family","font_size","font_size","font_size","font_size","font_size","font_size","font_size","font_size","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_stretch","font_style","font_style","font_style","font_style","font_style","font_style","font_style","font_style","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","font_weight","format_text","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","from","gap","gap","gap","hash","header","height","height","horizontal","horizontal","horizontal_any","horizontal_vec","hscroll","hstack","hstack","hstack","hstack_any","hstack_vec","hwrap","hwrap","hwrap","hwrap_any","hwrap_vec","icon_color","icon_color","icon_color","icon_size","icon_size","icon_size","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","init","inset","inset","inset","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","into","is_empty","is_empty","is_tight","justify","justify","justify","justify","justify_cross","justify_cross","knob_color","knob_color","knob_color","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","layout","left","len","len","length","length","length","lightness_color","lightness_color","lightness_color","line_height","line_height","line_height","line_height","line_height","line_height","line_height","line_height","marker","mask","mask","mask","max_height","max_height","max_size","max_size","max_width","max_width","memo","min_height","min_height","min_size","min_size","min_width","min_width","multiline","multiline","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","new","on_build","on_click","on_draw","on_draw","on_draw","on_event","on_event_before","on_input","on_input","on_input","on_input","on_input","on_input","on_open","on_open","on_press","on_rebuild","on_release","on_submit","on_submit","opaque","open","open","pad","pad_bottom","pad_left","pad_right","pad_top","padding","padding","padding","padding","padding","padding","painter","placeholder","placeholder","placeholder_color","placeholder_color","placeholder_color","push","push","range","range","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rebuild","rect","right","rotate","rotate_degrees","row_gap","row_gap","scale","size","size","size","size","size","size","size","size","size","slider","slider_width","slider_width","slider_width","space","stroke","stroke","stroke","style","styled","styled","styled","styled","styled","styled","styled","styled","styled","styled","suspense","text","text","text","text","text","text","text","text_input","tight","to_owned","to_owned","tooltip","top","top_left","top_right","transform","transform","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition","transition_active","transition_focused","transition_hot","translate","trigger","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","type_id","unbounded","value","value","vec","vec","vec_horizontal","vec_vertical","vertical","vertical","vertical_any","vertical_vec","vscroll","vstack","vstack","vstack","vstack_any","vstack_vec","vwrap","vwrap","vwrap","vwrap_any","vwrap_vec","width","width","width","width","width","width","width","width","with","with","with_data","with_data_default","with_state","with_state_default","with_style","without_data","without_state","wrap","wrap","wrap","wrap","wrap","wrap","wrap","wrap","zstack","zstack","zstack","Alias","AllScroll","Arrow","Cell","ColResize","Color","Content","ContextMenu","Copy","Crosshair","Cursor","Cursor","Decorated","Default","EResize","EwResize","Fixed","Grab","Grabbing","Help","Icon","Ime","Maximized","Move","NResize","NeResize","NeswResize","NoDrop","NotAllowed","NsResize","NwResize","NwseResize","Pointer","Pointer","Progress","Resizable","RowResize","SResize","Scale","SeResize","Size","SwResize","Text","Title","VerticalText","Visible","WResize","Wait","Window","WindowId","WindowSizing","WindowSnapshot","WindowUpdate","ZoomIn","ZoomOut","borrow","borrow","borrow","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","borrow_mut","clone","clone","clone","clone","clone","clone","clone","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","color","color","color","decorated","decorated","decorated","default","default","default","default","deref","deref","deref","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","deref_mut","difference","drop","drop","drop","drop","drop","drop","drop","eq","eq","eq","eq","eq","fit_content","fmt","fmt","fmt","fmt","fmt","fmt","fmt","fmt","from","from","from","from","from","from","from","get_pointer","get_pointer_mut","hash","hash","height","hovering","icon","icon","icon","id","id","init","init","init","init","init","init","init","into","into","into","into","into","into","into","is_hovered","is_pointer_held","is_pressed","maximized","maximized","maximized","move_pointer","name","new","new","new","physical_size","pointers","pointers_mut","position","press","press_pointer","release","release_pointer","remove_pointer","resizable","resizable","resizable","scale","scale","scale","size","size","size","sizing","sizing","snapshot","title","title","title","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_owned","to_smolstr","to_string","try_from","try_from","try_from","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","type_id","type_id","type_id","updates","visible","visible","visible","width"],"q":[[0,"ori_core"],[22,"ori_core::canvas"],[624,"ori_core::canvas::Primitive"],[634,"ori_core::clipboard"],[654,"ori_core::command"],[729,"ori_core::context"],[1018,"ori_core::event"],[1623,"ori_core::image"],[1785,"ori_core::layout"],[2370,"ori_core::rebuild"],[2373,"ori_core::style"],[2531,"ori_core::text"],[2838,"ori_core::transition"],[2891,"ori_core::view"],[3241,"ori_core::views"],[4789,"ori_core::window"],[5030,"ori_core::canvas::color"],[5031,"ori_core::canvas::border"],[5032,"ori_core::canvas::curve"],[5033,"ori_core::layout::rect"],[5034,"ori_core::layout::point"],[5035,"ori_core::canvas::canvas"],[5036,"ori_core::canvas::stroke"],[5037,"alloc::sync"],[5038,"core::convert"],[5039,"core::fmt"],[5040,"ori_core::image::image"],[5041,"core::hash"],[5042,"ori_core::view::state"],[5043,"core::ops::function"],[5044,"core::option"],[5045,"ori_core::layout::affine"],[5046,"core::iter::traits::iterator"],[5047,"ori_core::layout::vector"],[5048,"smol_str"],[5049,"alloc::string"],[5050,"core::result"],[5051,"core::any"],[5052,"alloc::boxed"],[5053,"core::marker"],[5054,"core::future::future"],[5055,"ori_core::context::event"],[5056,"ori_core::context::build"],[5057,"ori_core::context::rebuild"],[5058,"ori_core::context::layout"],[5059,"ori_core::context::draw"],[5060,"ori_core::context::base"],[5061,"ori_core::context::contexts"],[5062,"core::default"],[5063,"ori_core::text::fonts"],[5064,"ori_core::text::buffer"],[5065,"cosmic_text::buffer"],[5066,"ori_core::window::cursor"],[5067,"ori_core::event::ime"],[5068,"ori_core::layout::size"],[5069,"ori_core::style::style"],[5070,"ori_core::window::window"],[5071,"ori_core::event::modifiers"],[5072,"ori_core::event::keyboard"],[5073,"ori_core::event::pointer"],[5074,"ori_core::event::window"],[5075,"ori_core::event::event"],[5076,"ori_core::image::data"],[5077,"ori_core::image::texture"],[5078,"ori_core::layout::space"],[5079,"ori_core::view::any"],[5080,"alloc::vec"],[5081,"ori_core::layout::alignment"],[5082,"ori_core::layout::justify"],[5083,"ori_core::layout::padding"],[5084,"ori_core::layout::axis"],[5085,"ori_core::layout::matrix"],[5086,"ori_core::style::palette"],[5087,"core::clone"],[5088,"ori_core::views::collapsing"],[5089,"ori_core::views::text_input"],[5090,"ori_core::views::tooltip"],[5091,"ori_core::views::slider"],[5092,"ori_core::views::color_picker"],[5093,"ori_core::views::button"],[5094,"ori_core::views::scroll"],[5095,"ori_core::views::container"],[5096,"ori_core::views::checkbox"],[5097,"ori_core::views::text"],[5098,"ori_core::text::attributes"],[5099,"fontdb"],[5100,"ori_core::text::atlas"],[5101,"ori_core::text::source"],[5102,"std::path"],[5103,"cosmic_text::font::system"],[5104,"cosmic_text::swash"],[5105,"cosmic_text::glyph_cache"],[5106,"std::io::error"],[5107,"cosmic_text::layout"],[5108,"cosmic_text::attrs"],[5109,"ttf_parser::tables::os2"],[5110,"ori_core::view::sequence"],[5111,"ori_core::view::view"],[5112,"ori_core::view::pod"],[5113,"core::cmp"],[5114,"core::iter::traits::collect"],[5115,"bitflags::iter"],[5116,"ori_core::views::build_handler"],[5117,"ori_core::views::event_handler"],[5118,"ori_core::views::aligned"],[5119,"ori_core::views::stack"],[5120,"ori_core::views::wrap"],[5121,"ori_core::views::flex"],[5122,"ori_core::views::animate"],[5123,"ori_core::views::draw_handler"],[5124,"ori_core::views::focus"],[5125,"ori_core::views::memorize"],[5126,"ori_core::views::opaque"],[5127,"ori_core::views::rebuild_handler"],[5128,"ori_core::views::suspense"],[5129,"ori_core::views::trigger"],[5130,"ori_core::views::with_state"],[5131,"ori_core::views::with_style"],[5132,"ori_core::views::aspect"],[5133,"ori_core::views::clickable"],[5134,"ori_core::views::constrain"],[5135,"ori_core::views::pad"],[5136,"ori_core::views::painter"],[5137,"ori_core::views::transform"],[5138,"ori_core::views::zstack"],[5139,"core::ops::range"],[5140,"ori_core::window::pointer"],[5141,"ori_macro"]],"i":[0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,1,26,0,0,0,25,1,0,17,23,24,0,23,24,0,0,0,0,17,17,0,20,18,22,0,18,1,22,23,24,1,0,26,23,24,20,18,0,0,16,0,23,24,1,25,26,0,16,17,17,25,0,22,0,0,1,1,1,7,8,1,1,1,1,7,8,19,9,9,9,1,1,19,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,8,7,7,11,27,11,14,11,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,7,7,8,8,15,16,17,17,18,18,19,20,20,21,22,14,1,1,9,9,23,23,11,24,24,25,25,26,26,27,27,11,15,11,11,22,11,21,1,7,8,19,14,1,11,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,9,23,11,24,25,26,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,1,14,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,11,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,1,14,21,7,8,15,16,17,18,19,20,21,22,14,1,1,9,9,23,11,24,25,26,27,41,7,7,7,7,8,8,8,8,8,8,15,15,16,17,18,19,19,19,19,20,21,21,22,14,1,1,1,9,23,11,11,24,25,26,27,27,1,1,1,15,16,17,18,19,20,1,23,11,25,26,27,0,1,14,0,1,0,1,0,1,0,1,15,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,41,11,11,11,1,1,11,11,27,11,14,8,11,1,11,1,14,7,7,27,1,1,11,1,1,7,8,21,14,9,11,41,0,1,0,1,0,1,0,1,0,1,0,1,0,1,0,1,14,23,11,14,11,11,11,11,11,1,1,14,11,0,1,0,1,1,8,14,1,14,19,41,14,11,1,1,1,1,1,1,1,1,1,1,1,1,1,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,1,1,9,1,1,9,8,7,7,11,15,14,14,14,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,1,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,41,7,8,15,16,17,18,19,20,21,22,14,1,9,23,11,24,25,26,27,11,14,27,228,229,228,230,228,229,230,229,230,230,0,0,53,53,53,53,53,53,53,53,53,54,53,53,53,53,54,53,53,53,0,0,0,0,62,63,57,58,62,63,57,58,57,58,57,58,57,58,58,58,58,62,63,57,58,62,63,57,58,62,63,57,58,62,63,57,58,62,63,57,57,58,62,62,63,57,58,62,63,57,58,62,62,62,57,58,58,62,57,58,62,63,57,58,62,63,57,58,63,62,63,57,58,57,58,0,0,0,0,0,0,0,66,67,66,68,66,68,68,66,71,67,70,66,69,68,72,71,67,70,66,69,68,72,70,67,70,66,69,68,71,71,71,72,71,67,70,66,69,68,71,71,71,71,71,72,71,67,67,70,70,66,66,69,69,68,68,72,71,67,67,70,70,66,66,69,69,68,68,72,67,66,68,70,71,67,70,66,69,68,72,70,70,72,66,71,71,67,70,66,69,68,72,72,71,71,72,72,67,70,66,69,68,67,70,66,69,68,66,66,66,67,70,66,69,68,66,67,70,66,69,68,66,67,70,66,69,68,66,66,70,67,70,66,69,68,71,67,70,66,69,68,72,72,71,67,70,66,69,68,71,67,70,66,69,68,72,67,70,66,69,68,72,67,70,66,69,68,67,70,66,69,68,70,67,66,68,72,66,70,71,67,70,66,69,68,72,70,69,69,67,70,66,69,68,67,70,66,69,68,67,70,66,69,68,71,70,66,70,66,68,72,71,67,70,66,69,68,70,70,67,66,68,67,66,68,67,66,68,67,66,68,66,70,66,68,71,70,67,70,66,69,68,70,70,70,66,70,70,70,71,67,70,66,69,68,72,71,67,70,66,69,68,72,71,67,70,66,69,68,72,66,66,66,67,70,66,69,68,67,70,66,69,68,90,84,84,84,84,84,101,90,90,91,90,84,90,90,90,90,90,84,84,90,84,84,0,101,0,84,90,101,84,84,84,84,84,90,84,84,90,84,90,90,84,84,90,84,90,90,84,90,0,84,90,84,90,84,90,84,90,84,90,84,84,84,84,84,84,84,84,90,84,84,84,84,84,84,90,84,90,84,90,84,90,84,90,84,90,84,90,84,84,84,91,90,90,84,84,84,84,84,84,84,90,84,90,0,84,90,0,90,84,90,84,84,84,0,90,90,90,90,90,90,90,90,90,90,0,101,0,101,90,90,90,90,90,84,90,90,84,90,0,90,84,90,90,90,90,90,90,90,90,90,90,90,90,90,91,90,84,90,84,90,84,84,90,84,0,0,0,101,0,101,0,101,0,101,0,101,91,84,90,90,90,90,90,90,84,84,90,84,90,84,90,91,84,90,84,90,84,90,84,84,84,90,84,90,91,90,84,84,84,90,101,90,90,0,101,0,101,0,101,90,90,90,84,84,83,83,84,86,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,94,95,95,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,79,88,89,84,84,90,90,83,83,86,86,91,91,92,93,94,95,96,97,97,98,98,99,99,100,100,101,88,89,79,83,79,83,92,96,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,79,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,86,90,91,86,79,84,90,83,86,91,92,93,94,95,96,97,98,100,98,92,93,94,95,96,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,104,84,90,101,88,89,101,101,88,89,100,83,88,89,92,94,95,96,92,94,95,96,99,79,83,98,79,88,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,101,79,88,89,84,90,83,86,91,92,93,94,95,96,97,98,99,100,98,97,98,99,100,109,0,109,0,0,0,0,0,36,105,106,36,107,108,109,105,106,36,107,108,109,36,105,106,36,107,108,109,105,106,36,107,108,109,105,106,106,36,107,108,108,109,36,105,105,105,105,36,108,109,105,105,106,36,36,107,108,109,105,105,106,36,107,108,109,36,36,105,106,36,107,108,109,36,36,36,36,36,105,106,36,107,108,109,36,105,105,106,36,107,108,109,105,106,36,36,107,108,109,109,109,108,105,105,106,36,107,108,105,36,107,105,106,36,107,108,109,105,106,36,107,108,109,36,36,36,105,36,108,36,36,105,105,105,107,108,105,106,36,107,108,109,105,106,36,107,108,109,105,106,36,107,108,109,105,106,36,107,108,109,107,105,0,0,0,0,114,114,114,114,115,118,115,118,0,80,110,115,117,43,119,80,0,0,114,0,13,48,13,48,13,48,0,0,114,0,0,0,118,118,118,115,118,115,114,114,114,80,110,0,117,13,48,13,48,13,12,80,110,48,13,13,13,12,12,80,80,80,110,48,48,13,13,13,12,12,80,80,80,110,48,48,114,115,116,13,80,48,48,48,12,12,110,12,110,120,43,114,117,115,118,119,116,13,12,80,110,48,120,43,114,117,115,118,119,116,13,12,80,110,48,12,116,12,12,12,13,80,48,12,12,12,12,13,12,80,48,43,114,117,115,118,119,116,13,12,80,110,48,43,114,117,115,118,119,116,13,12,80,110,48,43,43,114,114,117,117,115,115,118,118,119,119,116,116,13,13,12,12,80,80,110,110,48,48,110,12,12,48,43,114,119,116,13,12,80,110,48,120,43,114,117,115,118,119,116,13,12,80,110,48,120,43,114,117,115,118,119,116,13,12,80,110,48,119,13,13,13,13,80,80,80,48,48,13,13,13,80,80,80,48,48,48,120,43,114,117,115,118,119,116,13,12,80,110,48,43,114,117,115,118,119,116,13,12,80,110,48,110,80,110,13,80,48,43,114,117,115,118,119,116,13,13,12,80,80,110,48,48,13,120,43,114,114,114,117,115,118,119,116,116,116,116,116,116,13,13,13,13,13,13,12,12,12,80,80,80,80,80,80,110,110,48,48,48,48,48,48,119,48,119,110,43,117,115,118,119,13,12,80,110,48,48,12,80,12,12,120,43,114,117,115,118,119,116,13,12,80,110,48,12,12,120,43,114,117,115,118,119,116,13,12,80,110,48,120,43,119,13,80,110,13,80,110,13,118,12,116,48,48,13,110,110,110,117,43,13,80,48,12,110,80,12,13,80,48,12,110,80,12,117,43,43,43,119,119,119,13,13,13,80,80,80,48,48,43,13,13,13,80,80,80,48,48,13,48,114,119,116,13,12,80,110,48,120,48,116,12,117,0,13,13,13,80,80,80,48,48,13,13,13,80,80,80,48,48,12,116,43,43,13,12,80,48,43,12,110,48,116,12,13,13,13,13,12,12,80,80,80,110,48,48,13,13,13,12,12,80,80,80,110,48,48,43,114,117,115,118,119,116,13,12,80,110,48,80,48,13,48,13,80,48,13,80,48,13,80,12,116,12,12,12,12,43,43,120,43,114,117,115,118,119,116,13,12,80,110,48,12,120,43,114,117,115,118,119,116,13,12,80,110,48,120,43,114,117,115,118,119,116,13,12,80,110,48,12,117,12,80,114,119,13,48,114,119,13,48,0,0,122,125,125,125,125,125,126,125,125,125,125,125,125,125,125,125,125,125,125,125,125,125,125,125,125,0,126,0,0,0,126,125,125,125,125,123,125,81,126,123,125,81,126,123,125,81,126,123,125,81,126,123,123,125,125,81,126,0,125,125,125,125,81,123,125,81,126,123,125,81,126,123,125,81,126,81,125,126,123,125,81,81,81,81,81,81,81,81,81,81,81,81,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,126,81,126,81,126,81,126,125,123,125,81,126,81,81,81,81,123,125,81,126,0,125,123,81,125,125,125,0,125,125,123,125,81,126,123,125,81,126,123,125,81,126,123,125,81,126,0,125,0,143,143,146,149,146,144,140,149,143,143,146,144,144,144,140,0,0,0,0,0,0,0,145,143,146,143,146,140,143,140,147,144,145,145,149,146,143,140,144,144,140,146,143,0,0,0,0,146,144,144,147,140,76,76,150,142,140,143,144,145,146,147,148,76,74,149,150,142,140,143,144,145,146,147,148,76,74,149,76,74,142,140,143,144,145,146,147,148,149,142,140,143,144,145,146,147,148,149,142,142,140,143,143,144,144,145,145,146,146,147,147,148,149,74,140,143,144,145,146,147,148,74,150,142,140,143,144,145,146,147,148,76,74,149,150,142,140,143,144,145,146,147,148,76,74,149,74,150,142,140,143,144,145,146,147,148,76,74,149,140,143,144,145,146,147,148,148,150,142,140,143,144,145,146,147,148,76,74,149,74,74,150,142,140,140,140,140,143,144,145,146,147,148,76,74,149,149,149,149,149,149,76,140,143,144,145,146,147,150,0,150,142,140,143,144,145,146,147,148,76,74,149,150,150,142,140,143,144,145,146,147,148,76,74,149,142,74,150,76,74,74,76,76,76,76,76,76,76,76,76,148,148,74,146,147,148,143,144,145,142,140,143,144,145,146,147,148,149,150,142,140,143,144,145,146,147,148,76,74,149,150,142,140,143,144,145,146,147,148,76,74,149,150,142,140,143,144,145,146,147,148,76,74,149,142,148,163,0,163,0,163,164,163,164,163,164,163,164,163,163,164,164,164,163,164,163,164,163,164,163,164,164,0,164,164,163,164,163,163,164,163,164,164,163,163,164,163,164,0,164,164,163,164,163,164,163,164,163,164,166,165,0,0,0,165,166,166,166,166,166,166,166,166,165,0,0,0,0,168,169,0,0,0,0,0,0,165,166,0,111,171,38,165,166,165,166,165,166,165,166,165,165,166,166,165,166,165,166,175,173,171,172,165,166,38,75,175,173,171,172,165,166,38,75,168,169,170,171,172,171,172,165,166,38,171,172,165,166,38,171,171,172,172,165,165,166,166,38,38,38,165,166,165,166,75,75,165,166,38,75,175,175,173,173,171,171,172,172,165,166,38,75,175,175,173,173,171,171,172,172,165,166,38,75,165,166,169,170,171,168,172,175,173,171,172,165,166,38,75,111,171,111,171,111,171,111,171,111,171,165,166,171,172,165,166,38,169,170,171,168,172,165,166,75,171,172,165,165,165,165,165,166,166,166,166,166,38,38,75,175,173,171,171,171,172,172,172,165,166,38,75,165,166,165,165,166,166,165,166,165,166,165,166,75,75,173,75,75,75,171,172,165,166,38,75,75,175,173,171,172,165,166,38,75,165,166,75,165,166,165,166,175,173,171,172,165,166,38,75,165,166,75,165,166,172,165,166,75,75,75,165,166,165,166,169,170,171,168,172,168,172,75,75,75,75,75,75,171,172,38,75,165,166,38,0,75,75,75,75,75,168,169,170,171,172,168,172,75,165,166,75,75,75,75,165,166,75,75,75,75,75,75,75,75,75,165,166,165,166,165,166,171,172,165,166,38,38,38,165,166,75,75,175,173,171,172,165,166,38,75,175,173,171,172,165,166,38,75,175,173,171,172,165,166,38,75,165,166,75,138,130,131,133,0,0,0,137,129,136,132,131,134,137,129,133,136,132,131,134,137,129,136,135,132,131,134,137,129,133,136,132,131,0,0,0,134,137,135,132,138,130,131,0,0,215,0,0,0,0,0,0,0,0,0,131,0,0,134,138,130,131,138,130,131,138,130,131,138,130,131,138,130,131,0,0,0,129,129,135,135,132,133,138,130,131,0,136,0,0,134,131,130,0,0,215,0,215,137,133,133,137,0,0,0,0,0,0,134,137,129,135,0,0,0,0,0,0,0,0,135,132,138,130,131,0,0,0,0,181,183,181,183,0,185,186,187,188,185,186,138,187,130,212,131,188,184,189,189,133,190,216,0,191,185,188,185,185,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,207,192,193,185,188,192,193,185,188,0,195,196,194,193,195,137,196,129,194,136,193,132,212,131,183,183,197,195,196,189,194,193,197,134,195,137,196,129,189,133,194,136,193,132,212,131,197,195,196,194,192,193,197,134,195,137,196,129,194,136,192,135,193,132,212,131,197,195,196,189,194,193,197,134,195,137,196,129,189,133,194,136,193,132,212,131,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,0,0,0,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,0,208,208,208,0,0,195,195,0,215,216,215,216,215,215,216,216,0,197,195,189,192,193,186,187,197,134,195,137,189,192,135,193,132,186,138,187,130,212,131,0,188,188,0,0,208,181,198,183,201,202,204,206,184,207,197,208,196,209,194,190,210,192,185,212,213,188,214,189,216,187,196,196,212,131,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,208,208,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,211,192,193,185,186,187,212,213,188,214,211,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,0,215,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,208,0,203,197,197,134,0,190,215,216,0,186,187,186,138,187,130,212,131,186,187,186,138,187,130,212,131,186,187,186,138,187,130,212,131,186,187,186,138,187,130,212,131,186,187,186,138,187,130,212,131,0,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,186,138,187,130,212,131,213,188,214,185,188,185,215,196,0,209,185,188,188,188,0,0,0,0,0,0,0,0,0,0,0,196,196,129,196,196,129,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,192,192,135,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,185,188,216,185,188,185,188,188,188,192,192,135,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,0,185,188,193,193,132,189,189,133,186,187,186,138,187,130,212,131,208,194,194,136,0,209,0,209,0,209,0,0,209,0,209,0,209,187,187,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,195,208,196,189,209,194,190,210,211,192,193,185,186,187,212,213,188,214,0,0,0,198,198,0,0,189,193,187,189,193,187,196,196,0,0,0,187,187,0,196,196,0,0,0,0,0,197,197,134,210,212,131,0,187,187,187,187,130,185,188,193,193,191,181,198,183,199,200,201,202,203,204,205,206,184,184,207,207,197,197,134,195,195,137,208,208,196,196,129,189,189,133,209,209,194,194,136,190,190,210,210,211,211,192,192,135,193,193,132,185,185,186,138,187,130,212,212,131,213,213,188,188,214,202,0,0,0,0,188,188,0,0,195,189,211,195,137,189,133,211,0,189,189,133,209,195,195,137,206,134,137,129,133,136,135,132,138,130,131,0,0,186,187,186,187,212,0,0,190,215,216,0,0,0,0,0,213,0,197,195,196,192,197,134,195,137,196,129,192,135,0,0,0,0,0,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,191,181,198,183,199,200,201,202,203,204,205,206,184,207,197,134,195,137,215,208,196,129,189,133,209,194,136,216,190,210,211,192,135,193,132,185,186,138,187,130,212,131,213,188,214,209,193,193,185,188,185,185,185,188,188,188,0,0,0,0,0,0,0,0,0,0,0,0,209,192,193,192,135,193,132,185,188,0,0,0,0,0,0,0,186,187,186,138,187,130,212,131,0,0,0,78,78,78,78,78,226,225,78,78,78,0,226,226,78,78,78,225,78,78,78,226,226,226,78,78,78,78,78,78,78,78,78,0,78,78,226,78,78,226,78,226,78,78,226,78,226,78,78,0,0,0,0,0,78,78,78,223,224,225,82,226,227,78,223,224,225,82,226,227,78,223,224,225,82,226,227,78,223,224,225,82,226,227,78,78,223,224,224,225,225,82,226,227,82,82,227,82,82,227,78,224,225,82,78,223,224,225,82,226,227,78,223,224,225,82,226,227,227,78,223,224,225,82,226,227,78,223,224,225,226,82,78,223,224,224,225,82,226,227,78,223,224,225,82,226,227,82,82,78,224,82,223,82,82,227,223,82,78,223,224,225,82,226,227,78,223,224,225,82,226,227,82,82,223,82,82,227,82,78,223,224,82,82,82,82,223,223,82,223,82,82,82,82,227,82,82,227,82,82,227,82,82,82,82,82,227,78,223,224,225,82,226,227,224,224,78,223,224,225,82,226,227,78,223,224,225,82,226,227,78,223,224,225,82,226,227,82,82,82,227,82],"f":"`````````````````````````````````````````````````````````````````````````````````````{{{d{b}}}f}{{bb}c{}}{{{d{hb}}b}j}{ln}{lA`}`{{{d{Ab}}}{{d{Ad}}}}00`5`{{{d{c}}}{{d{e}}}{}{}}0000000000000000000{{{d{hc}}}{{d{he}}}{}{}}0000000000000000000```{{{d{Af}}}Ah}`{{Ajl}Af}{{{d{hAl}}}j}{{{d{hAf}}}j}{{{d{n}}}n}{{{d{A`}}}A`}{{{d{An}}}An}{{{d{B`}}}B`}{{{d{Bb}}}Bb}{{{d{Bd}}}Bd}{{{d{Bf}}}Bf}{{{d{Bh}}}Bh}{{{d{Bj}}}Bj}{{{d{Bl}}}Bl}{{{d{Al}}}Al}{{{d{b}}}b}{{{d{Ab}}}Ab}{{{d{Bn}}}Bn}{{{d{Af}}}Af}{{{d{C`}}}C`}{{{d{Cb}}}Cb}{{{d{Cd}}}Cd}{{{d{Cf}}}Cf}{{{d{c}}{d{he}}}j{}{}}000000000000000000{{{d{c}}}j{}}000000000000000000000000000000{{{d{hAf}}}j}`{{{d{hAf}}AjAjl}j}{{{d{Af}}AjBh}Ch}{{{d{Bl}}}Cj}{{{d{hAf}}AjAjAj}j}`{{bl}b}{{}n}{{}A`}{{}Bf}{{}Al}{{}b}{{}Af}{{}Cf}{Cj{{d{c}}}{}}000000000000{{{d{Ab}}}{{d{c}}}{}}1111111{Cj{{d{hc}}}{}}0000000000000000000:{{{d{hAl}}Al}j}{Cjj}0000000000000000000{AhAf}{{{d{n}}{d{n}}}Ch}{{{d{A`}}{d{A`}}}Ch}{{{d{An}}{d{An}}}Ch}{{{d{B`}}{d{B`}}}Ch}{{{d{Bb}}{d{Bb}}}Ch}{{{d{Bd}}{d{Bd}}}Ch}{{{d{Bf}}{d{Bf}}}Ch}{{{d{Bh}}{d{Bh}}}Ch}{{{d{Bj}}{d{Bj}}}Ch}{{{d{Bl}}{d{Bl}}}Ch}{{{d{Al}}{d{Al}}}Ch}{{{d{b}}{d{b}}}Ch}{{{d{Ab}}{d{Ab}}}Ch}{{{d{Bn}}{d{Bn}}}Ch}{{{d{Af}}{d{Af}}}Ch}{{{d{C`}}{d{C`}}}Ch}{{{d{Cb}}{d{Cb}}}Ch}{{{d{Cd}}{d{Cd}}}Ch}{{{d{Cf}}{d{Cf}}}Ch}{{bl}b}{{{d{hAl}}cBhe}j{{Cn{{Cl{Af}}}}}{{Cn{Bf}}}}`{{{d{n}}{d{hD`}}}Db}{{{d{A`}}{d{hD`}}}Db}{{{d{An}}{d{hD`}}}Db}{{{d{B`}}{d{hD`}}}Db}{{{d{Bb}}{d{hD`}}}Db}{{{d{Bd}}{d{hD`}}}Db}{{{d{Bf}}{d{hD`}}}Db}{{{d{Bh}}{d{hD`}}}Db}{{{d{Bj}}{d{hD`}}}Db}{{{d{Bl}}{d{hD`}}}Db}{{{d{Al}}{d{hD`}}}Db}{{{d{b}}{d{hD`}}}Db}0{{{d{Ab}}{d{hD`}}}Db}0{{{d{Bn}}{d{hD`}}}Db}{{{d{Af}}{d{hD`}}}Db}{{{d{C`}}{d{hD`}}}Db}{{{d{Cb}}{d{hD`}}}Db}{{{d{Cd}}{d{hD`}}}Db}{{{d{Cf}}{d{hD`}}}Db}{cc{}}{{{Dd{llll}}}n}1{{{Df{l}}}n}{ln}3{{{Dd{llll}}}A`}{{{Df{l}}}A`}{{{Dd{ll}}}A`}{lA`}27{DhAn}888{DhBf}{bBf}{AnBf};;{AhBj}<<<<{{{Dd{llll}}}b}{{{Df{l}}}b}>>>{AhAf}????{lCf}`{{{d{b}}}f}{lb}{{{d{An}}{d{hc}}}jDj}{{{d{B`}}{d{hc}}}jDj}{{{d{Bb}}{d{hc}}}jDj}{{{d{Bd}}{d{hc}}}jDj}{{{d{Bf}}{d{hc}}}jDj}{{{d{Bh}}{d{hc}}}jDj}{{{d{b}}{d{hc}}}jDj}{{{d{Bn}}{d{hc}}}jDj}{{{d{Af}}{d{hc}}}jDj}{{{d{Cb}}{d{hc}}}jDj}{{{d{Cd}}{d{hc}}}jDj}{{{d{Cf}}{d{hc}}}jDj}{{{d{Ad}}}b}0{{{d{hAl}}Dle}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}{{lll}b}0{{llll}b}01100`{{}Cj}0000000000000000000{ce{}{}}00000000000000000000{{{d{Af}}}c{}}{{{d{Af}}}Ch}0{bCh}01{{{d{Af}}}Eb}`{{{d{Af}}}{{Ed{Aj}}}}{{{d{hAl}}Ef{Ed{Bj}}{Ed{Dl}}e}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}`{{{d{Af}}}Cj}{{bl}b}{{{d{hAf}}Aj}j}{bl}{{{d{hAl}}Bje}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}{{{d{n}}}l}0`{{bbl}b}04{{bb}c{}}{{bl}c{}}{{llll}n}{{llll}A`}{{cBh}Bj{{Cn{{Cl{Af}}}}}}{{}Al}{{ffff}Ab}{{}Af}{{{d{hEb}}}{{Ed{c}}}{}}{{lll}b}0{{llll}b}0110011001100{{{d{hAl}}Ehe}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}{{{d{Bn}}}Cj}{{{d{Af}}}{{d{{Ej{Aj}}}}}}{{{d{Al}}}{{`{{En{}{{El{{d{Bl}}}}}}}}}}{{{d{hAf}}Ah}j}0{{{d{hAf}}AhnA`}j}{{{d{hAf}}Ahn}j}{{{d{hAf}}AjAj}j}`{{{d{b}}}f}{{{d{hAl}}Ahc}j{{Cn{Bf}}}}{AhAf}<<;;{{ffff}b}`{{{d{hAl}}le}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}{{bl}b}{{{d{hAl}}F`e}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}`{{{d{Eb}}}{{Dd{Cj{Ed{Cj}}}}}}{{{d{hAl}}ceg}j{{Cn{{Cl{Af}}}}}{{Cn{Cf}}}{{Cn{Bf}}}}{{{d{hAf}}{d{Af}}Cf}j}{bAb}{b{{Dd{lll}}}}{b{{Dd{llll}}}}1010101010{{{d{c}}}e{}{}}000000000000000000{b{{Df{f}}}}{{{d{c}}}Fb{}}0{b{{Df{l}}}}{{{d{c}}}Fd{}}0```{{{d{hAf}}Ef}j}`{{{d{hAl}}Efe}c{}{{E`{{d{hAl}}}{{Dn{c}}}}}}={{{d{hAl}}AhDl}j}{c{{Ff{e}}}{}{}}0000000000000000000{{{d{Ad}}}{{Ed{b}}}}11111111111111111111{{{d{c}}}Fh{}}0000000000000000000{{{d{Af}}}{{d{{Ej{Bn}}}}}}{{{d{Al}}Aj}{{Ed{Dl}}}}`````````````{{{d{c}}}{{d{e}}}{}{}}{{{d{hc}}}{{d{he}}}{}{}}{{}Fj}{Cj{{d{c}}}{}}{Cj{{d{hc}}}{}}{Cjj}{{{d{Fj}}{d{hD`}}}Db}{cc{}}{{{d{hFj}}}Fd}{{{d{hFl}}}Fd}{{}Cj}{ce{}{}}{{{Fn{Fl}}}Fj}{{{d{hFj}}c}j{{G`{Ad}}}}{{{d{hFl}}{d{Ad}}}j}{c{{Ff{e}}}{}{}}0{{{d{c}}}Fh{}}````{{{d{c}}}{{d{e}}}{}{}}000{{{d{hc}}}{{d{he}}}{}{}}000{{{d{Gb}}}Gb}{{{d{Gd}}}Gd}{{{d{c}}{d{he}}}j{}{}}0{{{d{c}}}j{}}0{{{d{Gd}}c}j{GfGh}}{{{d{Gd}}e}j{GfGh}{{Gj{}{{Dn{c}}}}Gh}}{{{d{Gd}}Gl}j}{Cj{{d{c}}}{}}000{Cj{{d{hc}}}{}}000{Cjj}000{{{d{Gl}}{d{hD`}}}Db}{{{d{Gn}}{d{hD`}}}Db}{{{d{Gb}}{d{hD`}}}Db}{{{d{Gd}}{d{hD`}}}Db}{cc{}}00{{{Cl{H`}}}Gb}1{{{d{Gl}}}{{Ed{{d{c}}}}}Gf}{{}Cj}000{ce{}{}}000{{{d{Gl}}}Ch}{{{d{Gl}}}{{d{Ad}}}}{cGl{GfGh}}{cGb{H`GhHb}}{Gb{{Dd{GdGn}}}}{{{d{Gd}}c}j{{Gj{}{{Dn{j}}}}Gh}}{Gl{{Fn{Gf}}}}{{{d{c}}}e{}{}}0{c{{Ff{e}}}{}{}}0000000{{{d{Gn}}}{{Ed{Gl}}}}{{{d{c}}}Fh{}}000{{{d{Gb}}}j}{{{d{Gd}}}j}```````{{{d{Hd}}}Ch}{{{d{hHf}}}j}{{{d{hHd}}}j}{{{d{hHh}}}j}{{{d{hHd}}}Hf}{{{d{hHh}}}Hf}{{{d{hHh}}}Hj}{{{d{hHd}}}Hh}{{{d{c}}}{{d{e}}}{}{}}000000{{{d{hc}}}{{d{he}}}{}{}}000000{{{d{hHl}}}{{d{hAl}}}}{{{d{hHf}}}Hf}{{{d{hHl}}}Hl}{{{d{hHd}}}Hd}{{{d{hHj}}}Hj}{{{d{hHh}}}Hh}{{{d{hHn}}}{{d{hFj}}}}{{{d{hHn}}c}j{GfGh}}{{{d{Hn}}e}j{GfGh}{{Gj{}{{Dn{c}}}}Gh}}{{{d{I`}}}Ch}{{{d{Hn}}}Ch}{{{d{Hf}}}Ch}{{{d{Hl}}}Ch}{{{d{Hd}}}Ch}{{{d{Hj}}}Ch}{{{d{Hh}}}Ch}{{{d{Hn}}}{{d{c}}}Gf}{{{d{hHn}}}{{d{hc}}}Gf}{{{d{hHn}}}{{d{hc}}}{GfIb}}{{{d{Hn}}}{{d{I`}}}}{{{d{hHn}}}{{d{hI`}}}}{{}I`}{Cj{{d{c}}}{}}0{{{d{Hf}}}{{d{c}}}{}}{{{d{Hl}}}{{d{c}}}{}}2{{{d{Hd}}}{{d{c}}}{}}3{{{d{Hj}}}{{d{c}}}{}}4{{{d{Hh}}}{{d{c}}}{}}55{Cj{{d{hc}}}{}}{{{d{hHf}}}{{d{hc}}}{}}1{{{d{hHl}}}{{d{hc}}}{}}2{{{d{hHd}}}{{d{hc}}}{}}3{{{d{hHj}}}{{d{hc}}}{}}44{{{d{hHh}}}{{d{hc}}}{}}5{{{d{hHf}}}j}{{{d{hHd}}}j}{{{d{hHh}}}j}{{{d{hHl}}Al}j}{Cjj}000000{{{d{hHl}}AfBhc}j{{Cn{Bf}}}}{{{d{hHl}}Ahc}j{{Cn{Bf}}}}{{{d{I`}}{d{hD`}}}Db}{{{d{Hd}}}Ch}{{{d{hHn}}}{{d{hId}}}}{cc{}}000000{{{d{I`}}}{{Ed{{d{c}}}}}Gf}{{{d{Hn}}}{{Ed{{d{c}}}}}Gf}{{{d{hHn}}}{{Ed{{d{hc}}}}}Gf}{{{d{hI`}}}{{Ed{{d{hc}}}}}Gf}{{{d{hI`}}}{{d{hc}}}{GfIb}}{{{d{Hf}}}{{Ed{{d{c}}}}}{}}{{{d{Hl}}}{{Ed{{d{c}}}}}{}}{{{d{Hd}}}{{Ed{{d{c}}}}}{}}{{{d{Hj}}}{{Ed{{d{c}}}}}{}}{{{d{Hh}}}{{Ed{{d{c}}}}}{}}{{{d{hHf}}}{{Ed{{d{hc}}}}}{}}{{{d{hHl}}}{{Ed{{d{hc}}}}}{}}{{{d{hHd}}}{{Ed{{d{hc}}}}}{}}{{{d{hHj}}}{{Ed{{d{hc}}}}}{}}{{{d{hHh}}}{{Ed{{d{hc}}}}}{}}{{{d{Hd}}}Ch}00{{{d{Hf}}}Ch}{{{d{Hl}}}Ch}2{{{d{Hj}}}Ch}{{{d{Hh}}}Ch}43241043241044{{{d{hHl}}e}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{Hf}}}Dl}{{{d{Hl}}}Dl}{{{d{Hd}}}Dl}{{{d{Hj}}}Dl}{{{d{Hh}}}Dl}{{}Cj}000000{{{d{hI`}}c}{{Ed{c}}}Gf}{{{d{hHn}}c}{{Ed{c}}}Gf}{{{d{hHf}}c}j{}}{{{d{hHl}}c}j{}}{{{d{hHd}}c}j{}}{{{d{hHj}}c}j{}}{{{d{hHh}}c}j{}}{ce{}{}}000000{{{d{Hf}}}Ch}{{{d{Hl}}}Ch}{{{d{Hd}}}Ch}{{{d{Hj}}}Ch}{{{d{Hh}}}Ch}{{{d{I`}}}Ch}5432154321{{{d{Hl}}Ah}Ch}{{{d{hHf}}}j}{{{d{hHd}}}j}{{{d{hHh}}}j}{{{d{I`}}}Cj}{{{d{Hd}}Aj}Aj}{{{d{hHl}}cg}e{{Cn{Bj}}}{}{{E`{{d{hHl}}}{{Dn{e}}}}}}{{{d{hI`}}{d{hGd}}}Hn}{{{d{hHn}}{d{hIf}}}Hf}{{{d{hHn}}{d{hIf}}{d{hAl}}}Hl}{{{d{hHn}}{d{hIf}}{d{hCh}}}Hd}{{{d{hHn}}{d{hIf}}}Hj}{{{d{hHn}}{d{hIf}}}Hh}{{}I`}{{{d{hHl}}Ehe}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHj}}{d{Ih}}F`}j}{{{d{hHj}}{d{Ij}}F`}j}{{{d{hHf}}c}{{d{hc}}}{}}{{{d{hHl}}c}{{d{hc}}}{}}{{{d{hHd}}c}{{d{hc}}}{}}{{{d{hHj}}c}{{d{hc}}}{}}{{{d{hHh}}c}{{d{hc}}}{}}{{{d{hHf}}}{{d{hc}}}Ib}{{{d{hHl}}}{{d{hc}}}Ib}{{{d{hHd}}}{{d{hc}}}Ib}{{{d{hHj}}}{{d{hc}}}Ib}{{{d{hHh}}}{{d{hc}}}Ib}{{{d{hHf}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{hHl}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{hHd}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{hHj}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{hHh}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{Hn}}}Gd}{{{d{hHl}}Ahcegi}j{{Cn{Bf}}}{{Cn{n}}}{{Cn{A`}}}{{Cn{Bf}}}}{{{d{hHd}}}j}{{{d{Hl}}}Ah}{{{d{Hd}}}Ah}{{{d{Hh}}}Ah}{{{d{hI`}}}{{Ed{c}}}Gf}{{{d{hHn}}}{{Ed{c}}}Gf}{{{d{hHf}}}{{Ed{c}}}{}}{{{d{hHl}}}{{Ed{c}}}{}}{{{d{hHd}}}{{Ed{c}}}{}}{{{d{hHj}}}{{Ed{c}}}{}}{{{d{hHh}}}{{Ed{c}}}{}}{{{d{hHl}}le}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHl}}F`e}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHf}}Ch}Ch}{{{d{hHd}}Ch}Ch}{{{d{hHh}}Ch}Ch}{{{d{hHf}}{Ed{Il}}}j}{{{d{hHd}}{Ed{Il}}}j}{{{d{hHh}}{Ed{Il}}}j}543543{{{d{hHd}}{Ed{In}}}j}{{{d{Hl}}}J`}{{{d{Hd}}}J`}{{{d{Hh}}}J`}{{{d{hHn}}c}j{{Gj{}{{Dn{j}}}}Gh}}{{{d{hHl}}Afce}j{{Cn{Cf}}}{{Cn{Bf}}}}{{{d{Hf}}}{{d{Jb}}}}{{{d{Hl}}}{{d{Jb}}}}{{{d{Hd}}}{{d{Jb}}}}{{{d{Hj}}}{{d{Jb}}}}{{{d{Hh}}}{{d{Jb}}}}{{{d{hHl}}{d{Ih}}bF`}j}{{{d{hHl}}{d{Ij}}bF`}j}{{{d{Hl}}}Ef}{{{d{Hd}}}Ef}{{{d{hHl}}Efe}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHl}}F`e}c{}{{E`{{d{hHl}}}{{Dn{c}}}}}}{{{d{hHl}}Ah}j}{c{{Ff{e}}}{}{}}0000000000000{{{d{c}}}Fh{}}000000{{{d{Hd}}}Ch}00{{{d{Hf}}}{{d{Jd}}}}{{{d{Hl}}}{{d{Jd}}}}{{{d{Hd}}}{{d{Jd}}}}{{{d{Hj}}}{{d{Jd}}}}{{{d{Hh}}}{{d{Jd}}}}{{{d{hHf}}}{{d{hJd}}}}{{{d{hHl}}}{{d{hJd}}}}{{{d{hHd}}}{{d{hJd}}}}{{{d{hHj}}}{{d{hJd}}}}{{{d{hHh}}}{{d{hJd}}}}`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{d{Jf}}}Ch}{Jh{{Ed{Jj}}}}{{{d{Jl}}}Jn}{{{d{c}}}{{d{e}}}{}{}}00000000000000000{{{d{hc}}}{{d{he}}}{}{}}00000000000000000```{{{d{In}}}In}{{{d{K`}}}K`}{{{d{Kb}}}Kb}{{{d{Jh}}}Jh}{{{d{Kd}}}Kd}{{{d{Jf}}}Jf}{{{d{Jl}}}Jl}{{{d{Kf}}}Kf}{{{d{Kh}}}Kh}{{{d{Kj}}}Kj}{{{d{Kl}}}Kl}{{{d{Kn}}}Kn}{{{d{L`}}}L`}{{{d{Lb}}}Lb}{{{d{Ld}}}Ld}{{{d{Lf}}}Lf}{{{d{Lh}}}Lh}{{{d{c}}{d{he}}}j{}{}}0000000000000000{{{d{c}}}j{}}0000000000000000000000000{{{d{Lj}}}{{Ed{{d{c}}}}}Gf}````{{}In}{{}Jf}``{Cj{{d{c}}}{}}00000000000000000{Cj{{d{hc}}}{}}00000000000000000{Cjj}00000000000000000{{{d{In}}{d{In}}}Ch}{{{d{Jh}}{d{Jh}}}Ch}{{{d{Kd}}{d{Kd}}}Ch}{{{d{Jf}}{d{Jf}}}Ch}{{{d{Jl}}{d{Jl}}}Ch}{{{d{Kf}}{d{Kf}}}Ch}{{{d{Kh}}{d{Kh}}}Ch}{{{d{Kj}}{d{Kj}}}Ch}{{{d{Kl}}{d{Kl}}}Ch}{{{d{Kn}}{d{Kn}}}Ch}{{{d{L`}}{d{L`}}}Ch}{{{d{Lb}}{d{Lb}}}Ch}{{{d{Ld}}{d{Ld}}}Ch}{{{d{Lf}}{d{Lf}}}Ch}{{{d{Lh}}{d{Lh}}}Ch}{{{d{Lj}}{d{hD`}}}Db}{{{d{In}}{d{hD`}}}Db}{{{d{K`}}{d{hD`}}}Db}{{{d{Kb}}{d{hD`}}}Db}{{{d{Jh}}{d{hD`}}}Db}{{{d{Kd}}{d{hD`}}}Db}{{{d{Jf}}{d{hD`}}}Db}{{{d{Jl}}{d{hD`}}}Db}{{{d{Kf}}{d{hD`}}}Db}{{{d{Kh}}{d{hD`}}}Db}{{{d{Kj}}{d{hD`}}}Db}{{{d{Kl}}{d{hD`}}}Db}{{{d{Kn}}{d{hD`}}}Db}{{{d{L`}}{d{hD`}}}Db}{{{d{Lb}}{d{hD`}}}Db}{{{d{Ld}}{d{hD`}}}Db}{{{d{Lf}}{d{hD`}}}Db}{{{d{Lh}}{d{hD`}}}Db}{cc{}}00000000000000000{{{d{c}}}JlLl}{f{{Ed{Kd}}}}{LnKf}{JnJl}{{{d{In}}{d{hc}}}jDj}{{{d{Jh}}{d{hc}}}jDj}{{{d{Kd}}{d{hc}}}jDj}{{{d{Jf}}{d{hc}}}jDj}{{{d{Jl}}{d{hc}}}jDj}{{{d{Kf}}{d{hc}}}jDj}{{{d{Kh}}{d{hc}}}jDj}{{{d{Kj}}{d{hc}}}jDj}{{{d{Kl}}{d{hc}}}jDj}{{{d{Kn}}{d{hc}}}jDj}{{{d{L`}}{d{hc}}}jDj}{{{d{Lb}}{d{hc}}}jDj}{{{d{Ld}}{d{hc}}}jDj}{{{d{Lh}}{d{hc}}}jDj}``````{{}Cj}00000000000000000{ce{}{}}00000000000000000{{{d{M`}}Jh{Ed{Kd}}}Ch}{{{d{Jh}}Jh{Ed{Kd}}}Ch}{{{d{Kd}}Jh{Ed{Kd}}}Ch}{{{d{Lj}}}Ch}{{{d{K`}}c}ChM`}{{{d{Kb}}c}ChM`}{{{d{Lj}}c}ChM`}0`````````````````{{{d{Ld}}}J`}``{{{d{c}}}e{}{}}0000000000000000{c{{Ff{e}}}{}{}}00000000000000000000000000000000000{{{d{c}}}Fh{}}00000000000000000`````````````{{{d{c}}}{{d{Gf}}}{}}{{{d{c}}}{{d{e}}}{}{}}00000{{{d{hc}}}{{d{he}}}{}{}}00000{{{d{hDh}}{d{hHf}}{d{hc}}}e{}{}}{{{d{Mb}}}Mb}{{{d{Md}}}Md}{{{d{Dh}}}Dh}{{{d{Mf}}}Mf}{{{d{Mh}}}Mh}{{{d{Mj}}}Mj}{{{d{c}}{d{he}}}j{}{}}00000{{{d{c}}}j{}}0000000{{{d{hDh}}b}j}{{{d{Mb}}}Md}{{{d{Mb}}}{{d{{Ej{f}}}}}}{{{d{hMb}}}{{d{h{Ej{f}}}}}}{{}Mb}{{}Dh}{{}Mh}{{}Mj}{Cj{{d{c}}}{}}{{{d{Mb}}}{{d{c}}}{}}1{{{d{Dh}}}{{d{c}}}{}}2222{{{d{hMb}}}{{d{hc}}}{}}{Cj{{d{hc}}}{}}00000{{{d{Dh}}}Mf}{{{d{hDh}}{d{hc}}{d{hHl}}{d{he}}}j{}{}}{Cjj}00000{{{d{hc}}{d{hHf}}{d{he}}}{{Fn{Gf}}}{}{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHl}}{d{he}}}j{}{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHh}}{d{he}}{d{Mn}}}j{}{}}{{{d{Mb}}{d{Mb}}}Ch}{{{d{Md}}{d{Md}}}Ch}{{{d{Dh}}{d{Dh}}}Ch}{{{d{Mf}}{d{Mf}}}Ch}{{{d{Mh}}{d{Mh}}}Ch}{{{d{Mj}}{d{Mj}}}Ch}{{{d{hDh}}{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{Mb}}}Ch}{{{d{Mb}}{d{hD`}}}Db}{{{d{Md}}{d{hD`}}}Db}{{{d{Dh}}{d{hD`}}}Db}{{{d{Mf}}{d{hD`}}}Db}{{{d{Mh}}{d{hD`}}}Db}{{{d{Mj}}{d{hD`}}}Db}{cc{}}0{MbDh}1111{DhMj}{MhMj}{JnMh}{{{d{Mb}}N`N`}{{Df{f}}}}{{{d{Mb}}{d{hc}}}jDj}{{{d{Md}}{d{hc}}}jDj}{{{d{Dh}}{d{hc}}}jDj}{{{d{Mf}}{d{hc}}}jDj}{{{d{Mh}}{d{hc}}}jDj}{{{d{Mb}}}N`}{{{d{Dh}}}Md}{{{d{Mf}}}Md}{{}Cj}00000{ce{}{}}00000{{{d{hDh}}{d{hc}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{hDh}}c}j{{E`{{d{hMb}}}}}}{{{d{hDh}}}j}{{{Nb{f}}N`N`}Mb}{{{Nb{f}}N`N`}Dh}{{}Mh}{DhDh}{{{d{hDh}}{d{hc}}{d{hHh}}{d{he}}{d{Dh}}}j{}{}}{{{d{hMb}}Ch}j}{{{d{hMb}}N`N`{Df{f}}}j}{{{d{Mb}}}J`}{{{d{Mf}}}Cj}{MhJn}{{{d{c}}}e{}{}}00000{c{{Ff{e}}}{}{}}00000000000{{{d{c}}}Fh{}}000004{{{d{Mb}}}N`}``````````````````````````````````````````````````````````{{Ajl}c{}}{{AjJ`}c{}}{{AjF`}c{}}{{AhJ`}c{}}{{AhF`}c{}}{{J`F`}c{}}{{J`J`}c{}}{{J`l}c{}}{{MlJ`}c{}}{{F`l}c{}}{{F`F`}c{}}{{{d{hAj}}l}j}{{{d{hAj}}J`}j}{{{d{hAj}}F`}j}{{{d{hAh}}F`}j}{{{d{hAh}}J`}j}{{{d{hJ`}}l}j}{{{d{hJ`}}J`}j}{{{d{hJ`}}F`}j}{{{d{hMl}}J`}j}{{{d{hF`}}F`}j}{{{d{hF`}}l}j}{{NdJ`J`}F`}{{Nfll}l}{lNh}{lAj}{lJ`}{lF`}{F`l}{{F`F`}l}{Ahl}{{AhAh}c{}}{{MlMl}c{}}{{{d{hAh}}Ah}j}{{{d{hMl}}Ml}j}{{{d{c}}}{{d{e}}}{}{}}000000000000{{{d{hc}}}{{d{he}}}{}{}}0000000000006`{AhAj}00{AjAj}{J`J`}{F`F`}333{{AjJ`}Ah}{{AjAjAj}Aj}{{Ahc}Ah{{Cn{Ah}}}}{{J`J`J`}J`}{{F`F`F`}F`}{{{d{Ef}}}Ef}{{{d{Nd}}}Nd}{{{d{Nj}}}Nj}{{{d{Nf}}}Nf}{{{d{Nl}}}Nl}{{{d{Nn}}}Nn}{{{d{Nh}}}Nh}{{{d{Aj}}}Aj}{{{d{Ah}}}Ah}{{{d{J`}}}J`}{{{d{Ml}}}Ml}{{{d{F`}}}F`}{{{d{c}}{d{he}}}j{}{}}00000000000{{{d{c}}}j{}}00000000000000000000000{{MlMl}Ml}{{AhAj}Aj}{{AhAj}Ch}{{F`F`}l}{{}Ef}{{}Nd}{{}Nn}{{}Nh}{{}Aj}{{}Ah}{{}J`}{{}Ml}{{}F`}{Cj{{d{c}}}{}}000000000000{Cj{{d{hc}}}{}}000000000000{Nnl}{{AjAj}l}{{AjJ`}c{}}{{Ajl}c{}}{{AjF`}c{}}{{J`F`}c{}}{{J`l}c{}}{{J`J`}c{}}{{F`F`}c{}}{{F`l}c{}}{{{d{hAj}}J`}j}{{{d{hAj}}F`}j}{{{d{hAj}}l}j}{{{d{hJ`}}l}j}{{{d{hJ`}}F`}j}{{{d{hJ`}}J`}j}{{{d{hF`}}l}j}{{{d{hF`}}F`}j}{{F`F`}l}{Cjj}000000000000{{{d{Ef}}{d{Ef}}}Ch}{{{d{Nd}}{d{Nd}}}Ch}{{{d{Nj}}{d{Nj}}}Ch}{{{d{Nf}}{d{Nf}}}Ch}{{{d{Nl}}{d{Nl}}}Ch}{{{d{Nn}}{d{Nn}}}Ch}{{{d{Nh}}{d{Nh}}}Ch}{{{d{Aj}}{d{Aj}}}Ch}{{{d{Ah}}{d{Ah}}}Ch}{{{d{J`}}{d{J`}}}Ch}{{{d{Ml}}{d{Ml}}}Ch}{{{d{F`}}{d{F`}}}Ch}{{MlJ`}Ml}{J`J`}{{MlJ`}J`}{AjAj}2{F`F`}{{{d{Ef}}{d{hD`}}}Db}{{{d{Nd}}{d{hD`}}}Db}{{{d{Nj}}{d{hD`}}}Db}{{{d{Nf}}{d{hD`}}}Db}{{{d{Nl}}{d{hD`}}}Db}{{{d{Nn}}{d{hD`}}}Db}{{{d{Nh}}{d{hD`}}}Db}{{{d{Aj}}{d{hD`}}}Db}0{{{d{Ah}}{d{hD`}}}Db}{{{d{J`}}{d{hD`}}}Db}0{{{d{Ml}}{d{hD`}}}Db}{{{d{F`}}{d{hD`}}}Db}0={cc{}}0{{{Df{l}}}Nd}1{{{Dd{ll}}}Nd}2222{lNh}{{{Dd{llll}}}Nh}4{{{Df{l}}}Nh}0{{{Dd{ll}}}Nh}6{{{Dd{ll}}}Aj}{lAj}{{{Df{l}}}Aj}{F`Aj}{J`Aj}{J`Ah}<{{{Df{l}}}Ah}{F`J`}>{{{Df{l}}}J`}{{{Dd{ll}}}J`}{AjJ`}{lJ`}{J`Ml}{cc{}}{J`F`}{{{Df{l}}}F`}{AjF`}3{lF`}{{{Dd{ll}}}F`}{lNn}2{F`Nn}8{{{d{Ef}}{d{hc}}}jDj}{{{d{Nj}}{d{hc}}}jDj}{{{d{Nf}}{d{hc}}}jDj}{{{d{Nl}}{d{hc}}}jDj}{{{d{Nn}}{d{hc}}}jDj}{{{d{Aj}}{d{hc}}}jDj}{{{d{Ah}}{d{hc}}}jDj}{{{d{J`}}{d{hc}}}jDj}{{{d{Ml}}{d{hc}}}jDj}{{{d{F`}}{d{hc}}}jDj}{F`F`}{Ahl}`{{AhAj}Ah}{{Ahl}Ah}{{}Cj}000000000000{{AhAh}Ah}{{AhAh}Ch}{ce{}{}}0000000000000{EfEf}{NnNn}{AjCh}{J`Ch}{MlCh}2102{{Nl{d{{Ej{l}}}}ll}O`}<`{F`l}0{{AjAjl}Aj}{MlMl}00{{{d{Nj}}c}l{{Cn{{Dd{ll}}}}}}`{{AjAj}Aj}{{J`J`}J`}{{F`F`}F`}``{J`l}{{AjJ`}Ah}432``105{{EfEf}c{}}{{EfF`}c{}}{{EfAj}c{}}{{NnNn}c{}}{{NnAj}c{}}{{NnF`}c{}}{{AjJ`}c{}}{{AjF`}c{}}{{Ajl}c{}}{{J`J`}c{}}{{J`l}c{}}{{J`F`}c{}}{{F`F`}c{}}{{F`l}c{}}{{{d{hEf}}Ef}j}{{{d{hAj}}l}j}{{{d{hAj}}F`}j}{{{d{hAj}}J`}j}{{{d{hJ`}}F`}j}{{{d{hJ`}}l}j}{{{d{hJ`}}J`}j}{{{d{hF`}}l}j}{{{d{hF`}}F`}j}{Ajc{}}{F`c{}}{{ll}Nd}{{F`F`}Nn}{{llll}Nh}{{ll}Aj}{{AjAj}Ah}{{ll}J`}{{J`J`}Ml}{{ll}F`}{{{d{hO`}}}{{Ed{c}}}{}}{F`F`}{{{d{Nh}}}F`}{AhF`}{{{d{Nj}}ll}c{{Ob{{Dd{ll}}}}}}{ll}{{AjF`}c{}}{{Ajl}c{}}{{AjJ`}c{}}{{J`F`}c{}}{{J`J`}c{}}{{J`l}c{}}{{F`F`}c{}}{{F`l}c{}}{{{d{hAj}}l}j}{{{d{hAj}}J`}j}{{{d{hAj}}F`}j}{{{d{hJ`}}F`}j}{{{d{hJ`}}J`}j}{{{d{hJ`}}l}j}{{{d{hF`}}l}j}{{{d{hF`}}F`}j}{Ahl}`{lEf}{EfEf}{AjAj}{AhAh}{J`J`}{F`F`}{F`Ef}{{Ahl}Ah}{{MlJ`}Ml}3{{{d{Nh}}}J`}{AhJ`}{{AjF`}c{}}{{Ajl}c{}}{{AjAj}c{}}{{AjJ`}c{}}{{AhJ`}c{}}{{AhF`}c{}}{{J`l}c{}}{{J`J`}c{}}{{J`F`}c{}}{{MlJ`}c{}}{{F`F`}c{}}{{F`l}c{}}{{{d{hAj}}F`}j}{{{d{hAj}}l}j}{{{d{hAj}}J`}j}{{{d{hAh}}F`}j}{{{d{hAh}}J`}j}{{{d{hJ`}}F`}j}{{{d{hJ`}}J`}j}{{{d{hJ`}}l}j}{{{d{hMl}}J`}j}{{{d{hF`}}l}j}{{{d{hF`}}F`}j}{{{d{c}}}e{}{}}00000000000{J`Aj}{F`Aj}{AjJ`}{F`J`}{{{d{c}}}Fb{}}00{{{d{c}}}Fd{}}00{AjF`}{J`F`}{Ahl}`{AhAj}00{{AhEf}Ah}{F`Ef}`{c{{Ff{e}}}{}{}}000000000000{{AhAh}{{Ed{Ah}}}}1111111111111{{{d{c}}}Fh{}}000000000000{{AhAh}Ah}{{{d{Nj}}c}{{Dd{ll}}}{{Cn{{Dd{ll}}}}}}8```````````{{{d{Od}}{d{hHh}}{d{Od}}}j}``````````````````````````````````{{{d{c}}}{{d{e}}}{}{}}000{{{d{hc}}}{{d{he}}}{}{}}000{{{d{{Of{c}}}}}{{Of{c}}}Oh}{{{d{Oj}}}Oj}{{{d{Jb}}}Jb}{{{d{{Ol{c}}}}}{{Ol{c}}}On}{{{d{c}}{d{he}}}j{}{}}000{{{d{c}}}j{}}00000{e{{Ol{c}}}{}{{H`{{d{Jb}}}{{Dn{c}}}}GhHb}}``{{}Oj}0{{}Jb}{Cj{{d{c}}}{}}000{Cj{{d{hc}}}{}}000{Cjj}000{{{d{hJb}}c}j{{Cn{Jb}}}}{{{d{Oj}}{d{hD`}}}Db}{{{d{{Ol{c}}}}{d{hD`}}}DbA@`}{cc{}}0{A@bJb}{A@dJb}{A@fJb}{A@hJb}{A@jJb}{A@lJb}{A@nJb}{OjJb}{AA`Jb}9{AAbJb}{AAdJb}{c{{Ol{c}}}{}}{l{{Ol{Nh}}}}{AAfc{}}{l{{Ol{n}}}}{{{Dd{llll}}}{{Ol{A`}}}}{{{Df{l}}}{{Ol{n}}}}{{{Dd{ll}}}{{Ol{Nh}}}}{Fd{{Ol{AAh}}}}{{{Df{l}}}{{Ol{Nh}}}}{{{Df{l}}}{{Ol{A`}}}}{{{Dd{llll}}}{{Ol{Nh}}}}{l{{Ol{A`}}}}{Fb{{Ol{AAh}}}}{{{d{Ad}}}{{Ol{AAh}}}}{cc{}}{{{Of{c}}}{{Ol{c}}}{}}{{{Dd{ll}}}{{Ol{A`}}}}78{{{Dd{llll}}}{{Ol{n}}}}{{{d{Jb}}{Of{c}}}{{Ed{c}}}On}{{{d{{Ol{c}}}}{d{Jb}}}{{Ed{c}}}On}{{{d{Jb}}c{Of{c}}}cOn}{{{d{{Ol{c}}}}{d{Jb}}c}cOn}{{{d{Jb}}e{Of{c}}}cOn{{E`{}{{Dn{c}}}}}}{{{d{{Ol{c}}}}{d{Jb}}e}cOn{{E`{}{{Dn{c}}}}}}`{{}Cj}000{{{d{hJb}}{d{Ad}}{Ol{c}}}j{}}{{{d{hJb}}{d{Ad}}{d{Ad}}}j}{{{d{hJb}}JnJn}j}{{{d{hJb}}{d{Ad}}c}j{}}{ce{}{}}000{{{d{Ad}}}{{Ol{c}}}{}}{{}Oj}{{{d{Ad}}}{{Of{c}}}Oh}{{}Jb}``````{{{d{c}}}e{}{}}000{c{{Ff{e}}}{}{}}0000000{{{d{c}}}Fh{}}000{e{{Ol{c}}}{}{{Cn{c}}}}`````````````````````````````````````````````````````{{{d{AAh}}}AAj}{{{d{hIh}}}{{d{hIj}}}}{{{d{Ih}}}{{d{Ij}}}}{{{d{c}}}{{d{e}}}{}{}}00000000000{{{d{hc}}}{{d{he}}}{}{}}00000000000{{{d{Ih}}}J`}{{{d{Ij}}}J`}{{{d{AAl}}}AAl}{{{d{AAh}}}AAh}{{{d{AAn}}}AAn}{{{d{AB`}}}AB`}{{{d{ABb}}}ABb}{{{d{ABd}}}ABd}{{{d{ABf}}}ABf}{{{d{ABh}}}ABh}{{{d{ABj}}}ABj}{{{d{c}}{d{he}}}j{}{}}00000000{{{d{c}}}j{}}00000000000000`{{}AAh}{{}AAn}{{}AB`}{{}ABb}{{}ABd}{{}ABf}{{}ABh}{{}Id}{Cj{{d{c}}}{}}00000000000{Cj{{d{hc}}}{}}00000000000{{{d{hId}}{d{hAl}}{d{Ij}}bF`l}j}{Cjj}00000000000{{{d{AAh}}{d{AAh}}}Ch}{{{d{AAn}}{d{AAn}}}Ch}{{{d{AB`}}{d{AB`}}}Ch}{{{d{ABb}}{d{ABb}}}Ch}{{{d{ABd}}{d{ABd}}}Ch}{{{d{ABf}}{d{ABf}}}Ch}{{{d{ABh}}{d{ABh}}}Ch}`{{{d{ABl}}{d{hD`}}}Db}{{{d{AAl}}{d{hD`}}}Db}{{{d{AAh}}{d{hD`}}}Db}{{{d{AAn}}{d{hD`}}}Db}{{{d{AB`}}{d{hD`}}}Db}{{{d{ABb}}{d{hD`}}}Db}{{{d{ABd}}{d{hD`}}}Db}{{{d{ABf}}{d{hD`}}}Db}{{{d{ABh}}{d{hD`}}}Db}{{{d{Ih}}{d{hD`}}}Db}{{{d{Id}}{d{hD`}}}Db}{{{d{ABj}}{d{hD`}}}Db}``{cc{}}00{FdAAh}{FbAAh}{{{d{Ad}}}AAh}333333333{ABnABj}{{{d{Ad}}}ABj}{{{d{AC`}}}ABj}{{{d{{Ej{f}}}}}ABj}{{{Nb{f}}}ABj}{IjIh}{{{d{AAh}}{d{hc}}}jDj}{{{d{AAn}}{d{hc}}}jDj}{{{d{AB`}}{d{hc}}}jDj}{{{d{ABb}}{d{hc}}}jDj}{{{d{ABd}}{d{hc}}}jDj}{{{d{ABf}}{d{hc}}}jDj}{{{d{ABl}}}{{d{Dh}}}}`{{}Cj}00000000000{{{d{hABl}}{d{hACb}}{d{hACd}}ACf}{{Ed{AAl}}}}{ce{}{}}00000000000`{{{d{hId}}c}{{Ff{jACh}}}{{Cn{ABj}}}}{N`ABl}{{{d{hId}}ll}Ih}{{}Id}{{{d{hId}}{d{Ij}}F`l}j}{{{d{Ih}}}{{d{Ij}}}}{{{d{hIh}}}{{d{hIj}}}}{{{d{Ih}}}Ah}{{{d{hIh}}ABd}j}{{{d{hIh}}{d{hId}}J`}j}{{{d{hIh}}{d{hId}}ll}j}{{{d{hIh}}{d{hId}}{d{Ad}}ABh}j}{{{d{hIh}}{d{hId}}ABf}j}{{{d{Ih}}}J`}```{ABdACj}{ABfACl}{{{d{ABh}}}ACn}{AAnAD`}{AB`ADb}{ABbADd}{{{d{c}}}e{}{}}00000000{c{{Ff{e}}}{}{}}00000000000000000000000{{{d{c}}}Fh{}}00000000000``````{{{d{c}}}{{d{e}}}{}{}}0{{{d{hc}}}{{d{he}}}{}{}}0{{{d{ADf}}}ADf}{{{d{ADh}}}ADh}{{{d{c}}{d{he}}}j{}{}}0{{{d{c}}}j{}}000{{{d{ADh}}lCh}Ch}{{}ADf}{{}ADh}{Cj{{d{c}}}{}}0{Cj{{d{hc}}}{}}0{Cjj}0`{lADh}0`{{{d{ADf}}{d{ADf}}}Ch}{{{d{ADh}}{d{ADh}}}Ch}{{ADfl}l}{{{d{ADf}}{d{hD`}}}Db}{{{d{ADh}}{d{hD`}}}Db}{cc{}}0{{{d{ADh}}l}l}{{{d{ADf}}{d{hc}}}jDj}{{}Cj}0{ce{}{}}0::{{{d{ADh}}{d{hl}}Chl}Ch}{{{d{c}}}e{}{}}0{c{{Ff{e}}}{}{}}000{{{d{c}}}Fh{}}0```````````````````````````{{}ADj}{{}ADl}{e{{Fn{Mn}}}{}{{Mn{c}}}}{{{d{Mn}}}{{d{Gf}}}}{{{d{c}}}{{d{Gf}}}{}}{{{d{Dl}}}Jn}{{ADjADj}ADj}{{ADlADl}ADl}{{{d{hADj}}ADj}j}{{{d{hADl}}ADl}j}3210{{{d{ADj}}}f}0{{{d{ADl}}}f}05432{{{d{c}}}{{d{e}}}{}{}}0000000{{{d{hc}}}{{d{he}}}{}{}}0000000{{{d{h{AE`{}{{ADn{c}}}}}}{d{hHf}}{d{he}}}{{Dd{c{Nb{If}}}}}{}{}}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hHf}}{d{he}}}c{}Oh}{{{d{h{AEd{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AEf{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AEh{e}}}}{d{hHf}}{d{hc}}}{{AEj{ce}}}{}{{AE`{c}}}}{{{d{{AEf{c}}}}}{{AEf{c}}}On}{{{d{{AEh{c}}}}}{{AEh{c}}}On}{{{d{ADj}}}ADj}{{{d{ADl}}}ADl}{{{d{Dl}}}Dl}{{{d{c}}{d{he}}}j{}{}}0000{{{d{c}}}j{}}000000000{{{d{Dl}}{d{Dl}}}AEl}{ADjADj}{ADlADl}{{{d{ADj}}ADj}Ch}{{{d{ADl}}ADl}Ch}{{{d{If}}}Ch}{{{d{If}}}{{Ed{Il}}}}{{}ADj}{{}ADl}{{}Dl}{{}If}{Cj{{d{c}}}{}}{{{d{{AEn{ce}}}}}{{d{g}}}{}{{AEb{c}}Oh}{}}{{{d{{AEj{ce}}}}}{{d{g}}}{}{{AE`{c}}}{}}22{{{d{{AEf{c}}}}}{{d{e}}}{}{}}{{{d{{AEh{c}}}}}{{d{e}}}{}{}}44444{Cj{{d{hc}}}{}}{{{d{h{AEn{ce}}}}}{{d{hg}}}{}{{AEb{c}}Oh}{}}{{{d{h{AEj{ce}}}}}{{d{hg}}}{}{{AE`{c}}}{}}22{{{d{h{AEf{c}}}}}{{d{he}}}{}{}}3{{{d{h{AEh{c}}}}}{{d{he}}}{}{}}4444{{ADjADj}ADj}{{ADlADl}ADl}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hc}}{d{hHl}}{d{he}}}j{}Oh}{{{d{h{AEd{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AEf{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AE`{}{{ADn{c}}}}}}Cj{d{hc}}{d{hHl}}{d{he}}}j{}{}}{{{d{h{AEh{e}}}}Cj{d{h{AEj{ce}}}}{d{hHl}}{d{hc}}}j{}{{AE`{c}}}}{Cjj}0000000{{{d{hMn}}{d{hHf}}{d{hc}}}{{Fn{Gf}}}{}}{{{d{hc}}{d{hHf}}{d{he}}}{{Fn{Gf}}}{}{}}{{{d{hMn}}{d{hAF`}}{d{hHl}}{d{hc}}}j{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHl}}{d{he}}}j{}{}}{{{d{hMn}}{d{hAF`}}{d{hHd}}{d{hc}}{d{Lj}}}j{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{hMn}}{d{hAF`}}{d{hHj}}{d{hc}}Ml}J`{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{hMn}}{d{hAF`}}{d{hHh}}{d{hc}}{d{Mn}}}j{}}{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHh}}{d{he}}{d{Mn}}}j{}{}}{{}ADj}{{}ADl}{{{d{{AEf{c}}}}{d{{AEf{c}}}}}ChAFb}{{{d{{AEh{c}}}}{d{{AEh{c}}}}}ChAFb}{{{d{ADj}}{d{ADj}}}Ch}{{{d{ADl}}{d{ADl}}}Ch}{{{d{Dl}}{d{Dl}}}Ch}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}Oh}{{{d{h{AEd{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AEf{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AE`{}{{ADn{c}}}}}}Cj{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{h{AEh{e}}}}Cj{d{h{AEj{ce}}}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AE`{c}}}}{{{d{hADj}}c}j{{AFd{}{{El{ADj}}}}}}{{{d{hADl}}c}j{{AFd{}{{El{ADl}}}}}}{{{d{If}}}ADl}{{{d{{AEf{c}}}}{d{hD`}}}DbA@`}{{{d{{AEh{c}}}}{d{hD`}}}DbA@`}{{{d{ADj}}{d{hD`}}}Db}0000{{{d{ADl}}{d{hD`}}}Db}0000{{{d{Dl}}{d{hD`}}}Db}0{{{d{If}}{d{hD`}}}Db}{cc{}}0{c{{AEf{c}}}{}}1{AAfc{}}02{c{{AEh{c}}}{}}3333{f{{Ed{ADj}}}}{f{{Ed{ADl}}}}{fADj}0{fADl}010{cADj{{AFd{}{{El{ADj}}}}}}{cADl{{AFd{}{{El{ADl}}}}}}{{{d{Ad}}}{{Ed{ADj}}}}{{{d{Ad}}}{{Ed{ADl}}}}{{{d{If}}}{{Ed{{d{c}}}}}{}}{{{d{hIf}}}{{Ed{{d{hc}}}}}{}}{{{d{{AEj{ce}}}}}Ch{}{{AE`{c}}}}{{{d{If}}}Ch}00{{{d{{AEf{c}}}}{d{he}}}jLlDj}{{{d{{AEh{c}}}}{d{he}}}jLlDj}{{{d{ADj}}{d{hc}}}jDj}{{{d{ADl}}{d{hc}}}jDj}{{{d{Dl}}{d{hc}}}jDj}{{{d{If}}}Dl}{{{d{If}}}{{Ed{{d{In}}}}}}{{}Cj}0000000{{{d{hADj}}ADj}j}{{{d{hADl}}ADl}j}{{{d{hIf}}c}j{}}{{ADjADj}ADj}{{ADlADl}ADl}{{{d{ADj}}ADj}Ch}{{{d{ADl}}ADl}Ch}{ce{}{}}0000000{ADjc{}}{ADlc{}}{{{d{If}}}Ch}{{{d{ADj}}}Ch}{{{d{ADl}}}Ch}{{{d{{AEh{e}}}}}Ch{}{{AE`{c}}}}21333{{{d{ADj}}}{{AFf{ADj}}}}{{{d{ADl}}}{{AFf{ADl}}}}{{{d{ADj}}}{{AFh{ADj}}}}{{{d{ADl}}}{{AFh{ADl}}}}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hc}}{d{hHj}}{d{he}}Ml}J`{}Oh}{{{d{h{AEd{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AEf{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AE`{}{{ADn{c}}}}}}Cj{d{hc}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{h{AEh{e}}}}Cj{d{h{AEj{ce}}}}{d{hHj}}{d{hc}}Ml}J`{}{{AE`{c}}}}{{{d{{AE`{}{{ADn{c}}}}}}}Cj{}}{{{d{{AEh{e}}}}}Cj{}{{AE`{c}}}}{{{d{hIf}}}j}00???{c{{AEf{c}}}{}}{c{{AEh{c}}}{}}{{}Dl}{DlIf}{ADjADj}{ADlADl}{{{d{Dl}}{d{Dl}}}{{Ed{AEl}}}}67{{{d{hIf}}{d{hIf}}}j}{{{d{hIf}}c}{{d{hc}}}{}}{{{d{hIf}}}{{d{hc}}}Ib}{{{d{hIf}}e}{{d{hc}}}{}{{E`{}{{Dn{c}}}}}}{{{d{h{AE`{}{{ADn{c}}}}}}{d{hc}}{d{hHf}}{d{he}}{d{{AE`{}{{ADn{c}}}}}}}j{}{}}{{{d{h{AEb{}{{ADn{c}}}}}}{d{hc}}{d{hHh}}{d{he}}{d{{AEb{}{{ADn{c}}}}}}}j{}Oh}{{{d{h{AEd{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AEd{c}}}}}j{}{}}{{{d{h{AEf{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AEf{e}}}}}j{}{{AEb{c}}}{}}{{{d{h{AEh{e}}}}{d{h{AEj{ce}}}}{d{hHf}}{d{hc}}{d{{AEh{e}}}}}j{}{{AE`{c}}}}{{{d{h{AE`{}{{ADn{c}}}}}}Cj{d{hc}}{d{hHh}}{d{he}}{d{{AE`{}{{ADn{c}}}}}}}j{}{}}{{{d{h{AEh{e}}}}Cj{d{h{AEj{ce}}}}{d{hHh}}{d{hc}}{d{{AEh{e}}}}}j{}{{AE`{c}}}}{{{d{If}}}Ah}{{{d{hADj}}ADj}j}{{{d{hADl}}ADl}j}{{{d{hIf}}}{{Ed{c}}}{}}{{{d{hIf}}}j}00{{{d{hADj}}ADjCh}j}{{{d{hADl}}ADlCh}j}{{{d{hIf}}Ch}j}{{{d{hIf}}{Ed{Il}}}j}111{{{d{hIf}}{Ed{In}}}j}{{{d{hIf}}J`}j}{{{d{hIf}}Ef}j}{{{d{If}}}J`}{{ADjADj}ADj}{{ADlADl}ADl}=<10{{{d{c}}}e{}{}}0000{{{d{c}}}Fb{}}{{{d{c}}}Fd{}}{{{d{hADj}}ADj}j}{{{d{hADl}}ADl}j}{{{d{If}}}Ef}{{{d{hIf}}F`}j}{c{{Ff{e}}}{}{}}000000000000000{{{d{c}}}Fh{}}0000000:9{{{d{If}}}ADj}`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{AFj{ce}}g}{{AFj{ce}}}{}{}{{AFl{{d{hHf}}{d{hc}}}}}}{{{AFn{ce}}g}{{AFn{ce}}}{}{}{{AFl{{d{hHd}}{d{hc}}{d{Lj}}}}}}``{{ce}{{AG`{e}}}{{Cn{Nd}}}{}}{{{AGb{c}}e}{{AGb{c}}}{}{{Cn{Nf}}}}{{AGdc}AGd{{Cn{{Ol{ABd}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{ABd}}}}}}{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{Nf}}}}`````````{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{b}}}}}}``{{{AGl{c}}l}{{AGl{c}}}{}}`{i{{AGn{egc}}}{}{}{}{{AFl{{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}{{Dn{{Ed{g}}}}}}}}`{Nj{{AGb{{Nb{{Fn{Mn}}}}}}}}{Nj{{AGh{{Nb{{Fn{Mn}}}}}}}}{{}{{AGb{{Nb{{Fn{Mn}}}}}}}}0{{{d{c}}}{{d{Gf}}}{}}00000000000000000000000000000000`{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{Nj}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{Nj}}}}{{{AGb{c}}e}{{AGb{c}}}{}{{Cn{Nj}}}}{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{Nj}}}}````{{ce}{{AHd{e}}}{{Cn{{Ol{b}}}}}{}}{{AHfc}AHf{{Cn{{Ol{b}}}}}}{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{Cn{{Ol{b}}}}}}{{{AHd{c}}e}{{AHd{c}}}{}{{Cn{{Ol{b}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{b}}}}}}``````````{{{AFn{ce}}g}{{AFn{ce}}}{}{}{{AFl{{d{hHd}}{d{hc}}{d{Lj}}}}}}`{{{AHj{c}}e}{{AHj{c}}}{}{{Cn{{Ol{b}}}}}}54{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{b}}}}}}43``````````````{{{AHj{c}}e}{{AHj{c}}}{}{{Cn{{Ol{n}}}}}}{{AHfc}AHf{{Cn{{Ol{n}}}}}}{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{Cn{{Ol{n}}}}}}{{{AHd{c}}e}{{AHd{c}}}{}{{Cn{{Ol{n}}}}}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{n}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{n}}}}}}``````````````{{{AHj{c}}e}{{AHj{c}}}{}{{Cn{{Ol{A`}}}}}}{{AHfc}AHf{{Cn{{Ol{A`}}}}}}{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{Cn{{Ol{A`}}}}}}{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{l}}}}}}{{{AHd{c}}e}{{AHd{c}}}{}{{Cn{{Ol{A`}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{A`}}}}}}``````````````{{{d{c}}}{{d{e}}}{}{}}00000000000000000000000000000000000000000000{{{d{hc}}}{{d{he}}}{}{}}00000000000000000000000000000000000000000000{c{{AG`{c}}}{}}00{{{d{h{AGn{ceg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHl{ce}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHn{ceg}}}}{d{hHf}}{d{hc}}}i{}{}{{AEb{e}}}{}}{{{d{h{AI`{ceg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}AFb{}}{{{d{h{AIb{c}}}}{d{hHf}}{d{he}}}gAEb{}{}}{{{d{h{AId{ce}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AIf{eg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIh{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AIj{ceg}}}}{d{hHf}}{d{hc}}}i{}{}{{AEb{{Dd{ce}}}}}{}}{{{d{h{AIl{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AIn{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHj{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{hAHf}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AJ`{ceg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{h{AHh{ceg}}}}{d{hHf}}{d{hc}}}i{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{h{AGj{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AJb{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHd{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AGl{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AJd{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AJf{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AH`{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AHb{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AGb{e}}}}{d{hHf}}{d{hc}}}g{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AGf{c}}}}{d{hHf}}{d{hc}}}e{}{}}{{{d{h{AJh{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AJj{e}}}}{d{hHf}}{d{hc}}}g{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hHf}}{d{hc}}}g{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hHf}}{d{hc}}}g{}{{AE`{c}}}{}}{c{{AHj{c}}}{}}{{{AJ`{ceg}}i}{{AJ`{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{{Ed{Kf}}}}}}``{c{{AG`{c}}}{}}{ChAHf}{{AHfc}AHf{{Cn{Ch}}}}`{{lc}{{AJf{e}}}{{Cn{Bf}}}{}}{{{d{AJn}}}AJn}{{{d{AK`}}}AK`}{{{d{c}}{d{he}}}j{}{}}0{{{d{c}}}j{}}000{{ce}{{AHh{gce}}}{}{}{}}{{{AHj{c}}e}{{AHj{c}}}{}{{Cn{{Ol{b}}}}}}{{AHfc}AHf{{Cn{{Ol{b}}}}}}{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{b}}}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{b}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{b}}}}}}{{AGdc}AGd{{Cn{{Ol{b}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{b}}}}}}```````````````{{}{{AGj{c}}}{}}{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{l}}}}`{{ce}{{AJb{e}}}{{Cn{Ml}}}{}}{c{{AHd{c}}}{}}{{{AJ`{ceg}}i}{{AJ`{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{{AEf{e}}}}}}``````````````````````4{{}AK`}{{}{{AGf{c}}}{}}{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{Cn{Ch}}}}```{Cj{{d{c}}}{}}0000000000000000000000000000{{{d{{AJd{c}}}}}{{d{e}}}{}{}}1111111111111111{Cj{{d{hc}}}{}}0000000000000000000000000000{{{d{h{AJd{c}}}}}{{d{he}}}{}{}}1111111111111111{{{AJ`{ceg}}i}{{AJ`{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{Ch}}}}`{{{d{h{AGn{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHl{ce}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHn{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{}{{AEb{e}}}{}}{{{d{h{AI`{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}AFb{}}{{{d{h{AIb{c}}}}{d{he}}{d{hHl}}{d{hg}}}jAEb{}{}}{{{d{h{AId{ce}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AIf{eg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIh{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AIj{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{}{{AEb{{Dd{ce}}}}}{}}{{{d{h{AIl{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AIn{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHj{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{hAHf}}{d{hc}}{d{hHl}}{d{he}}}j{}{}}{{{d{h{AJ`{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{h{AHh{ceg}}}}{d{hi}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{h{AGj{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AJb{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHd{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AGl{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AJd{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AJf{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{AJf{c}}e}{{AJf{c}}}{}{{Cn{{Fn{AFl}}}}}}{{{d{h{AH`{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AHb{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AGb{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hc}}{d{hHl}}{d{he}}}j{}{}}{{{d{h{AGf{c}}}}{d{he}}{d{hHl}}{d{hc}}}j{}{}}{{{d{h{AJh{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AJj{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hg}}{d{hHl}}{d{hc}}}j{}{{AE`{c}}}{}}`{Cjj}00000000000000000000000000000000000000000000{{{d{hc}}{d{hHf}}{d{he}}}{{Fn{Gf}}}{}{}}00000000000000000000000000000000{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHl}}{d{he}}}j{}{}}00000000000000000000000000000000{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}00000000000000000000000000000000{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHj}}{d{he}}Ml}J`{}{}}00000000000000000000000000000000{{{d{hc}}{d{h{Fn{Gf}}}}{d{hHh}}{d{he}}{d{Mn}}}j{}{}}00000000000000000000000000000000{{J`c}{{AJf{e}}}{{Cn{Bf}}}{}}{{{d{AJn}}{d{AJn}}}Ch}{{{d{h{AGn{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHl{ce}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHn{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}{{AEb{e}}}{}}{{{d{h{AI`{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}AFb{}}{{{d{h{AIb{c}}}}{d{he}}{d{hHd}}{d{hg}}{d{Lj}}}jAEb{}{}}{{{d{h{AId{ce}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AIf{eg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIh{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AIj{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}{{AEb{{Dd{ce}}}}}{}}{{{d{h{AIl{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AIn{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHj{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{hAHf}}{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{AJ`{ceg}}i}{{AJ`{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{AJn}}}}{{{d{h{AJ`{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{h{AHh{ceg}}}}{d{hi}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{h{AGj{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AJb{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHd{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AGl{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AJd{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AJf{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AH`{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AHb{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AGb{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}j{}{}}{{{d{h{AGf{c}}}}{d{he}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{}}{{{d{h{AJh{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AJj{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hg}}{d{hHd}}{d{hc}}{d{Lj}}}j{}{{AE`{c}}}{}}`{c{{AGl{c}}}{}}{{{AIf{jc}}e}{{AIf{ec}}}{}{}}{{{AHj{c}}e}{{AHj{c}}}{}{{Cn{{Ol{l}}}}}}``2`{{{d{AJn}}{d{hD`}}}Db}{{{d{AK`}}{d{hD`}}}Db}{{gi}{{AHn{cei}}}{}{}{{AFl{{d{hc}}{d{h{AKb{e}}}}}}}{{AEb{e}}}}{{AGdc}AGd{{Cn{{Ol{AAh}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{AAh}}}}}}``````{{AGdc}AGd{{Cn{{Ol{l}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{l}}}}}}``````{{AGdc}AGd{{Cn{{Ol{AB`}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{AB`}}}}}}``````{{AGdc}AGd{{Cn{{Ol{ABb}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{ABb}}}}}}``````{{AGdc}AGd{{Cn{{Ol{AAn}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{AAn}}}}}}```````{cc{}}00000000000000000000000000000000000{AKdAGd}111111111{{{AGb{c}}e}{{AGb{c}}}{}{{Cn{l}}}}{{{AGh{c}}l}{{AGh{c}}}{}}`{{{d{AJn}}{d{hc}}}jDj}`{{lc}{{AJb{c}}}{}}{{{AJb{c}}l}{{AJb{c}}}{}}{c{{AGb{c}}}{}}{c{{AGh{c}}}{}}{{}{{AGh{{Nb{{Fn{Mn}}}}}}}}{{}{{AGh{{Nb{c}}}}}{}}{c{{AH`{c}}}{}}4``{{}{{AGb{{Nb{{Fn{Mn}}}}}}}}{{}{{AGb{{Nb{c}}}}}{}}5``43{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{Cn{{Ol{b}}}}}}``{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{Cn{{Ol{l}}}}}}``{{}Cj}00000000000000000000000000000000000000000000{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{l}}}}}}``{ce{}{}}00000000000000000000000000000000000000000000{{{d{{AGb{{Nb{c}}}}}}}Ch{}}{{{d{{AGh{{Nb{c}}}}}}}Ch{}}`{{{AGb{c}}e}{{AGb{c}}}{}{{Cn{Nl}}}}{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{Nl}}}}``0`{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{b}}}}}}``{{{d{h{AGn{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHl{ce}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHn{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{}{{AEb{e}}}{}}{{{d{h{AI`{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}AFb{}}{{{d{h{AIb{c}}}}{d{he}}{d{hHj}}{d{hg}}Ml}J`AEb{}{}}{{{d{h{AId{ce}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AIf{eg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIh{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AIj{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{}{{AEb{{Dd{ce}}}}}{}}{{{d{h{AIl{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AIn{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHj{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{hAHf}}{d{hc}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{h{AJ`{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{h{AHh{ceg}}}}{d{hi}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{h{AGj{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AJb{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHd{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AGl{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AJd{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AJf{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AH`{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AHb{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AGb{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hc}}{d{hHj}}{d{he}}Ml}J`{}{}}{{{d{h{AGf{c}}}}{d{he}}{d{hHj}}{d{hc}}Ml}J`{}{}}{{{d{h{AJh{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AJj{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AEb{c}}}{}}{{{d{h{AGh{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hg}}{d{hHj}}{d{hc}}Ml}J`{}{{AE`{c}}}{}}{c{{AG`{c}}}{}}{{{d{{AGb{{Nb{c}}}}}}}Cj{}}{{{d{{AGh{{Nb{c}}}}}}}Cj{}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{l}}}}}}``{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{b}}}}}}``{{AGdc}AGd{{Cn{{Ol{l}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{l}}}}}}``````{{{AJ`{ceg}}i}{{AJ`{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{{Cn{{AKh{{AKf{}{{Dn{c}}}}}}}}}}{{{AHd{c}}e}{{AHd{c}}}{}{{Cn{{Ol{Ch}}}}}}``{{lc}{{AJb{c}}}{}}{{{AJb{c}}l}{{AJb{c}}}{}}{{ce}{{AJb{e}}}{{Cn{J`}}}{}}{{{AJb{c}}e}{{AJb{c}}}{}{{Cn{J`}}}}32{{gk}{{AI`{cie}}}{}AFb{{E`{{d{hc}}}{{Dn{e}}}}}{{AEb{c}}}{{E`{{d{hc}}}{{Dn{i}}}}}}432143{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{Ch}}}}`{i{{AGn{egc}}}{}{}{}{{AFl{{d{hc}}{d{hHd}}{d{he}}{d{Lj}}}{{Dn{{Ed{g}}}}}}}}{c{{AFj{ec}}}{}{}}{c{{AHl{ec}}}{}{}}{c{{AFn{ec}}}{}{}}{{ci}{{AHn{egc}}}{}{}{}{{AFl{{d{he}}{d{h{AKb{g}}}}}}}}6{c{{AIb{c}}}AEb}{{cg}{{AId{ec}}}{}{}{{AFl{{d{hHh}}{d{he}}}}}}{c{{AIf{jc}}}{GjGh}}{c{{AIh{c}}}{}}{{ek}{{AIj{gci}}}{}{{AFl{}{{Dn{c}}}}}{}{}{{AFl{{d{hg}}{d{hc}}}{{Dn{i}}}}}}{{Jbc}{{AIl{c}}}{}}{{Ndc}{{AG`{c}}}{}}{{cl}{{AIn{c}}}{}}{c{{AHj{c}}}{}}{ChAHf}{{eAJng}{{AJ`{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}}{{ce}{{AHh{gce}}}{}{}{}}{{}{{AGj{c}}}{}}{{Mlc}{{AJb{c}}}{}}{c{{AHd{c}}}{}}{{lChc}{{AGl{c}}}{}}{{ce}{{AJd{e}}}{{Cn{Nh}}}{}}{e{{AJf{c}}}{}{{AFl{{d{hHl}}{d{hc}}}}}}{{Njc}{{AH`{c}}}{}}{l{{AHb{c}}}{}}{{Njc}{{AGb{c}}}{}}{cAGd{{Cn{Fb}}}}{{}{{AGf{c}}}{}}{{ce}{{AJh{c}}}{}{{Cn{Fb}}}}{{Efc}{{AJj{c}}}{}}{{Njc}{{AGh{c}}}{}}{c{{AJl{c}}}{}}{{cg}{{AFj{ec}}}{}{}{{AFl{{d{hHf}}{d{he}}}}}}{{eg}{{AJ`{ceg}}}{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}}{{cg}{{AHl{ec}}}{}{}{{AFl{{d{hHl}}{d{he}}}}}}{{{AHl{ce}}g}{{AHl{ce}}}{}{}{{AFl{{d{hHl}}{d{hc}}}}}}`{{cg}{{AFn{ec}}}{}{}{{AFl{{d{hHd}}{d{he}}{d{Lj}}}}}}0{{{AGj{c}}e}{{AGj{c}}}{}{{AFl{{d{hHd}}{d{hc}}b}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{AFl{{d{hHd}}{d{hc}}l}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{AFl{{d{hHd}}{d{hc}}Fd}}}}```{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{AFl{{d{hHd}}{d{hc}}Ch}}}}`7{{cg}{{AId{ec}}}{}{}{{AFl{{d{hHh}}{d{he}}}}}}82`{c{{AIb{c}}}AEb}{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{Cn{{Ed{Ch}}}}}}`{{ce}{{AJd{e}}}{{Cn{Nh}}}{}}{{lc}{{AJd{c}}}{}}000{{{AHj{c}}e}{{AHj{c}}}{}{{Cn{{Ol{Nh}}}}}}`````{e{{AJf{c}}}{}{{AFl{{d{hHl}}{d{hc}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{Fd}}}}`{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{b}}}}}}``{{{d{h{AGb{{Nb{c}}}}}}c}j{}}{{{d{h{AGh{{Nb{c}}}}}}c}j{}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{AKj{l}}}}}}`{{{d{h{AGn{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AGn{ceg}}}}}j{}{{AEb{c}}}Ib{}}{{{d{h{AFj{ce}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AFj{ce}}}}}j{}{{AEb{c}}}{}}{{{d{h{AHl{ce}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AHl{ce}}}}}j{}{{AEb{c}}}{}}{{{d{h{AFn{ce}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AFn{ce}}}}}j{}{{AEb{c}}}{}}{{{d{h{AHn{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AHn{ceg}}}}}j{}{}{{AEb{e}}}{}}{{{d{h{AI`{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AI`{ceg}}}}}j{}{{AEb{c}}}AFb{}}{{{d{h{AIb{c}}}}{d{he}}{d{hHh}}{d{hg}}{d{{AIb{c}}}}}jAEb{}{}}{{{d{h{AId{ce}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AId{ce}}}}}j{}{{AEb{c}}}{}}{{{d{h{AIf{eg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AIf{eg}}}}}j{}{{AEb{c}}}{GjGh}{}}{{{d{h{AIh{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AIh{e}}}}}j{}{{AEb{c}}}{}}{{{d{h{AIj{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AIj{ceg}}}}}j{}{}{{AEb{{Dd{ce}}}}}{}}{{{d{h{AIl{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AIl{e}}}}}j{}{{AEb{c}}}{}}{{{d{h{AG`{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AG`{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AG`{c}}}}{d{hHh}}{d{{AG`{c}}}}}j{}}{{{d{{AIn{c}}}}{d{hHh}}{d{{AIn{c}}}}}j{}}{{{d{h{AIn{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AIn{e}}}}}j{}{{AEb{c}}}{}}{{{d{h{AHj{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AHj{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AHj{c}}}}{d{hHh}}{d{{AHj{c}}}}}j{}}{{{d{hA@l}}{d{{AHj{c}}}}{d{hHh}}}j{}}{{{d{hAHf}}{d{hc}}{d{hHh}}{d{he}}{d{AHf}}}j{}{}}{{{d{AHf}}{d{hHh}}{d{AHf}}}j}{{{d{hAAb}}{d{AHf}}{d{hHh}}}j}{{{d{h{AJ`{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AJ`{ceg}}}}}j{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}{}}{{{d{{AJ`{ceg}}}}{d{hHh}}{d{{AJ`{ceg}}}}}j{}{{AEb{c}}}{{AFl{{d{hHd}}{d{hc}}}}}}{{{d{h{AHh{ceg}}}}{d{hi}}{d{hHh}}{d{hc}}{d{{AHh{ceg}}}}}j{}{{AEb{c}}}{{AEb{c}}}{}}{{{d{{AHh{ceg}}}}{d{hHh}}{d{{AHh{ceg}}}}}j{}{}{}}{{{d{hA@b}}{d{{AHh{ceg}}}}{d{hHh}}}j{}{}{}}{{{d{{AGj{c}}}}{d{hHh}}{d{{AGj{c}}}}}j{}}{{{d{h{AGj{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AGj{c}}}}}j{}{}}{{{d{hA@j}}{d{{AGj{c}}}}{d{hHh}}}j{}}{{{d{h{AJb{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJb{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AJb{c}}}}{d{hHh}}{d{{AJb{c}}}}}j{}}{{{d{h{AHd{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AHd{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AHd{c}}}}{d{hHh}}{d{{AHd{c}}}}}j{}}{{{d{hAA`}}{d{{AHd{c}}}}{d{hHh}}}j{}}{{{d{{AGl{c}}}}{d{hHh}}{d{{AGl{c}}}}}j{}}{{{d{h{AGl{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AGl{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AJd{c}}}}{d{hHh}}{d{{AJd{c}}}}}j{}}{{{d{h{AJd{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJd{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AJf{c}}}}{d{hHh}}{d{{AJf{c}}}}}j{}}{{{d{h{AJf{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AJf{c}}}}}j{}{}}{{{d{h{AH`{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AH`{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AH`{c}}}}{d{hHh}}{d{{AH`{c}}}}}j{}}{{{d{hA@n}}{d{{AH`{c}}}}{d{hHh}}}j{}}{{{d{h{AHb{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AHb{c}}}}}j{}{}}{{{d{{AHb{c}}}}{d{hHh}}{d{{AHb{c}}}}}j{}}{{{d{hA@h}}{d{{AHb{c}}}}{d{hHh}}}j{}}{{{d{{AGb{c}}}}{d{hHh}}{d{{AGb{c}}}}}j{}}{{{d{h{AGb{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AGb{e}}}}}j{}{{AE`{c}}}{}}{{{d{hAGd}}{d{hc}}{d{hHh}}{d{he}}{d{AGd}}}j{}{}}{{{d{hAAd}}{d{AGd}}{d{hHh}}}j}{{{d{h{AGf{c}}}}{d{he}}{d{hHh}}{d{hc}}{d{{AGf{c}}}}}j{}{}}{{{d{hA@d}}{d{{AGf{c}}}}{d{hHh}}}j{}}{{{d{{AJh{c}}}}{d{hHh}}{d{{AJh{c}}}}}j{}}{{{d{h{AJh{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJh{e}}}}}j{}{{AEb{c}}}{}}{{{d{hA@f}}{d{{AJh{c}}}}{d{hHh}}}j{}}{{{d{{AJj{c}}}}{d{hHh}}{d{{AJj{c}}}}}j{}}{{{d{h{AJj{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJj{e}}}}}j{}{{AEb{c}}}{}}{{{d{{AGh{c}}}}{d{hHh}}{d{{AGh{c}}}}}j{}}{{{d{h{AGh{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AGh{e}}}}}j{}{{AE`{c}}}{}}{{{d{h{AJl{e}}}}{d{hg}}{d{hHh}}{d{hc}}{d{{AJl{e}}}}}j{}{{AE`{c}}}{}}`{{J`c}{{AJf{e}}}{{Cn{Bf}}}{}}{c{{AG`{c}}}{}}{{lc}{{AJj{c}}}{}}0{{{AGh{c}}e}{{AGh{c}}}{}{{Cn{l}}}}`{{ce}{{AJj{e}}}{{Cn{F`}}}{}}{{ce}{{AJb{e}}}{{Cn{J`}}}{}}{{AHfc}AHf{{Cn{{Ol{l}}}}}}{{{AGj{c}}e}{{AGj{c}}}{}{{Cn{{Ol{l}}}}}}{{{AJf{c}}e}{{AJf{c}}}{}{{Cn{{Ed{J`}}}}}}`````{l{{AHb{c}}}{}}2```3```{{{d{{AHj{c}}}}{d{Jb}}}A@l{}}{{{d{AHf}}{d{Jb}}}AAb}{{{d{{AHh{ceg}}}}{d{Jb}}}A@b{}{}{}}{{{d{{AGj{c}}}}{d{Jb}}}A@j{}}{{{d{{AHd{c}}}}{d{Jb}}}AA`{}}{{{d{{AH`{c}}}}{d{Jb}}}A@n{}}{{{d{{AHb{c}}}}{d{Jb}}}A@h{}}{{{d{AGd}}{d{Jb}}}AAd}{{{d{{AGf{c}}}}{d{Jb}}}A@d{}}{{{d{{AJh{c}}}}{d{Jb}}}A@f{}}{c{{AIf{jc}}}{GjGh}}{cAGd{{Cn{Fb}}}}{{AGdc}AGd{{Cn{Fb}}}}{{{AGf{c}}e}{{AGf{c}}}{}AKl}````{{}{{AGf{c}}}{}}`{{{d{c}}}e{}{}}0{{ce}{{AJh{c}}}{}{{Cn{Fb}}}}{c{{AG`{c}}}{}}00{{Efc}{{AJj{c}}}{}}`{{ADhChg}{{AGn{cel}}}{}{}{{AFl{{d{hHd}}{d{hc}}l}{{Dn{e}}}}}}{{{AHj{c}}e}{{AHj{c}}}{}{{Cn{{Ol{ADh}}}}}}{{AHfc}AHf{{Cn{{Ol{ADh}}}}}}{{{AHh{ceg}}i}{{AHh{ceg}}}{}{}{}{{Cn{{Ol{ADh}}}}}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{ADh}}}}}}````````{{ADhg}{{AGn{cel}}}{}{}{{AFl{{d{hHd}}{d{hc}}l}{{Dn{e}}}}}}00{{ce}{{AJj{e}}}{{Cn{F`}}}{}}{c{{AIh{c}}}{}}{c{{Ff{e}}}{}{}}00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000{{{d{c}}}Fh{}}00000000000000000000000000000000000000000000{c{{AJb{c}}}{}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{l}}}}`{Nj{{AGb{{Nb{c}}}}}{}}{Nj{{AGh{{Nb{c}}}}}{}}{{}{{AGb{{Nb{c}}}}}{}}0{c{{AGb{c}}}{}}{c{{AGh{c}}}{}}{{}{{AGh{{Nb{{Fn{Mn}}}}}}}}{{}{{AGh{{Nb{c}}}}}{}}{c{{AH`{c}}}{}}4``{{}{{AGb{{Nb{{Fn{Mn}}}}}}}}64``32{{lc}{{AJb{c}}}{}}{{{AJb{c}}l}{{AJb{c}}}{}}{{{AH`{c}}e}{{AH`{c}}}{}{{Cn{{Ol{l}}}}}}{{{AHb{c}}e}{{AHb{c}}}{}{{Cn{{Ol{l}}}}}}````{{{AGb{{Nb{c}}}}c}{{AGb{{Nb{c}}}}}{}}{{{AGh{{Nb{c}}}}c}{{AGh{{Nb{c}}}}}{}}{{ei}{{`{{AEb{k}}}}}{}{{AFl{}{{Dn{c}}}}}{{AEb{c}}}{{AFl{{d{hc}}}{{Dn{g}}}}}{}}{g{{`{{AEb{i}}}}}Ib{{AEb{c}}}{{AFl{{d{hc}}}{{Dn{e}}}}}{}}{{ek}{{AIj{gci}}}{}{{AFl{}{{Dn{c}}}}}{}{{AEb{{Dd{gc}}}}}{{AFl{{d{hg}}{d{hc}}}{{Dn{i}}}}}}{i{{AIj{ceg}}}{}Ib{{AEb{{Dd{ce}}}}}{{AFl{{d{hc}}{d{he}}}{{Dn{g}}}}}}{{cg}{{AIl{g}}}{{Cn{Jb}}}{}{{AEb{e}}}}{e{{`{{AEb{{Dd{gc}}}}}}}{}{{AEb{c}}}{}}{e{{`{{AEb{{Dd{cg}}}}}}}{}{{AEb{c}}}{}}{{AGdc}AGd{{Cn{{Ol{ABf}}}}}}{{{AGf{c}}e}{{AGf{c}}}{}{{Cn{{Ol{ABf}}}}}}``````{c{{AJl{c}}}{}}`````````````````````````````````````````````````````````{{{d{c}}}{{d{e}}}{}{}}000000{{{d{hc}}}{{d{he}}}{}{}}000000{{{d{Il}}}Il}{{{d{AKn}}}AKn}{{{d{AL`}}}AL`}{{{d{ALb}}}ALb}{{{d{Jd}}}Jd}{{{d{ALd}}}ALd}{{{d{ALf}}}ALf}{{{d{c}}{d{he}}}j{}{}}000000{{{d{c}}}j{}}000000000{{Jdc}Jd{{Cn{{Ed{b}}}}}}``{{JdCh}Jd}``{{}Il}{{}AL`}{{}ALb}{{}Jd}{Cj{{d{c}}}{}}000000{Cj{{d{hc}}}{}}000000{{{d{ALf}}{d{Jd}}}{{Nb{ALd}}}}{Cjj}000000{{{d{Il}}{d{Il}}}Ch}{{{d{AKn}}{d{AKn}}}Ch}{{{d{AL`}}{d{AL`}}}Ch}{{{d{ALb}}{d{ALb}}}Ch}{{{d{ALd}}{d{ALd}}}Ch}{JdJd}{{{d{Il}}{d{hD`}}}Db}{{{d{AKn}}{d{hD`}}}Db}{{{d{AL`}}{d{hD`}}}Db}0{{{d{ALb}}{d{hD`}}}Db}{{{d{Jd}}{d{hD`}}}Db}{{{d{ALd}}{d{hD`}}}Db}{{{d{ALf}}{d{hD`}}}Db}{cc{}}000000{{{d{Jd}}Jl}{{Ed{{d{AKn}}}}}}{{{d{hJd}}Jl}{{Ed{{d{hAKn}}}}}}{{{d{Il}}{d{hc}}}jDj}{{{d{AL`}}{d{hc}}}jDj}{{{d{Jd}}}N`}`{{Jdc}Jd{{Cn{{Ed{Dh}}}}}}``{{{d{AKn}}}Jl}{{{d{Jd}}}AL`}{{}Cj}000000{ce{}{}}000000{{{d{Jd}}Dl}Ch}{{{d{Jd}}JlKf}Ch}{{{d{AKn}}Kf}Ch}{{JdCh}Jd}``{{{d{hJd}}JlAj}F`}{Il{{d{Ad}}}}{{JlAj}AKn}{{}AL`}{{}Jd}{{{d{Jd}}}J`}{{{d{Jd}}}{{d{{Ej{AKn}}}}}}{{{d{hJd}}}{{d{h{Nb{AKn}}}}}}`{{{d{hAKn}}Kf}j}{{{d{hJd}}JlKf}j}{{{d{hAKn}}Kf}Ch}{{{d{hJd}}JlKf}Ch}{{{d{hJd}}Jl}j}=``{{Jdl}Jd}``{{JdN`N`}Jd}``{{JdALb}Jd}`{{{d{Jd}}}ALf}{{Jdc}JdAKl}``{{{d{c}}}e{}{}}000000{{{d{c}}}Fb{}}{{{d{c}}}Fd{}}{c{{Ff{e}}}{}{}}0000000000000{{{d{c}}}Fh{}}000000{{{d{hJd}}}{{Nb{ALd}}}}{{JdCh}Jd}``{{{d{Jd}}}N`}","D":"A@Gf","p":[[5,"Color",22,5030],[1,"reference"],[1,"u8"],[0,"mut"],[1,"unit"],[1,"f32"],[5,"BorderRadius",22,5031],[5,"BorderWidth",22,5031],[5,"DisplayHex",22,5030],[1,"str"],[5,"Curve",22,5032],[5,"Rect",1785,5033],[5,"Point",1785,5034],[5,"Canvas",22,5035],[5,"Pattern",22,5035],[6,"Shader",22,5035],[6,"BlendMode",22,5035],[6,"AntiAlias",22,5035],[5,"Paint",22,5035],[6,"FillRule",22,5035],[5,"Mask",22,5035],[6,"Primitive",22,5035],[6,"CurveVerb",22,5032],[6,"CurveSegment",22,5032],[6,"StrokeCap",22,5036],[6,"StrokeJoin",22,5036],[5,"Stroke",22,5036],[1,"bool"],[1,"usize"],[5,"Arc",5037],[10,"Into",5038],[5,"Formatter",5039],[8,"Result",5039],[1,"tuple"],[1,"array"],[5,"Image",1623,5040],[10,"Hasher",5041],[5,"ViewId",2891,5042],[17,"Output"],[10,"FnOnce",5043],[5,"CurveIter",22,5032],[6,"Option",5044],[5,"Affine",1785,5045],[1,"i32"],[1,"slice"],[17,"Item"],[10,"Iterator",5046],[5,"Vector",1785,5047],[5,"SmolStr",5048],[5,"String",5049],[6,"Result",5050],[5,"TypeId",5051],[5,"Clipboard",634],[10,"ClipboardBackend",634],[5,"Box",5052],[10,"AsRef",5038],[5,"CommandWaker",654],[5,"CommandProxy",654],[10,"Any",5051],[10,"Send",5053],[10,"Future",5054],[5,"Command",654],[5,"CommandReceiver",654],[10,"Fn",5043],[10,"Sync",5053],[5,"EventCx",729,5055],[5,"BuildCx",729,5056],[5,"RebuildCx",729,5057],[5,"LayoutCx",729,5058],[5,"DrawCx",729,5059],[5,"BaseCx",729,5060],[5,"Contexts",729,5061],[10,"Default",5062],[5,"Fonts",2531,5063],[5,"ViewState",2891,5042],[5,"TextBuffer",2531,5064],[5,"Buffer",5065],[6,"Cursor",4789,5066],[5,"Ime",1018,5067],[5,"Size",1785,5068],[5,"Styles",2373,5069],[5,"Window",4789,5070],[5,"Modifiers",1018,5071],[6,"Key",1018,5072],[1,"char"],[5,"PointerId",1018,5073],[1,"u64"],[5,"KeyPressed",1018,5072],[5,"KeyReleased",1018,5072],[6,"Code",1018,5072],[6,"PointerButton",1018,5073],[5,"PointerMoved",1018,5073],[5,"PointerLeft",1018,5073],[5,"PointerPressed",1018,5073],[5,"PointerReleased",1018,5073],[5,"PointerScrolled",1018,5073],[5,"CloseRequested",1018,5074],[5,"WindowResized",1018,5074],[5,"WindowScaled",1018,5074],[5,"WindowMaximized",1018,5074],[6,"Event",1018,5075],[10,"Hash",5041],[1,"u16"],[10,"IsKey",1018,5072],[5,"ImageData",1623,5076],[5,"ImageId",1623,5040],[5,"WeakImage",1623,5040],[5,"TextureId",1623,5077],[6,"Texture",1623,5077],[5,"Space",1785,5078],[10,"AnyView",2891,5079],[1,"u32"],[5,"Vec",5080],[5,"Alignment",1785,5081],[6,"Align",1785,5082],[5,"Padding",1785,5083],[6,"Axis",1785,5084],[6,"Justify",1785,5082],[5,"Matrix",1785,5085],[5,"JustifyIterator",1785,5082],[10,"From",5038],[10,"Rebuild",2370],[5,"Style",2373,5069],[10,"Sized",5053],[5,"Theme",2373,5086],[6,"Styled",2373,5069],[10,"Clone",5087],[10,"Debug",5039],[5,"CollapsingStyle",3241,5088],[5,"TextInputStyle",3241,5089],[5,"TooltipStyle",3241,5090],[5,"SliderStyle",3241,5091],[5,"ColorPickerStyle",3241,5092],[5,"ButtonStyle",3241,5093],[5,"ScrollStyle",3241,5094],[5,"ContainerStyle",3241,5095],[5,"CheckboxStyle",3241,5096],[5,"TextStyle",3241,5097],[1,"never"],[6,"FontFamily",2531,5098],[6,"Family",5099],[5,"AtlasGlyph",2531,5100],[5,"FontWeight",2531,5098],[6,"FontStretch",2531,5098],[6,"FontStyle",2531,5098],[6,"TextAlign",2531,5098],[6,"TextWrap",2531,5098],[5,"TextAttributes",2531,5098],[6,"FontSource",2531,5101],[5,"FontAtlas",2531,5100],[5,"PathBuf",5102],[5,"Path",5102],[5,"FontSystem",5103],[5,"SwashCache",5104],[5,"CacheKey",5105],[5,"Error",5106],[6,"Align",5107],[6,"Wrap",5107],[5,"Attrs",5108],[5,"Weight",5099],[6,"Width",5109],[6,"Style",5099],[6,"Easing",2838],[5,"Transition",2838],[5,"Update",2891,5042],[5,"ViewFlags",2891,5042],[17,"State"],[10,"ViewSeq",2891,5110],[10,"View",2891,5111],[8,"BoxedView",2891,5079],[5,"Pod",2891,5112],[5,"PodSeq",2891,5110],[5,"SeqState",2891,5110],[6,"Ordering",5113],[5,"State",2891,5112],[8,"AnyState",2891,5079],[10,"PartialEq",5113],[10,"IntoIterator",5114],[5,"Iter",5115],[5,"IterNames",5115],[5,"BuildHandler",3241,5116],[10,"FnMut",5043],[5,"EventHandler",3241,5117],[5,"Aligned",3241,5118],[5,"Stack",3241,5119],[5,"Text",3241,5097],[5,"TextInput",3241,5089],[5,"Wrap",3241,5120],[5,"ColorPicker",3241,5092],[5,"Flexible",3241,5121],[5,"Animate",3241,5122],[5,"Scroll",3241,5094],[5,"Slider",3241,5091],[5,"Container",3241,5095],[5,"Checkbox",3241,5096],[5,"Collapsing",3241,5088],[5,"Button",3241,5093],[5,"DrawHandler",3241,5123],[5,"Focus",3241,5124],[5,"Memo",3241,5125],[5,"Opaque",3241,5126],[5,"RebuildHandler",3241,5127],[5,"Suspense",3241,5128],[5,"Trigger",3241,5129],[5,"WithState",3241,5130],[5,"WithStyle",3241,5131],[5,"Aspect",3241,5132],[5,"Clickable",3241,5133],[5,"Constrain",3241,5134],[5,"Pad",3241,5135],[5,"Painter",3241,5136],[5,"Tooltip",3241,5090],[5,"Transform",3241,5137],[5,"ZStack",3241,5138],[6,"ClickEvent",3241,5133],[5,"Flex",3241,5121],[8,"Lens",3241,5124],[5,"Arguments",5039],[1,"fn"],[5,"PhantomData",5053],[5,"RangeInclusive",5139],[10,"ToString",5049],[5,"Pointer",4789,5140],[5,"WindowId",4789,5070],[6,"WindowSizing",4789,5070],[6,"WindowUpdate",4789,5070],[5,"WindowSnapshot",4789,5070],[15,"Fill",624],[15,"Stroke",624],[15,"Layer",624]],"r":[[22,5035],[26,5035],[27,5031],[28,5031],[31,5035],[35,5030],[38,5032],[39,5032],[40,5032],[41,5032],[44,5030],[48,5035],[55,5035],[61,5035],[62,5035],[64,5035],[70,5035],[75,5036],[77,5036],[78,5036],[388,5030],[391,5030],[393,5030],[395,5030],[397,5030],[472,5030],[474,5030],[476,5030],[478,5030],[480,5030],[482,5030],[484,5030],[486,5030],[501,5030],[503,5030],[729,5060],[730,5056],[731,5061],[732,5059],[733,5055],[734,5058],[735,5057],[1040,5074],[1042,5072],[1066,5075],[1121,5067],[1124,5072],[1131,5072],[1142,5072],[1144,5072],[1156,5071],[1182,5073],[1183,5073],[1184,5073],[1186,5073],[1188,5073],[1190,5073],[1192,5073],[1231,5074],[1233,5074],[1235,5074],[1624,5040],[1626,5076],[1627,5040],[1628,5077],[1629,5077],[1630,5040],[1785,5045],[1786,5082],[1787,5081],[1788,5084],[1805,5082],[1806,5082],[1808,5085],[1815,5083],[1816,5034],[1818,5033],[1819,5068],[1820,5078],[1832,5047],[2371,5141],[2397,5069],[2399,5069],[2400,5069],[2401,5086],[2429,5069],[2503,5069],[2510,0],[2529,5069],[2531,5100],[2547,5100],[2548,5098],[2549,5101],[2550,5098],[2551,5098],[2552,5098],[2553,5063],[2575,5098],[2576,5098],[2577,5064],[2578,5098],[2741,5141],[2893,5079],[2894,5079],[2895,5079],[2906,5112],[2907,5110],[2908,5110],[2909,5112],[2912,5042],[2913,5111],[2914,5042],[2915,5042],[2916,5110],[2917,5042],[2920,5079],[3166,5112],[3245,5118],[3246,5122],[3247,5132],[3274,5116],[3275,5093],[3276,5093],[3284,5096],[3285,5096],[3287,5133],[3288,5133],[3289,5088],[3290,5088],[3291,5092],[3292,5092],[3293,5134],[3294,5095],[3295,5095],[3297,5123],[3298,5117],[3315,5121],[3316,5121],[3317,5124],[3327,5124],[3329,5125],[3330,5126],[3334,5135],[3335,5136],[3337,5127],[3343,5094],[3344,5094],[3345,5091],[3346,5091],[3347,5119],[3348,5128],[3353,5097],[3354,5089],[3355,5089],[3356,5097],[3357,5090],[3358,5090],[3359,5137],[3360,5129],[3366,5130],[3367,5131],[3368,5120],[3369,5138],[3374,5118],[3393,5122],[3441,5095],[3608,5118],[3609,5118],[3610,5118],[3644,5093],[3648,5118],[3649,5096],[3652,5136],[3661,5088],[3684,5092],[3687,5134],[3688,5095],[4058,5136],[4095,5121],[4100,5121],[4104,5124],[4145,0],[4197,5134],[4203,5094],[4204,5119],[4205,0],[4206,0],[4207,5119],[4208,5119],[4209,5120],[4210,0],[4211,0],[4212,5120],[4213,5120],[4358,5118],[4379,5134],[4381,5134],[4383,5134],[4385,5125],[4386,5134],[4388,5134],[4390,5134],[4427,5116],[4428,5133],[4429,5123],[4432,5117],[4433,5117],[4442,5133],[4443,5127],[4444,5133],[4447,5126],[4450,5135],[4451,5135],[4452,5135],[4453,5135],[4454,5135],[4461,5136],[4533,5136],[4534,5118],[4535,5137],[4536,5137],[4539,5137],[4540,5134],[4549,5091],[4568,5128],[4569,5097],[4576,5089],[4580,5090],[4581,5118],[4582,5118],[4583,5118],[4584,5137],[4586,5122],[4599,5122],[4600,5122],[4601,5122],[4602,5137],[4603,5129],[4750,5094],[4751,5119],[4752,0],[4753,0],[4754,5119],[4755,5119],[4756,5120],[4757,0],[4758,0],[4759,5120],[4760,5120],[4761,5134],[4771,5130],[4772,5130],[4773,5130],[4774,5130],[4775,5131],[4776,5130],[4777,5130],[4786,5138],[4787,0],[4788,0],[4799,5066],[4821,5140],[4837,5070],[4838,5070],[4839,5070],[4840,5070],[4841,5070]],"b":[[326,"impl-Debug-for-Color"],[327,"impl-Display-for-Color"],[328,"impl-Display-for-DisplayHex"],[329,"impl-Debug-for-DisplayHex"],[337,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-BorderRadius"],[339,"impl-From%3C%5Bf32;+4%5D%3E-for-BorderRadius"],[340,"impl-From%3Cf32%3E-for-BorderRadius"],[342,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-BorderWidth"],[343,"impl-From%3C%5Bf32;+4%5D%3E-for-BorderWidth"],[344,"impl-From%3C(f32,+f32)%3E-for-BorderWidth"],[345,"impl-From%3Cf32%3E-for-BorderWidth"],[346,"impl-From%3C%5Bf32;+2%5D%3E-for-BorderWidth"],[352,"impl-From%3CImage%3E-for-Paint"],[353,"impl-From%3CColor%3E-for-Paint"],[354,"impl-From%3CPattern%3E-for-Paint"],[362,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Color"],[363,"impl-From%3C%5Bf32;+4%5D%3E-for-Color"],[463,"impl-Mul-for-Color"],[464,"impl-Mul%3Cf32%3E-for-Color"],[1722,"impl-From%3CImage%3E-for-Texture"],[1723,"impl-From%3CTextureId%3E-for-Texture"],[1843,"impl-Add%3Cf32%3E-for-Point"],[1844,"impl-Add%3CSize%3E-for-Point"],[1845,"impl-Add%3CVector%3E-for-Point"],[1846,"impl-Add%3CSize%3E-for-Rect"],[1847,"impl-Add%3CVector%3E-for-Rect"],[1848,"impl-Add%3CVector%3E-for-Size"],[1849,"impl-Add-for-Size"],[1850,"impl-Add%3Cf32%3E-for-Size"],[1852,"impl-Add%3Cf32%3E-for-Vector"],[1853,"impl-Add-for-Vector"],[1854,"impl-AddAssign%3Cf32%3E-for-Point"],[1855,"impl-AddAssign%3CSize%3E-for-Point"],[1856,"impl-AddAssign%3CVector%3E-for-Point"],[1857,"impl-AddAssign%3CVector%3E-for-Rect"],[1858,"impl-AddAssign%3CSize%3E-for-Rect"],[1859,"impl-AddAssign%3Cf32%3E-for-Size"],[1860,"impl-AddAssign-for-Size"],[1861,"impl-AddAssign%3CVector%3E-for-Size"],[1863,"impl-AddAssign-for-Vector"],[1864,"impl-AddAssign%3Cf32%3E-for-Vector"],[2009,"impl-Div%3CSize%3E-for-Point"],[2010,"impl-Div%3Cf32%3E-for-Point"],[2011,"impl-Div%3CVector%3E-for-Point"],[2012,"impl-Div%3CVector%3E-for-Size"],[2013,"impl-Div%3Cf32%3E-for-Size"],[2014,"impl-Div-for-Size"],[2015,"impl-Div-for-Vector"],[2016,"impl-Div%3Cf32%3E-for-Vector"],[2017,"impl-DivAssign%3CSize%3E-for-Point"],[2018,"impl-DivAssign%3CVector%3E-for-Point"],[2019,"impl-DivAssign%3Cf32%3E-for-Point"],[2020,"impl-DivAssign%3Cf32%3E-for-Size"],[2021,"impl-DivAssign%3CVector%3E-for-Size"],[2022,"impl-DivAssign-for-Size"],[2023,"impl-DivAssign%3Cf32%3E-for-Vector"],[2024,"impl-DivAssign-for-Vector"],[2064,"impl-Debug-for-Point"],[2065,"impl-Display-for-Point"],[2067,"impl-Debug-for-Size"],[2068,"impl-Display-for-Size"],[2070,"impl-Debug-for-Vector"],[2071,"impl-Display-for-Vector"],[2075,"impl-From%3C%5Bf32;+2%5D%3E-for-Alignment"],[2077,"impl-From%3C(f32,+f32)%3E-for-Alignment"],[2082,"impl-From%3Cf32%3E-for-Padding"],[2083,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Padding"],[2085,"impl-From%3C%5Bf32;+4%5D%3E-for-Padding"],[2086,"impl-From%3C%5Bf32;+2%5D%3E-for-Padding"],[2087,"impl-From%3C(f32,+f32)%3E-for-Padding"],[2089,"impl-From%3C(f32,+f32)%3E-for-Point"],[2090,"impl-From%3Cf32%3E-for-Point"],[2091,"impl-From%3C%5Bf32;+2%5D%3E-for-Point"],[2092,"impl-From%3CVector%3E-for-Point"],[2093,"impl-From%3CSize%3E-for-Point"],[2094,"impl-From%3CSize%3E-for-Rect"],[2096,"impl-From%3C%5Bf32;+4%5D%3E-for-Rect"],[2097,"impl-From%3CVector%3E-for-Size"],[2099,"impl-From%3C%5Bf32;+2%5D%3E-for-Size"],[2100,"impl-From%3C(f32,+f32)%3E-for-Size"],[2101,"impl-From%3CPoint%3E-for-Size"],[2102,"impl-From%3Cf32%3E-for-Size"],[2105,"impl-From%3CSize%3E-for-Vector"],[2106,"impl-From%3C%5Bf32;+2%5D%3E-for-Vector"],[2107,"impl-From%3CPoint%3E-for-Vector"],[2109,"impl-From%3Cf32%3E-for-Vector"],[2110,"impl-From%3C(f32,+f32)%3E-for-Vector"],[2194,"impl-Mul-for-Affine"],[2195,"impl-Mul%3CVector%3E-for-Affine"],[2196,"impl-Mul%3CPoint%3E-for-Affine"],[2197,"impl-Mul-for-Matrix"],[2198,"impl-Mul%3CPoint%3E-for-Matrix"],[2199,"impl-Mul%3CVector%3E-for-Matrix"],[2200,"impl-Mul%3CSize%3E-for-Point"],[2201,"impl-Mul%3CVector%3E-for-Point"],[2202,"impl-Mul%3Cf32%3E-for-Point"],[2203,"impl-Mul-for-Size"],[2204,"impl-Mul%3Cf32%3E-for-Size"],[2205,"impl-Mul%3CVector%3E-for-Size"],[2206,"impl-Mul-for-Vector"],[2207,"impl-Mul%3Cf32%3E-for-Vector"],[2209,"impl-MulAssign%3Cf32%3E-for-Point"],[2210,"impl-MulAssign%3CVector%3E-for-Point"],[2211,"impl-MulAssign%3CSize%3E-for-Point"],[2212,"impl-MulAssign%3CVector%3E-for-Size"],[2213,"impl-MulAssign%3Cf32%3E-for-Size"],[2214,"impl-MulAssign-for-Size"],[2215,"impl-MulAssign%3Cf32%3E-for-Vector"],[2216,"impl-MulAssign-for-Vector"],[2233,"impl-Rem%3CVector%3E-for-Point"],[2234,"impl-Rem%3Cf32%3E-for-Point"],[2235,"impl-Rem%3CSize%3E-for-Point"],[2236,"impl-Rem%3CVector%3E-for-Size"],[2237,"impl-Rem-for-Size"],[2238,"impl-Rem%3Cf32%3E-for-Size"],[2239,"impl-Rem-for-Vector"],[2240,"impl-Rem%3Cf32%3E-for-Vector"],[2241,"impl-RemAssign%3Cf32%3E-for-Point"],[2242,"impl-RemAssign%3CSize%3E-for-Point"],[2243,"impl-RemAssign%3CVector%3E-for-Point"],[2244,"impl-RemAssign%3CVector%3E-for-Size"],[2245,"impl-RemAssign-for-Size"],[2246,"impl-RemAssign%3Cf32%3E-for-Size"],[2247,"impl-RemAssign%3Cf32%3E-for-Vector"],[2248,"impl-RemAssign-for-Vector"],[2263,"impl-Sub%3CVector%3E-for-Point"],[2264,"impl-Sub%3Cf32%3E-for-Point"],[2265,"impl-Sub-for-Point"],[2266,"impl-Sub%3CSize%3E-for-Point"],[2267,"impl-Sub%3CSize%3E-for-Rect"],[2268,"impl-Sub%3CVector%3E-for-Rect"],[2269,"impl-Sub%3Cf32%3E-for-Size"],[2270,"impl-Sub-for-Size"],[2271,"impl-Sub%3CVector%3E-for-Size"],[2273,"impl-Sub-for-Vector"],[2274,"impl-Sub%3Cf32%3E-for-Vector"],[2275,"impl-SubAssign%3CVector%3E-for-Point"],[2276,"impl-SubAssign%3Cf32%3E-for-Point"],[2277,"impl-SubAssign%3CSize%3E-for-Point"],[2278,"impl-SubAssign%3CVector%3E-for-Rect"],[2279,"impl-SubAssign%3CSize%3E-for-Rect"],[2280,"impl-SubAssign%3CVector%3E-for-Size"],[2281,"impl-SubAssign-for-Size"],[2282,"impl-SubAssign%3Cf32%3E-for-Size"],[2284,"impl-SubAssign%3Cf32%3E-for-Vector"],[2285,"impl-SubAssign-for-Vector"],[2452,"impl-From%3CCollapsingStyle%3E-for-Styles"],[2453,"impl-From%3CTextInputStyle%3E-for-Styles"],[2454,"impl-From%3CTooltipStyle%3E-for-Styles"],[2455,"impl-From%3CSliderStyle%3E-for-Styles"],[2456,"impl-From%3CColorPickerStyle%3E-for-Styles"],[2457,"impl-From%3CButtonStyle%3E-for-Styles"],[2458,"impl-From%3CScrollStyle%3E-for-Styles"],[2459,"impl-From%3CTheme%3E-for-Styles"],[2460,"impl-From%3CContainerStyle%3E-for-Styles"],[2462,"impl-From%3CCheckboxStyle%3E-for-Styles"],[2463,"impl-From%3CTextStyle%3E-for-Styles"],[2464,"impl-From%3CT%3E-for-Styled%3CT%3E"],[2465,"impl-From%3Cf32%3E-for-Styled%3CPadding%3E"],[2467,"impl-From%3Cf32%3E-for-Styled%3CBorderRadius%3E"],[2468,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CBorderWidth%3E"],[2469,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CBorderRadius%3E"],[2470,"impl-From%3C(f32,+f32)%3E-for-Styled%3CPadding%3E"],[2471,"impl-From%3CString%3E-for-Styled%3CFontFamily%3E"],[2472,"impl-From%3C%5Bf32;+2%5D%3E-for-Styled%3CPadding%3E"],[2473,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CBorderWidth%3E"],[2474,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CPadding%3E"],[2475,"impl-From%3Cf32%3E-for-Styled%3CBorderWidth%3E"],[2476,"impl-From%3CSmolStr%3E-for-Styled%3CFontFamily%3E"],[2477,"impl-From%3C%26str%3E-for-Styled%3CFontFamily%3E"],[2479,"impl-From%3CStyle%3CT%3E%3E-for-Styled%3CT%3E"],[2480,"impl-From%3C(f32,+f32)%3E-for-Styled%3CBorderWidth%3E"],[2481,"impl-From%3C%5Bf32;+2%5D%3E-for-Styled%3CBorderWidth%3E"],[2482,"impl-From%3C%5Bf32;+4%5D%3E-for-Styled%3CPadding%3E"],[2483,"impl-From%3C(f32,+f32,+f32,+f32)%3E-for-Styled%3CBorderRadius%3E"],[2716,"impl-From%3CString%3E-for-FontFamily"],[2717,"impl-From%3CSmolStr%3E-for-FontFamily"],[2718,"impl-From%3C%26str%3E-for-FontFamily"],[2728,"impl-From%3CPathBuf%3E-for-FontSource%3C\'_%3E"],[2729,"impl-From%3C%26str%3E-for-FontSource%3C\'a%3E"],[2730,"impl-From%3C%26Path%3E-for-FontSource%3C\'a%3E"],[2731,"impl-From%3C%26%5Bu8%5D%3E-for-FontSource%3C\'a%3E"],[2732,"impl-From%3CVec%3Cu8%3E%3E-for-FontSource%3C\'_%3E"],[2932,"impl-Update"],[2933,"impl-Flags-for-Update"],[2934,"impl-ViewFlags"],[2935,"impl-Flags-for-ViewFlags"],[3058,"impl-LowerHex-for-Update"],[3059,"impl-Binary-for-Update"],[3060,"impl-Octal-for-Update"],[3061,"impl-UpperHex-for-Update"],[3062,"impl-Debug-for-Update"],[3063,"impl-UpperHex-for-ViewFlags"],[3064,"impl-Binary-for-ViewFlags"],[3065,"impl-LowerHex-for-ViewFlags"],[3066,"impl-Debug-for-ViewFlags"],[3067,"impl-Octal-for-ViewFlags"],[3068,"impl-Display-for-ViewId"],[3069,"impl-Debug-for-ViewId"],[3085,"impl-Flags-for-Update"],[3086,"impl-Update"],[3087,"impl-Flags-for-ViewFlags"],[3088,"impl-ViewFlags"],[3836,"impl-View%3CT%3E-for-Painter%3CT%3E"],[3837,"impl-Painter%3CT%3E"],[4076,"impl-Clickable%3CT,+V,+F%3E"],[4077,"impl-View%3CT%3E-for-Clickable%3CT,+V,+F%3E"],[4483,"impl-View%3CT%3E-for-Aligned%3CV%3E"],[4484,"impl-Rebuild-for-Aligned%3CV%3E"],[4485,"impl-Rebuild-for-Aspect%3CV%3E"],[4486,"impl-View%3CT%3E-for-Aspect%3CV%3E"],[4487,"impl-View%3CT%3E-for-Button%3CV%3E"],[4488,"impl-Rebuild-for-Button%3CV%3E"],[4490,"impl-View%3CT%3E-for-Checkbox"],[4491,"impl-Rebuild-for-Checkbox"],[4493,"impl-View%3CT%3E-for-Clickable%3CT,+V,+F%3E"],[4494,"impl-Rebuild-for-Clickable%3CT,+V,+F%3E"],[4495,"impl-View%3CT%3E-for-Collapsing%3CT,+H,+V%3E"],[4496,"impl-Rebuild-for-Collapsing%3CT,+H,+V%3E"],[4498,"impl-Rebuild-for-ColorPicker%3CT%3E"],[4499,"impl-View%3CT%3E-for-ColorPicker%3CT%3E"],[4501,"impl-View%3CT%3E-for-Constrain%3CV%3E"],[4502,"impl-Rebuild-for-Constrain%3CV%3E"],[4503,"impl-View%3CT%3E-for-Container%3CV%3E"],[4504,"impl-Rebuild-for-Container%3CV%3E"],[4506,"impl-Rebuild-for-Flexible%3CV%3E"],[4507,"impl-View%3CT%3E-for-Flexible%3CV%3E"],[4508,"impl-Rebuild-for-Pad%3CV%3E"],[4509,"impl-View%3CT%3E-for-Pad%3CV%3E"],[4510,"impl-Rebuild-for-Painter%3CT%3E"],[4511,"impl-View%3CT%3E-for-Painter%3CT%3E"],[4512,"impl-View%3CT%3E-for-Scroll%3CV%3E"],[4513,"impl-Rebuild-for-Scroll%3CV%3E"],[4515,"impl-View%3CT%3E-for-Slider%3CT%3E"],[4516,"impl-Rebuild-for-Slider%3CT%3E"],[4518,"impl-Rebuild-for-Stack%3CV%3E"],[4519,"impl-View%3CT%3E-for-Stack%3CV%3E"],[4524,"impl-Rebuild-for-Tooltip%3CV%3E"],[4525,"impl-View%3CT%3E-for-Tooltip%3CV%3E"],[4527,"impl-Rebuild-for-Transform%3CV%3E"],[4528,"impl-View%3CT%3E-for-Transform%3CV%3E"],[4529,"impl-Rebuild-for-Wrap%3CV%3E"],[4530,"impl-View%3CT%3E-for-Wrap%3CV%3E"],[4922,"impl-Display-for-WindowId"],[4923,"impl-Debug-for-WindowId"]],"c":"OjAAAAAAAAA=","e":"OzAAAAEAAGsL3gALAAAAGAABAB8AAAAzAAAANwAAAEQAAABQAAIAVwABAFwAAABiACcAkgBEAN8ALwARARMAJgESADwBFABSAQAAVAEBAFcBBABdAQAAYQECAGYBAABrAQEAcAEAAHUBAAB5AQsAkQETALkBAQDQAQEA2AEAAAACAAAQAhIAJAIBACcCAQAxAhMARgInAH0CBgCHAgAAjAICAJMCDQCkAg8AtwIAALoCAwDJAgkA1AIDAOkCDQAMAxgAKQMGADIDAABnAwYA2QMUAPsDBQACBAEABQQLABQEAQAXBBMALAQoAFYECwBjBAEAZgQFAG0ECQB7BAkAhgQOAJYECACsBA0AuwQLAMgEBADOBAEA1gQEAN8EIwAGBTsARwUBAEsFVgC4BQ0AzAURAPEFAQAMBkYAYAYhAIYGEgCaBhIArgYFALYGAAC7BgEAvwYEAMcGBQDTBgAA2gYAAOAGFwA0BxUAUwcdAIEHLwC1ByIA2gcPAOsHGAAKCA4AHAgAAB4IAAAjCAEAJggCACoIBQAxCAEANAgEADoIAgA+CAEARAgJAFMIDABvCAAAkwgYALQIAAC6CA8A2AgiAP8IBQAPCQwAHQkZAEYJBABMCREAZAkBAGgJFQCCCQ0AkQkBAJUJCACfCQ8AsAkEALwJAwDSCQ8A5wkAAP0JAAD/CQAACAoAABQKAAAZChkANQogAFcKHwB4ChIAjAoLAJ0KAgCpCgQArwoFALcKCwDoCiwAGwsLACgLBwA0CwEANwsBADwLAgBECwcAawsAAHYLAAB4CwAAfQsPAI8LAQCSCxQArQsbAMwLAQDQCwcA2QsAANsLAADdCwAA3wsAAOELAADkCwQA6gsBAPELDgACDAAABAwBAAcMAAAODAAAEAwAAB4MBAAlDAcAPAwBAEwMAQBeDAAAZwwBAIQMBgCPDBcASA0gAL8NWQAcDiAARg4HAIEOAgCIDlsA5g4XAP8OCAAJD9EA3A8QAO4PEAAHEAEAVxAAAGQQAAB9ECwA5hAgAHgREQCLEQEAjhEDAJMRAQCWEQMAmxEHAKQRAQCnEQIAqxEAAK0RAQCwEQQA4xEBAP0RhgC2EgQAvRICAMMSAgDHEgIAzRIIANcSAQDaEgEA3RIAAN8SAQDiEgAA5BIBAOsSJwAZExEALBMLADkTBwBKEwEAUxMGAIQTHQA="}],\
["ori_font_awesome",{"t":"PTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFGGFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNNNNNNNNNNNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNONNNNNNNNNNNNNNOONONNNNNNNNNNNNNNNN","n":["A","ALL_ICONS","AccessibleIcon","Accusoft","AddressBook","AddressCard","Adn","Adversal","Affiliatetheme","Airbnb","Algolia","AlignCenter","AlignJustify","AlignLeft","AlignRight","Alipay","Amazon","AmazonPay","Amilia","Anchor","AnchorCircleCheck","AnchorCircleExclamation","AnchorCircleXmark","AnchorLock","Android","Angellist","AngleDown","AngleLeft","AngleRight","AngleUp","AnglesDown","AnglesLeft","AnglesRight","AnglesUp","Angrycreative","Angular","Ankh","AppStore","AppStoreIos","Apper","Apple","ApplePay","AppleWhole","Archway","ArrowDown","ArrowDown19","ArrowDown91","ArrowDownAZ","ArrowDownLong","ArrowDownShortWide","ArrowDownUpAcrossLine","ArrowDownUpLock","ArrowDownWideShort","ArrowDownZA","ArrowLeft","ArrowLeftLong","ArrowPointer","ArrowRight","ArrowRightArrowLeft","ArrowRightFromBracket","ArrowRightLong","ArrowRightToBracket","ArrowRightToCity","ArrowRotateLeft","ArrowRotateRight","ArrowTrendDown","ArrowTrendUp","ArrowTurnDown","ArrowTurnUp","ArrowUp","ArrowUp19","ArrowUp91","ArrowUpAZ","ArrowUpFromBracket","ArrowUpFromGroundWater","ArrowUpFromWaterPump","ArrowUpLong","ArrowUpRightDots","ArrowUpRightFromSquare","ArrowUpShortWide","ArrowUpWideShort","ArrowUpZA","ArrowsDownToLine","ArrowsDownToPeople","ArrowsLeftRight","ArrowsLeftRightToLine","ArrowsRotate","ArrowsSpin","ArrowsSplitUpAndLeft","ArrowsToCircle","ArrowsToDot","ArrowsToEye","ArrowsTurnRight","ArrowsTurnToDots","ArrowsUpDown","ArrowsUpDownLeftRight","ArrowsUpToLine","Artstation","Asterisk","Asymmetrik","At","Atlassian","Atom","Audible","AudioDescription","AustralSign","Autoprefixer","Avianex","Aviato","Award","Aws","B","Baby","BabyCarriage","Backward","BackwardFast","BackwardStep","Bacon","Bacteria","Bacterium","BagShopping","Bahai","BahtSign","Ban","BanSmoking","Bandage","Bandcamp","BangladeshiTakaSign","Barcode","Bars","BarsProgress","BarsStaggered","Baseball","BaseballBatBall","BasketShopping","Basketball","Bath","BatteryEmpty","BatteryFull","BatteryHalf","BatteryQuarter","BatteryThreeQuarters","BattleNet","Bed","BedPulse","BeerMugEmpty","Behance","Bell","BellConcierge","BellSlash","BezierCurve","Bicycle","Bilibili","Bimobject","Binoculars","Biohazard","Bitbucket","Bitcoin","BitcoinSign","Bity","BlackTie","Blackberry","Blender","BlenderPhone","Blog","Blogger","BloggerB","Bluetooth","BluetoothB","Bold","Bolt","BoltLightning","Bomb","Bone","Bong","Book","BookAtlas","BookBible","BookBookmark","BookJournalWhills","BookMedical","BookOpen","BookOpenReader","BookQuran","BookSkull","BookTanakh","Bookmark","Bootstrap","BorderAll","BorderNone","BorderTopLeft","BoreHole","Bots","BottleDroplet","BottleWater","BowlFood","BowlRice","BowlingBall","Box","BoxArchive","BoxOpen","BoxTissue","BoxesPacking","BoxesStacked","Braille","Brain","Brand","BrazilianRealSign","BreadSlice","Bridge","BridgeCircleCheck","BridgeCircleExclamation","BridgeCircleXmark","BridgeLock","BridgeWater","Briefcase","BriefcaseMedical","Broom","BroomBall","Brush","Btc","Bucket","Buffer","Bug","BugSlash","Bugs","Building","BuildingCircleArrowRight","BuildingCircleCheck","BuildingCircleExclamation","BuildingCircleXmark","BuildingColumns","BuildingFlag","BuildingLock","BuildingNgo","BuildingShield","BuildingUn","BuildingUser","BuildingWheat","Bullhorn","Bullseye","Burger","Buromobelexperte","Burst","Bus","BusSimple","BusinessTime","BuyNLarge","Buysellads","C","COLOR","CableCar","CakeCandles","Calculator","Calendar","CalendarCheck","CalendarDay","CalendarDays","CalendarMinus","CalendarPlus","CalendarWeek","CalendarXmark","Camera","CameraRetro","CameraRotate","Campground","CanadianMapleLeaf","CandyCane","Cannabis","Capsules","Car","CarBattery","CarBurst","CarOn","CarRear","CarSide","CarTunnel","Caravan","CaretDown","CaretLeft","CaretRight","CaretUp","Carrot","CartArrowDown","CartFlatbed","CartFlatbedSuitcase","CartPlus","CartShopping","CashRegister","Cat","CcAmazonPay","CcAmex","CcApplePay","CcDinersClub","CcDiscover","CcJcb","CcMastercard","CcPaypal","CcStripe","CcVisa","CediSign","CentSign","Centercode","Centos","Certificate","Chair","Chalkboard","ChalkboardUser","ChampagneGlasses","ChargingStation","ChartArea","ChartBar","ChartColumn","ChartGantt","ChartLine","ChartPie","ChartSimple","Check","CheckDouble","CheckToSlot","Cheese","Chess","ChessBishop","ChessBoard","ChessKing","ChessKnight","ChessPawn","ChessQueen","ChessRook","ChevronDown","ChevronLeft","ChevronRight","ChevronUp","Child","ChildCombatant","ChildDress","ChildReaching","Children","Chrome","Chromecast","Church","Circle","CircleArrowDown","CircleArrowLeft","CircleArrowRight","CircleArrowUp","CircleCheck","CircleChevronDown","CircleChevronLeft","CircleChevronRight","CircleChevronUp","CircleDollarToSlot","CircleDot","CircleDown","CircleExclamation","CircleH","CircleHalfStroke","CircleInfo","CircleLeft","CircleMinus","CircleNodes","CircleNotch","CirclePause","CirclePlay","CirclePlus","CircleQuestion","CircleRadiation","CircleRight","CircleStop","CircleUp","CircleUser","CircleXmark","City","Clapperboard","Clipboard","ClipboardCheck","ClipboardList","ClipboardQuestion","ClipboardUser","Clock","ClockRotateLeft","Clone","ClosedCaptioning","Cloud","CloudArrowDown","CloudArrowUp","CloudBolt","CloudMeatball","CloudMoon","CloudMoonRain","CloudRain","CloudShowersHeavy","CloudShowersWater","CloudSun","CloudSunRain","Cloudflare","Cloudscale","Cloudsmith","Cloudversify","Clover","Cmplid","Code","CodeBranch","CodeCommit","CodeCompare","CodeFork","CodeMerge","CodePullRequest","Codepen","Codiepie","Coins","ColonSign","Comment","CommentDollar","CommentDots","CommentMedical","CommentSlash","CommentSms","Comments","CommentsDollar","CompactDisc","Compass","CompassDrafting","Compress","Computer","ComputerMouse","Confluence","Connectdevelop","Contao","Cookie","CookieBite","Copy","Copyright","CottonBureau","Couch","Cow","Cpanel","CreativeCommons","CreativeCommonsBy","CreativeCommonsNc","CreativeCommonsNcEu","CreativeCommonsNcJp","CreativeCommonsNd","CreativeCommonsPd","CreativeCommonsPdAlt","CreativeCommonsRemix","CreativeCommonsSa","CreativeCommonsSampling","CreativeCommonsSamplingPlus","CreativeCommonsShare","CreativeCommonsZero","CreditCard","CriticalRole","Crop","CropSimple","Cross","Crosshairs","Crow","Crown","Crutch","CruzeiroSign","Css3","Css3Alt","Cube","Cubes","CubesStacked","Cuttlefish","D","DAndD","DAndDBeyond","Dailymotion","Dashcube","Database","Debian","Deezer","DeleteLeft","Delicious","Democrat","Deploydog","Deskpro","Desktop","Dev","Deviantart","Dharmachakra","Dhl","DiagramNext","DiagramPredecessor","DiagramProject","DiagramSuccessor","Diamond","DiamondTurnRight","Diaspora","Dice","DiceD20","DiceD6","DiceFive","DiceFour","DiceOne","DiceSix","DiceThree","DiceTwo","Digg","DigitalOcean","Discord","Discourse","Disease","Display","Divide","Dna","Dochub","Docker","Dog","DollarSign","Dolly","DongSign","DoorClosed","DoorOpen","Dove","DownLeftAndUpRightToCenter","DownLong","Download","Draft2digital","Dragon","DrawPolygon","Dribbble","Dropbox","Droplet","DropletSlash","Drum","DrumSteelpan","DrumstickBite","Drupal","Dumbbell","Dumpster","DumpsterFire","Dungeon","Dyalog","E","EarDeaf","EarListen","Earlybirds","EarthAfrica","EarthAmericas","EarthAsia","EarthEurope","EarthOceania","Ebay","Edge","EdgeLegacy","Egg","Eject","Elementor","Elevator","Ellipsis","EllipsisVertical","Ello","Ember","Empire","Envelope","EnvelopeCircleCheck","EnvelopeOpen","EnvelopeOpenText","EnvelopesBulk","Envira","Equals","Eraser","Erlang","Ethereum","Ethernet","Etsy","EuroSign","Evernote","Exclamation","Expand","Expeditedssl","Explosion","Eye","EyeDropper","EyeLowVision","EyeSlash","F","FaceAngry","FaceDizzy","FaceFlushed","FaceFrown","FaceFrownOpen","FaceGrimace","FaceGrin","FaceGrinBeam","FaceGrinBeamSweat","FaceGrinHearts","FaceGrinSquint","FaceGrinSquintTears","FaceGrinStars","FaceGrinTears","FaceGrinTongue","FaceGrinTongueSquint","FaceGrinTongueWink","FaceGrinWide","FaceGrinWink","FaceKiss","FaceKissBeam","FaceKissWinkHeart","FaceLaugh","FaceLaughBeam","FaceLaughSquint","FaceLaughWink","FaceMeh","FaceMehBlank","FaceRollingEyes","FaceSadCry","FaceSadTear","FaceSmile","FaceSmileBeam","FaceSmileWink","FaceSurprise","FaceTired","Facebook","FacebookF","FacebookMessenger","Fan","FantasyFlightGames","Faucet","FaucetDrip","Fax","Feather","FeatherPointed","Fedex","Fedora","Ferry","Figma","File","FileArrowDown","FileArrowUp","FileAudio","FileCircleCheck","FileCircleExclamation","FileCircleMinus","FileCirclePlus","FileCircleQuestion","FileCircleXmark","FileCode","FileContract","FileCsv","FileExcel","FileExport","FileImage","FileImport","FileInvoice","FileInvoiceDollar","FileLines","FileMedical","FilePdf","FilePen","FilePowerpoint","FilePrescription","FileShield","FileSignature","FileVideo","FileWaveform","FileWord","FileZipper","Fill","FillDrip","Film","Filter","FilterCircleDollar","FilterCircleXmark","Fingerprint","Fire","FireBurner","FireExtinguisher","FireFlameCurved","FireFlameSimple","Firefox","FirefoxBrowser","FirstOrder","FirstOrderAlt","Firstdraft","Fish","FishFins","Flag","FlagCheckered","FlagUsa","Flask","FlaskVial","Flickr","Flipboard","FloppyDisk","FlorinSign","Fly","Folder","FolderClosed","FolderMinus","FolderOpen","FolderPlus","FolderTree","Font","FontAwesome","Fonticons","FonticonsFi","Football","FortAwesome","FortAwesomeAlt","Forumbee","Forward","ForwardFast","ForwardStep","Foursquare","FrancSign","FreeCodeCamp","Freebsd","Frog","Fulcrum","Futbol","G","GalacticRepublic","GalacticSenate","Gamepad","GasPump","Gauge","GaugeHigh","GaugeSimple","GaugeSimpleHigh","Gavel","Gear","Gears","Gem","Genderless","GetPocket","Gg","GgCircle","Ghost","Gift","Gifts","Git","GitAlt","Github","GithubAlt","Gitkraken","Gitlab","Gitter","GlassWater","GlassWaterDroplet","Glasses","Glide","GlideG","Globe","Gofore","Golang","GolfBallTee","Goodreads","GoodreadsG","Google","GoogleDrive","GooglePay","GooglePlay","GooglePlus","GooglePlusG","GoogleWallet","Gopuram","GraduationCap","Gratipay","Grav","GreaterThan","GreaterThanEqual","Grip","GripLines","GripLinesVertical","GripVertical","Gripfire","GroupArrowsRotate","Grunt","GuaraniSign","Guilded","Guitar","Gulp","Gun","H","HackerNews","Hackerrank","Hammer","Hamsa","Hand","HandBackFist","HandDots","HandFist","HandHolding","HandHoldingDollar","HandHoldingDroplet","HandHoldingHand","HandHoldingHeart","HandHoldingMedical","HandLizard","HandMiddleFinger","HandPeace","HandPointDown","HandPointLeft","HandPointRight","HandPointUp","HandPointer","HandScissors","HandSparkles","HandSpock","Handcuffs","Hands","HandsAslInterpreting","HandsBound","HandsBubbles","HandsClapping","HandsHolding","HandsHoldingChild","HandsHoldingCircle","HandsPraying","Handshake","HandshakeAngle","HandshakeSimple","HandshakeSimpleSlash","HandshakeSlash","Hanukiah","HardDrive","Hashnode","Hashtag","HatCowboy","HatCowboySide","HatWizard","HeadSideCough","HeadSideCoughSlash","HeadSideMask","HeadSideVirus","Heading","Headphones","HeadphonesSimple","Headset","Heart","HeartCircleBolt","HeartCircleCheck","HeartCircleExclamation","HeartCircleMinus","HeartCirclePlus","HeartCircleXmark","HeartCrack","HeartPulse","Helicopter","HelicopterSymbol","HelmetSafety","HelmetUn","Highlighter","HillAvalanche","HillRockslide","Hippo","Hips","HireAHelper","Hive","HockeyPuck","HollyBerry","Hooli","Hornbill","Horse","HorseHead","Hospital","HospitalUser","HotTubPerson","Hotdog","Hotel","Hotjar","Hourglass","HourglassEnd","HourglassHalf","HourglassStart","House","HouseChimney","HouseChimneyCrack","HouseChimneyMedical","HouseChimneyUser","HouseChimneyWindow","HouseCircleCheck","HouseCircleExclamation","HouseCircleXmark","HouseCrack","HouseFire","HouseFlag","HouseFloodWater","HouseFloodWaterCircleArrowRight","HouseLaptop","HouseLock","HouseMedical","HouseMedicalCircleCheck","HouseMedicalCircleExclamation","HouseMedicalCircleXmark","HouseMedicalFlag","HouseSignal","HouseTsunami","HouseUser","Houzz","HryvniaSign","Html5","Hubspot","Hurricane","I","ICursor","IceCream","Icicles","Icon","IconCode","IconFont","IconStyle","Icons","IdBadge","IdCard","IdCardClip","Ideal","Igloo","Image","ImagePortrait","Images","Imdb","Inbox","Indent","IndianRupeeSign","Industry","Infinity","Info","Instagram","Instalod","Intercom","InternetExplorer","Invision","Ioxhost","Italic","ItchIo","Itunes","ItunesNote","J","Jar","JarWheat","Java","Jedi","JediOrder","Jenkins","JetFighter","JetFighterUp","Jira","Joget","Joint","Joomla","Js","Jsfiddle","JugDetergent","K","Kaaba","Kaggle","Key","Keybase","Keyboard","Keycdn","Khanda","Kickstarter","KickstarterK","KipSign","KitMedical","KitchenSet","KiwiBird","Korvue","L","LandMineOn","Landmark","LandmarkDome","LandmarkFlag","Language","Laptop","LaptopCode","LaptopFile","LaptopMedical","Laravel","LariSign","Lastfm","LayerGroup","Leaf","Leanpub","LeftLong","LeftRight","Lemon","Less","LessThan","LessThanEqual","LifeRing","Lightbulb","Line","LinesLeaning","Link","LinkSlash","Linkedin","LinkedinIn","Linode","Linux","LiraSign","List","ListCheck","ListOl","ListUl","LitecoinSign","LocationArrow","LocationCrosshairs","LocationDot","LocationPin","LocationPinLock","Lock","LockOpen","Locust","Lungs","LungsVirus","Lyft","M","Magento","Magnet","MagnifyingGlass","MagnifyingGlassArrowRight","MagnifyingGlassChart","MagnifyingGlassDollar","MagnifyingGlassLocation","MagnifyingGlassMinus","MagnifyingGlassPlus","Mailchimp","ManatSign","Mandalorian","Map","MapLocation","MapLocationDot","MapPin","Markdown","Marker","Mars","MarsAndVenus","MarsAndVenusBurst","MarsDouble","MarsStroke","MarsStrokeRight","MarsStrokeUp","MartiniGlass","MartiniGlassCitrus","MartiniGlassEmpty","Mask","MaskFace","MaskVentilator","MasksTheater","Mastodon","MattressPillow","Maxcdn","Maximize","Mdb","Medal","Medapps","Medium","Medrt","Meetup","Megaport","Memory","Mendeley","Menorah","Mercury","Message","Meta","Meteor","Microblog","Microchip","Microphone","MicrophoneLines","MicrophoneLinesSlash","MicrophoneSlash","Microscope","Microsoft","MillSign","Minimize","Minus","Mitten","Mix","Mixcloud","Mixer","Mizuni","Mobile","MobileButton","MobileRetro","MobileScreen","MobileScreenButton","Modx","Monero","MoneyBill","MoneyBill1","MoneyBill1Wave","MoneyBillTransfer","MoneyBillTrendUp","MoneyBillWave","MoneyBillWheat","MoneyBills","MoneyCheck","MoneyCheckDollar","Monument","Moon","MortarPestle","Mosque","Mosquito","MosquitoNet","Motorcycle","Mound","Mountain","MountainCity","MountainSun","MugHot","MugSaucer","Music","N","NairaSign","Napster","Neos","NetworkWired","Neuter","Newspaper","NfcDirectional","NfcSymbol","Nimblr","Node","NodeJs","NotEqual","Notdef","NoteSticky","NotesMedical","Npm","Ns8","Num0","Num1","Num2","Num3","Num4","Num42Group","Num5","Num500px","Num6","Num7","Num8","Num9","Nutritionix","O","ObjectGroup","ObjectUngroup","OctopusDeploy","Odnoklassniki","Odysee","OilCan","OilWell","OldRepublic","Om","Opencart","Openid","Opera","OptinMonster","Orcid","Osi","Otter","Outdent","P","Padlet","Page4","Pagelines","Pager","PaintRoller","Paintbrush","Palette","Palfed","Pallet","Panorama","PaperPlane","Paperclip","ParachuteBox","Paragraph","Passport","Paste","Patreon","Pause","Paw","Paypal","Peace","Pen","PenClip","PenFancy","PenNib","PenRuler","PenToSquare","Pencil","PeopleArrows","PeopleCarryBox","PeopleGroup","PeopleLine","PeoplePulling","PeopleRobbery","PeopleRoof","PepperHot","Perbyte","Percent","Periscope","Person","PersonArrowDownToLine","PersonArrowUpFromLine","PersonBiking","PersonBooth","PersonBreastfeeding","PersonBurst","PersonCane","PersonChalkboard","PersonCircleCheck","PersonCircleExclamation","PersonCircleMinus","PersonCirclePlus","PersonCircleQuestion","PersonCircleXmark","PersonDigging","PersonDotsFromLine","PersonDress","PersonDressBurst","PersonDrowning","PersonFalling","PersonFallingBurst","PersonHalfDress","PersonHarassing","PersonHiking","PersonMilitaryPointing","PersonMilitaryRifle","PersonMilitaryToPerson","PersonPraying","PersonPregnant","PersonRays","PersonRifle","PersonRunning","PersonShelter","PersonSkating","PersonSkiing","PersonSkiingNordic","PersonSnowboarding","PersonSwimming","PersonThroughWindow","PersonWalking","PersonWalkingArrowLoopLeft","PersonWalkingArrowRight","PersonWalkingDashedLineArrowRight","PersonWalkingLuggage","PersonWalkingWithCane","PesetaSign","PesoSign","Phabricator","PhoenixFramework","PhoenixSquadron","Phone","PhoneFlip","PhoneSlash","PhoneVolume","PhotoFilm","Php","PiedPiper","PiedPiperAlt","PiedPiperHat","PiedPiperPp","PiggyBank","Pills","Pinterest","PinterestP","Pix","PizzaSlice","PlaceOfWorship","Plane","PlaneArrival","PlaneCircleCheck","PlaneCircleExclamation","PlaneCircleXmark","PlaneDeparture","PlaneLock","PlaneSlash","PlaneUp","PlantWilt","PlateWheat","Play","Playstation","Plug","PlugCircleBolt","PlugCircleCheck","PlugCircleExclamation","PlugCircleMinus","PlugCirclePlus","PlugCircleXmark","Plus","PlusMinus","Podcast","Poo","PooStorm","Poop","PowerOff","Prescription","PrescriptionBottle","PrescriptionBottleMedical","Print","ProductHunt","PumpMedical","PumpSoap","Pushed","PuzzlePiece","Python","Q","Qq","Qrcode","Question","Quinscape","Quora","QuoteLeft","QuoteRight","R","RProject","Radiation","Radio","Rainbow","RankingStar","RaspberryPi","Ravelry","React","Reacteurope","Readme","Rebel","Receipt","RecordVinyl","RectangleAd","RectangleList","RectangleXmark","Recycle","RedRiver","Reddit","RedditAlien","Redhat","Registered","Regular","Renren","Repeat","Reply","ReplyAll","Replyd","Republican","Researchgate","Resolving","Restroom","Retweet","Rev","Ribbon","RightFromBracket","RightLeft","RightLong","RightToBracket","Ring","Road","RoadBarrier","RoadBridge","RoadCircleCheck","RoadCircleExclamation","RoadCircleXmark","RoadLock","RoadSpikes","Robot","Rocket","Rocketchat","Rockrms","Rotate","RotateLeft","RotateRight","Route","Rss","RubleSign","Rug","Ruler","RulerCombined","RulerHorizontal","RulerVertical","RupeeSign","RupiahSign","Rust","S","SIZE","SackDollar","SackXmark","Safari","Sailboat","Salesforce","Sass","Satellite","SatelliteDish","ScaleBalanced","ScaleUnbalanced","ScaleUnbalancedFlip","Schlix","School","SchoolCircleCheck","SchoolCircleExclamation","SchoolCircleXmark","SchoolFlag","SchoolLock","Scissors","Screenpal","Screwdriver","ScrewdriverWrench","Scribd","Scroll","ScrollTorah","SdCard","Searchengin","Section","Seedling","Sellcast","Sellsy","Server","Servicestack","Shapes","Share","ShareFromSquare","ShareNodes","SheetPlastic","ShekelSign","Shield","ShieldCat","ShieldDog","ShieldHalved","ShieldHeart","ShieldVirus","Ship","Shirt","Shirtsinbulk","ShoePrints","Shop","ShopLock","ShopSlash","Shopify","Shopware","Shower","Shrimp","Shuffle","ShuttleSpace","SignHanging","Signal","Signature","SignsPost","SimCard","Simplybuilt","Sink","Sistrix","Sitemap","Sith","Sitrox","Sketch","Skull","SkullCrossbones","Skyatlas","Skype","Slack","Slash","Sleigh","Sliders","Slideshare","Smog","Smoking","Snapchat","Snowflake","Snowman","Snowplow","Soap","Socks","SolarPanel","Solid","Sort","SortDown","SortUp","Soundcloud","Sourcetree","Spa","SpaceAwesome","SpaghettiMonsterFlying","Speakap","SpeakerDeck","SpellCheck","Spider","Spinner","Splotch","Spoon","Spotify","SprayCan","SprayCanSparkles","Square","SquareArrowUpRight","SquareBehance","SquareCaretDown","SquareCaretLeft","SquareCaretRight","SquareCaretUp","SquareCheck","SquareDribbble","SquareEnvelope","SquareFacebook","SquareFontAwesome","SquareFontAwesomeStroke","SquareFull","SquareGit","SquareGithub","SquareGitlab","SquareGooglePlus","SquareH","SquareHackerNews","SquareInstagram","SquareJs","SquareLastfm","SquareMinus","SquareNfi","SquareOdnoklassniki","SquareParking","SquarePen","SquarePersonConfined","SquarePhone","SquarePhoneFlip","SquarePiedPiper","SquarePinterest","SquarePlus","SquarePollHorizontal","SquarePollVertical","SquareReddit","SquareRootVariable","SquareRss","SquareShareNodes","SquareSnapchat","SquareSteam","SquareThreads","SquareTumblr","SquareTwitter","SquareUpRight","SquareViadeo","SquareVimeo","SquareVirus","SquareWhatsapp","SquareXTwitter","SquareXing","SquareXmark","SquareYoutube","Squarespace","StackExchange","StackOverflow","Stackpath","StaffSnake","Stairs","Stamp","Stapler","Star","StarAndCrescent","StarHalf","StarHalfStroke","StarOfDavid","StarOfLife","Staylinked","Steam","SteamSymbol","SterlingSign","Stethoscope","StickerMule","Stop","Stopwatch","Stopwatch20","Store","StoreSlash","Strava","StreetView","Strikethrough","Stripe","StripeS","Stroopwafel","Stubber","Studiovinari","Stumbleupon","StumbleuponCircle","Subscript","Suitcase","SuitcaseMedical","SuitcaseRolling","Sun","SunPlantWilt","Superpowers","Superscript","Supple","Suse","Swatchbook","Swift","Symfony","Synagogue","Syringe","T","Table","TableCells","TableCellsLarge","TableColumns","TableList","TableTennisPaddleBall","Tablet","TabletButton","TabletScreenButton","Tablets","TachographDigital","Tag","Tags","Tape","Tarp","TarpDroplet","Taxi","Teamspeak","Teeth","TeethOpen","Telegram","TemperatureArrowDown","TemperatureArrowUp","TemperatureEmpty","TemperatureFull","TemperatureHalf","TemperatureHigh","TemperatureLow","TemperatureQuarter","TemperatureThreeQuarters","TencentWeibo","TengeSign","Tent","TentArrowDownToLine","TentArrowLeftRight","TentArrowTurnLeft","TentArrowsDown","Tents","Terminal","TextHeight","TextSlash","TextWidth","TheRedYeti","Themeco","Themeisle","Thermometer","ThinkPeaks","Threads","ThumbsDown","ThumbsUp","Thumbtack","Ticket","TicketSimple","Tiktok","Timeline","ToggleOff","ToggleOn","Toilet","ToiletPaper","ToiletPaperSlash","ToiletPortable","ToiletsPortable","Toolbox","Tooth","ToriiGate","Tornado","TowerBroadcast","TowerCell","TowerObservation","Tractor","TradeFederation","Trademark","TrafficLight","Trailer","Train","TrainSubway","TrainTram","Transgender","Trash","TrashArrowUp","TrashCan","TrashCanArrowUp","Tree","TreeCity","Trello","TriangleExclamation","Trophy","Trowel","TrowelBricks","Truck","TruckArrowRight","TruckDroplet","TruckFast","TruckField","TruckFieldUn","TruckFront","TruckMedical","TruckMonster","TruckMoving","TruckPickup","TruckPlane","TruckRampBox","Tty","Tumblr","TurkishLiraSign","TurnDown","TurnUp","Tv","Twitch","Twitter","Typo3","U","Uber","Ubuntu","Uikit","Umbraco","Umbrella","UmbrellaBeach","Uncharted","Underline","Uniregistry","Unity","UniversalAccess","Unlock","UnlockKeyhole","Unsplash","Untappd","UpDown","UpDownLeftRight","UpLong","UpRightAndDownLeftFromCenter","UpRightFromSquare","Upload","Ups","Usb","User","UserAstronaut","UserCheck","UserClock","UserDoctor","UserGear","UserGraduate","UserGroup","UserInjured","UserLarge","UserLargeSlash","UserLock","UserMinus","UserNinja","UserNurse","UserPen","UserPlus","UserSecret","UserShield","UserSlash","UserTag","UserTie","UserXmark","Users","UsersBetweenLines","UsersGear","UsersLine","UsersRays","UsersRectangle","UsersSlash","UsersViewfinder","Usps","Ussunnah","Utensils","V","Vaadin","VanShuttle","Vault","VectorSquare","Venus","VenusDouble","VenusMars","Vest","VestPatches","Viacoin","Viadeo","Vial","VialCircleCheck","VialVirus","Vials","Viber","Video","VideoSlash","Vihara","Vimeo","VimeoV","Vine","Virus","VirusCovid","VirusCovidSlash","VirusSlash","Viruses","Vk","Vnv","Voicemail","Volcano","Volleyball","VolumeHigh","VolumeLow","VolumeOff","VolumeXmark","VrCardboard","Vuejs","W","WalkieTalkie","Wallet","WandMagic","WandMagicSparkles","WandSparkles","Warehouse","WatchmanMonitoring","Water","WaterLadder","WaveSquare","Waze","Weebly","Weibo","WeightHanging","WeightScale","Weixin","Whatsapp","WheatAwn","WheatAwnCircleExclamation","Wheelchair","WheelchairMove","WhiskeyGlass","Whmcs","Wifi","WikipediaW","Wind","WindowMaximize","WindowMinimize","WindowRestore","Windows","WineBottle","WineGlass","WineGlassEmpty","Wirsindhandwerk","Wix","WizardsOfTheCoast","Wodu","WolfPackBattalion","WonSign","Wordpress","WordpressSimple","Worm","Wpbeginner","Wpexplorer","Wpforms","Wpressr","Wrench","X","XRay","XTwitter","Xbox","Xing","Xmark","XmarksLines","Y","YCombinator","Yahoo","Yammer","Yandex","YandexInternational","Yarn","Yelp","YenSign","YinYang","Yoast","Youtube","Z","Zhihu","as_any","as_str","borrow","borrow","borrow","borrow","borrow_mut","borrow_mut","borrow_mut","borrow_mut","build","clone","clone","clone_into","clone_into","clone_to_uninit","clone_to_uninit","clone_to_uninit","clone_to_uninit","code_point","color","color","color","deref","deref","deref","deref","deref_mut","deref_mut","deref_mut","deref_mut","draw","drop","drop","drop","drop","dyn_build","dyn_draw","dyn_event","dyn_layout","dyn_rebuild","eq","eq","event","family","fmt","fmt","font","fonts","from","from","from","from","from","from_name","hash","hash","icon","icon","icon","init","init","init","init","into","into","into","into","label","layout","new","rebuild","rebuild","size","size","size","solid","solid","styled","to_owned","to_owned","try_from","try_from","try_from","try_from","try_into","try_into","try_into","try_into","type_id","type_id","type_id","type_id","weight"],"q":[[0,"ori_font_awesome"],[1965,"core::any"],[1966,"ori_font_awesome::kind"],[1967,"ori_font_awesome::icon"],[1968,"ori_core::context::build"],[1969,"ori_core::canvas::color"],[1970,"ori_core::style::style"],[1971,"core::convert"],[1972,"ori_core::context::draw"],[1973,"alloc::boxed"],[1974,"ori_core::context::event"],[1975,"ori_core::event::event"],[1976,"ori_core::context::layout"],[1977,"ori_core::layout::space"],[1978,"ori_core::layout::size"],[1979,"ori_core::context::rebuild"],[1980,"ori_core::view::any"],[1981,"ori_core::text::attributes"],[1982,"core::fmt"],[1983,"core::option"],[1984,"core::hash"],[1985,"core::result"]],"i":[3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,8,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,31,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,0,0,0,0,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,8,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,31,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,8,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,3,6,3,6,31,3,8,6,31,3,8,6,3,8,3,8,3,3,8,8,3,6,6,31,6,31,3,8,6,31,3,8,6,6,31,3,8,6,6,6,6,6,3,8,6,8,3,8,6,3,6,31,3,3,8,3,3,8,0,6,6,6,31,3,8,6,31,3,8,3,6,6,6,31,6,6,31,6,6,31,3,8,6,31,3,8,6,31,3,8,6,31,3,8,8],"f":"```````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````{{{b{c}}}{{b{d}}}{}}{f{{b{h}}}}{{{b{c}}}{{b{e}}}{}{}}000{{{b{jc}}}{{b{je}}}{}{}}000{{{b{jl}}{b{jn}}{b{jc}}}e{}{}}{{{b{f}}}f}{{{b{A`}}}A`}{{{b{c}}{b{je}}}Ab{}{}}0{{{b{c}}}Ab{}}000{fAd}{{lc}l{{Aj{{Ah{Af}}}}}}``{Al{{b{c}}}{}}000{Al{{b{jc}}}{}}000{{{b{jl}}{b{jc}}{b{jAn}}{b{je}}}Ab{}{}}{AlAb}000{{{b{jc}}{b{jn}}{b{je}}}{{B`{d}}}{}{}}{{{b{jc}}{b{j{B`{d}}}}{b{jAn}}{b{je}}}Ab{}{}}{{{b{jc}}{b{j{B`{d}}}}{b{jBb}}{b{je}}{b{Bd}}}Ab{}{}}{{{b{jc}}{b{j{B`{d}}}}{b{jBf}}{b{je}}Bh}Bj{}{}}{{{b{jc}}{b{j{B`{d}}}}{b{jBl}}{b{je}}{b{Bn}}}Ab{}{}}{{{b{f}}{b{f}}}C`}{{{b{A`}}{b{A`}}}C`}{{{b{jl}}{b{jc}}{b{jBb}}{b{je}}{b{Bd}}}Ab{}{}}{A`Cb}{{{b{f}}{b{jCd}}}Cf}{{{b{A`}}{b{jCd}}}Cf}{{{b{l}}}A`}{f{{b{{Ch{A`}}}}}}{cc{}}0{{{b{h}}}f}11{{{b{h}}}{{Cj{f}}}}{{{b{f}}{b{jc}}}AbCl}{{{b{A`}}{b{jc}}}AbCl}{cl{{Aj{f}}}}{{lc}l{{Aj{f}}}}`{{}Al}000{ce{}{}}000{f{{b{h}}}}{{{b{jl}}{b{jc}}{b{jBf}}{b{je}}Bh}Bj{}{}}5{{{b{jl}}{b{jc}}{b{jBl}}{b{je}}{b{l}}}Ab{}{}}{{{b{jCn}}{b{l}}{b{jBl}}}Ab}{{lc}l{{Aj{{Ah{D`}}}}}}``{{lc}l{{Aj{C`}}}}`{{{b{l}}{b{Db}}}Cn}{{{b{c}}}e{}{}}0{c{{Dd{e}}}{}{}}0000000{{{b{c}}}Df{}}000{A`Dh}","D":"NMl","p":[[1,"reference"],[10,"Any",1965],[6,"IconCode",0,1966],[1,"str"],[0,"mut"],[5,"Icon",0,1967],[5,"BuildCx",1968],[6,"IconFont",0,1966],[1,"unit"],[1,"char"],[5,"Color",1969],[6,"Styled",1970],[10,"Into",1971],[1,"usize"],[5,"DrawCx",1972],[5,"Box",1973],[5,"EventCx",1974],[6,"Event",1975],[5,"LayoutCx",1976],[5,"Space",1977],[5,"Size",1978],[5,"RebuildCx",1979],[10,"AnyView",1980],[1,"bool"],[6,"FontFamily",1981],[5,"Formatter",1982],[8,"Result",1982],[1,"slice"],[6,"Option",1983],[10,"Hasher",1984],[5,"IconStyle",0,1967],[1,"f32"],[5,"Styles",1970],[6,"Result",1985],[5,"TypeId",1965],[5,"FontWeight",1981]],"r":[[903,1967],[904,1966],[905,1966],[906,1967],[1928,1967]],"b":[],"c":"OjAAAAAAAAA=","e":"OzAAAAEAAD8ACgBQBwAAUgcQAGcHFAB9BwEAgwcAAIcHAQCMBwMAlQcAAJcHAACfBw0A"}],\
["ori_macro",{"t":"YYYXXQQQQXXXX","n":["Build","Rebuild","Styled","desktop","example","include_font","is_desktop","is_mobile","is_web","main","mobile","reloadable","web"],"q":[[0,"ori_macro"]],"i":[0,0,0,0,0,0,0,0,0,0,0,0,0],"f":"`````````````","D":"Al","p":[],"r":[],"b":[],"c":"OjAAAAAAAAA=","e":"OjAAAAAAAAA="}],\
["ori_reload",{"t":"FFNNNNNNONNNNNNNNNNNNNONNNNNNNNNNNHNNNNNN","n":["Reloader","Watcher","as_any","borrow","borrow","borrow_mut","borrow_mut","build","content","deref","deref","deref_mut","deref_mut","draw","drop","drop","dyn_build","dyn_draw","dyn_event","dyn_layout","dyn_rebuild","event","file","from","from","init","init","into","into","layout","load","new","new","rebuild","start_cargo_build_watcher","try_from","try_from","try_into","try_into","type_id","type_id"],"q":[[0,"ori_reload"],[41,"core::any"],[42,"ori_core::context::build"],[43,"ori_core::view::view"],[44,"ori_core::context::draw"],[45,"alloc::boxed"],[46,"ori_core::context::event"],[47,"ori_core::event::event"],[48,"ori_core::context::layout"],[49,"ori_core::layout::space"],[50,"ori_core::layout::size"],[51,"ori_core::context::rebuild"],[52,"ori_core::view::any"],[53,"libloading::safe"],[54,"core::option"],[55,"alloc::string"],[56,"core::result"]],"i":[0,0,4,18,4,18,4,4,4,18,4,18,4,4,18,4,4,4,4,4,4,4,4,18,4,18,4,18,4,4,18,18,4,4,0,18,4,18,4,18,4],"f":"``{{{b{c}}}{{b{d}}}{}}{{{b{c}}}{{b{e}}}{}{}}0{{{b{fc}}}{{b{fe}}}{}{}}0{{{b{f{h{e}}}}{b{fj}}{b{fc}}}g{}{{l{c}}}{}}`{n{{b{c}}}{}}0{n{{b{fc}}}{}}0{{{b{f{h{e}}}}{b{fg}}{b{fA`}}{b{fc}}}Ab{}{{l{c}}}{}}{nAb}0{{{b{fc}}{b{fj}}{b{fe}}}{{Ad{d}}}{}{}}{{{b{fc}}{b{f{Ad{d}}}}{b{fA`}}{b{fe}}}Ab{}{}}{{{b{fc}}{b{f{Ad{d}}}}{b{fAf}}{b{fe}}{b{Ah}}}Ab{}{}}{{{b{fc}}{b{f{Ad{d}}}}{b{fAj}}{b{fe}}Al}An{}{}}{{{b{fc}}{b{f{Ad{d}}}}{b{fB`}}{b{fe}}{b{Bb}}}Ab{}{}}{{{b{f{h{e}}}}{b{fg}}{b{fAf}}{b{fc}}{b{Ah}}}Ab{}{{l{c}}}{}}`{cc{}}0{{}n}0{ce{}{}}0{{{b{f{h{e}}}}{b{fg}}{b{fAj}}{b{fc}}Al}An{}{{l{c}}}{}}{{{b{fBd}}{b{{Bh{Bf}}}}}{{Bl{{Bj{c}}}}}{}}{{{b{Bn}}}Bd}{{cC`}{{h{c}}}{}}{{{b{f{h{e}}}}{b{fg}}{b{fB`}}{b{fc}}{b{{h{e}}}}}Ab{}{{l{c}}}{}}{{{b{Bn}}{b{Bn}}Cb}Ab}{c{{Cd{e}}}{}{}}000{{{b{c}}}Cf{}}0","D":"Aj","p":[[1,"reference"],[10,"Any",41],[0,"mut"],[5,"Watcher",0],[5,"BuildCx",42],[10,"View",43],[1,"usize"],[5,"DrawCx",44],[1,"unit"],[5,"Box",45],[5,"EventCx",46],[6,"Event",47],[5,"LayoutCx",48],[5,"Space",49],[5,"Size",50],[5,"RebuildCx",51],[10,"AnyView",52],[5,"Reloader",0],[1,"u8"],[1,"slice"],[5,"Symbol",53],[6,"Option",54],[1,"str"],[5,"String",55],[1,"bool"],[6,"Result",56],[5,"TypeId",41]],"r":[],"b":[],"c":"OjAAAAAAAAA=","e":"OzAAAAEAABwABgADAAUACgAMABoAAQAeAAAAIgAAACQABQA="}],\
diff --git a/search.desc/ori/ori-desc-0-.js b/search.desc/ori/ori-desc-0-.js
index dd6ea9523..eaf98592b 100644
--- a/search.desc/ori/ori-desc-0-.js
+++ b/search.desc/ori/ori-desc-0-.js
@@ -1 +1 @@
-searchState.loadedDescShard("ori", 0, "Ori\nOri app module.\nOri core module.\nOri log module.\nA macro to generate boilerplate for the main function.\nConvenient imports for Ori.\nA macro to generate boilerplate for a hot-reloadable …\nThe main application state.\nA builder for an App.\nCommands that can be sent to the application.\nA delegate for handling events in an application.\nRequests that an application can make to the platform.\nClose a window.\nClose a window.\nThe data type of the returned view.\nThe context passed to the [Delegate] trait.\nDrag a window.\nDrag a window.\nTrait for converting a type into a UiBuilder.\nOpen a new window.\nOpen a new window.\nQuit the application.\nQuit the application.\nRedraw a window.\nA builder for a user interface.\nUpdate a window.\nInformation needed to render a window.\nThe canvas to render.\nThe clear color of the window.\nHandle an event.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCalled when the application is idle.\nCalled when the application is initialized.\nCalls U::from(self).\nCalls U::from(self).\nConvert a type into it’s requisite UiBuilder.\nThe size of the window.\nCanvas module.\nClipboard.\nA channel for sending commands to the user interface.\nContexts for views.\nEvents and event handling.\nCreate a formatted Text.\nCreate a horizontal Stack.\nCreate a horizontal Wrap.\nImage data and processing.\nLayout of Views.\nRebuild trait and derive macro.\nStyleing and theming.\nCreate a collection of styles.\nText rendering and layouting.\nTransition utilities.\nView module.\nThe builtin views in Ori.\nCreate a vertical Stack.\nCreate a vertical Wrap.\nWindowing system abstraction layer.\nCreate a new ZStack view.\nWays to anti-alias a shape.\nThe strokes are joined with a beveled corner.\nWays to blend two colors.\nRadi of the corners on a rounded rectangle.\nThe border width of a rounded rectangle.\nThe end of the stoke is squared off.\nA canvas that can be drawn on.\nReplaces the destination with zero.\nA close verb.\nClose the curve.\nA color with red, green, blue and alpha components.\nA cubic verb.\nCubic bezier curve to a point.\nA bezier curve.\nAn iterator over the segments of a curve.\nA segment of a curve.\nA verb that describes the type of curve.\nPreserves the destination.\nDestination over source.\nA type for displaying a color as a hex string.\nA point is inside the shape if a ray from the point …\nFast anti-aliasing.\nA filled curve.\nRule determining if a point is inside a shape.\nAnti-aliasing.\nA layer that can be transformed and masked.\nA line verb.\nLine to a point.\nA mask that can be used to clip a layer.\nThe strokes are joined with a sharp corner.\nA move verb.\nMove to a point.\nA point is inside the shape if a ray from the point …\nNo anti-aliasing.\nA paint that can be used to fill or stroke a shape.\nA pattern that can be used to fill a shape.\nA pattern.\nA primitive that can be drawn on a canvas.\nA quad verb.\nQuadratic bezier curve to a point.\nThe end of the stroke is rounded.\nThe strokes are joined with a rounded corner.\nWays to fill a shape.\nA solid color.\nReplaces the destination with the source.\nSource over destination.\nThe end of the stroke is squared off and extends past the …\nProperties of a stroke.\nA stroked curve.\nWays to draw the end of a stroke.\nWays to join two segments of a stroke.\nThe alpha component of the color.\nWhether the paint should be anti-aliased.\nConvert the hex color display to a &str.\nConvert the hex color display to a &str.\nThe blue component of the color.\nThe blend mode of the paint.\nThe bottom border width.\nThe bottom left corner radius.\nThe bottom right corner radius.\nThe cap of the stroke.\nThe color of the pattern.\nCount the number of primitives.\nThe curve of the mask.\nThe fill rule of the mask.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nThe green component of the color.\nCreate a new color, with the given hex string.\nCreate a new color, with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, …\nCreate a new color, with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, value …\nThe image of the pattern.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nThe join of the stroke.\nThe left border width.\nThe miter limit of the stroke.\nCreate a new mask.\nCreate a new hex color display with the given red, green, …\nCreate a new color, with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, …\nCreate a new color, with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, value …\nCreate a new color, with the given lightness, a and b …\nCreate a new color, with the given lightness, a, b and …\nCreate a new color, with the given lightness, chroma and …\nCreate a new color, with the given lightness, chroma, hue …\nGet the number of points for the verb.\nThe red component of the color.\nCreate a new color, with the given red, green and blue …\nCreate a new color, with the given red, green, blue and …\nThe right border width.\nThe shader of the paint.\nThe top border width.\nThe top left corner radius.\nThe top right corner radius.\nThe transformation of the pattern.\nThe width of the stroke.\nThe curve to draw.\nThe curve to draw.\nThe fill rule of the curve.\nThe mask of the layer.\nThe paint to fill the curve with.\nThe paint to stroke the curve with.\nThe primitives of the layer.\nThe stroke properties of the curve.\nThe transformation of the layer.\nThe view of the layer.\nA clipboard.\nA clipboard backend.\nGet the clipboard text.\nSet the clipboard text.\nA command containing arbitrary data.\nA clonable channel for sending Commands.\nA receiver for Commands.\nA waker for the event loop, triggered when a command is …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nTry to downcast the command to T.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck whether the command is of type T.\nGet the name of the command.\nCreate a new command.\nCreate a new CommandWaker.\nConvert the command into a boxed Any value.\nTry receive a command.\nWake the event loop.\nA base context that is shared between all other contexts.\nA context for building the view tree.\nA context for a view.\nA context for drawing the view tree.\nA context for handling events.\nA context for laying out the view tree.\nA context for rebuilding the view tree.\nCheck if the context is present.\nReturns the argument unchanged.\nGet a context.\nGet a mutable context.\nGet a context or insert a default.\nPush a context.\nCalls U::from(self).\nCheck if there are no contexts.\nGet the number of contexts.\nCreate a new context.\nPop a context.\nAn animation frame has passed.\nThe back button.\nEvent emitted when a window wants to close.\nThe window requested to be close.\nA keyboard key-code.\nA command was sent.\nAn event that can be sent to a view.\nThe forward button.\nInput Method Editor (IME) state.\nA trait for checking if something is a certain key.\nA keyboard key.\nAn event fired when a key is pressed.\nA keyboard key was pressed.\nAn event fired when a key is released.\nA keyboard key was released.\nModifiers for keyboard and pointer events.\nOther buttons.\nA pointer button.\nA unique pointer id.\nA pointer left the window.\nA pointer left the window.\nA pointer was moved.\nA pointer moved.\nA pointer button was pressed.\nA pointer button was pressed.\nA pointer button was released.\nA pointer button was released.\nA pointer wheel was scrolled.\nA pointer was scrolled.\nThe primary button, usually the left mouse button or the …\nThe secondary button, usually the right mouse button.\nThe tertiary button, usually the middle mouse button.\nView state needs to be updated.\nEvent emitted when a window is maximized.\nThe window was maximized.\nEvent emitted when a window is resized.\nThe window was resized.\nEvent emitted when a window is scaled.\nThe window was scaled.\nWhether the alt key is held down.\nThe button of the pointer.\nThe button of the pointer.\nWhether the button was clicked.\nThe code of the key that was pressed.\nThe code of the key that was released.\nThe current composition range.\nWhether the control key is held down.\nThe delta of the pointer.\nThe delta of the pointer.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nThe new height of the window.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck if the key is the given key.\nCheck if the key is released.\nThe key that was pressed, ignoring modifiers.\nThe key that was released, ignoring modifiers.\nWhether the window is maximized or not.\nWhether the meta key is held down.\nThe modifiers that were active.\nThe modifiers that were active.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe new scale factor of the window.\nThe current selection range.\nWhether the shift key is held down.\nGet the new size of the window.\nThe current text being edited.\nThe text that was entered.\nThe new width of the window.\nThe window that wants to close.\nThe window that was resized.\nThe window that was scaled.\nThe window that was maximized.\nA texture managed by the rendering backend.\nAn clonable image.\nAn Image texture.\nImage data.\nA unique identifier for an Image.\nA texture.\nAn opaque backend texture identifier.\nA weak reference to an Image.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new TextureId from an index.\nGet the ImageId.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCreate a new TextureId.\nGet the number of strong references to the image.\nConvert the TextureId to an index.\nGet the number of weak references to the image.\nAn affine transformation in 2 dimensional space.\nThe alignment of items along the cross axis.\nAlignment of content inside a container.\nAn axis is a direction in which a layout is applied.\nItems are packed toward the center of the stack.\nItems are packed toward the center of the stack.\nItems are packed toward the end of the stack.\nItems are packed toward the end of the stack.\nA constant used to indicate that a dimension should fill …\nItems are stretched to fill the available space.\nThe horizontal axis.\nThe justify content of a stack container.\nAn iterator over the positions of items in a stack …\nA 2x2 matrix.\nA padding of a rectangle.\nA point in 2D space.\nA rectangle defined by its minimum and maximum points.\nA 2 dimensional size.\nSpace available to lay out a view.\nItems are evenly distributed in the stack, with half-size …\nItems are evenly distributed in the stack, with equal-size …\nItems are evenly distributed in the stack.\nItems are packed toward the start of the stack.\nItems are packed toward the start of the stack.\nItems are stretched to all have the same size.\nA 2D vector.\nThe vertical axis.\nThe bottom padding.\nReturns the argument unchanged.\nThe height.\nCalls U::from(self).\nThe left padding.\nThe matrix of the affine transformation.\nThe maximum point of the rectangle.\nMaximum size the view can be.\nThe minimum point of the rectangle.\nMinimum size the view can be.\nConvert a from points to pixels.\nThe right padding.\nThe top padding.\nThe translation of the affine transformation.\nThe width.\nThe horizontal alignment.\nThe x axis of the matrix.\nThe x coordinate.\nThe x coordinate.\nThe vertical alignment.\nThe y axis of the matrix.\nThe y coordinate.\nThe y coordinate.\nTrait implemented by callsites.\nDispatch trace data to a Subscriber.\nEvents represent single points in time where something …\nIdentifies a span within the context of a subscriber.\nAttaches spans to a std::future::Future.\nDescribes the level of verbosity of a span or event.\nMetadata describing a span or event.\nA handle representing a span, with the capability to enter …\nTrait representing the functions required to collect trace …\nA field value of an erased type.\nCallsites represent the source locations from which spans …\nNotifies the subscriber that a span ID has been cloned.\nReturns a type representing this subscriber’s view of …\nConstructs an event at the debug level.\nConstructs a span at the debug level.\nDispatches trace events to Subscribers.\nIf self is the same type as the provided TypeId, returns …\nThis method is deprecated.\nReturns true if a span or event with the specified metadata…\nChecks whether a span or event is enabled based on the …\nRecords that a span has been entered.\nConstructs an event at the error level.\nConstructs a span at the error level.\nEvents represent single points in time during the …\nRecords that an Event has occurred.\nConstructs a new Event.\nDetermine if an Event should be recorded.\nTests whether an event with the specified level and target …\nRecords that a span has been exited.\nSpan and Event key-value data.\nInstruments this type with the current Span, returning an …\nConstructs an event at the info level.\nConstructs a span at the info level.\nAttach a span to a std::future::Future.\nInstruments this type with the provided Span, returning an …\nInstruments a function to create and enter a tracing span …\nTrace verbosity level filtering.\nReturns the highest verbosity level that this Subscriber …\nMetadata describing trace data.\nReturns the metadata associated with the callsite.\nStatically constructs new span metadata.\nVisit the construction of a new span, returning a new span …\nInvoked when this subscriber becomes a Dispatch.\nVisits this value with the given Visitor.\nRecord a set of values on a span.\nAdds an indication that span follows from the span with …\nRegisters a new callsite with this subscriber, returning …\nSets the Interest for this callsite.\nSpans represent periods of time in which a program was …\nConstructs a new span.\nTests whether a span with the specified level and target …\nCollects and records trace data.\nConstructs an event at the trace level.\nConstructs a span at the trace level.\nNotifies the subscriber that a span ID has been dropped, …\nConstructs an event at the warn level.\nConstructs a span at the warn level.\nTrait implemented by callsites.\nA default Callsite implementation.\nUniquely identifies a Callsite\nReturns the metadata associated with the callsite.\nClear and reregister interest on every Callsite\nRegister a new Callsite with the global registry.\nSets the Interest for this callsite.\nA guard that resets the current default dispatcher to the …\nDispatch trace data to a Subscriber.\nReturned if setting the global dispatcher fails.\nWeakDispatch is a version of Dispatch that holds a …\nExecutes a closure with a reference to this thread’s …\nSets the dispatch as the default dispatch for the duration …\nSets this dispatch as the global default for the duration …\nSets this dispatch as the default for the duration of a …\nEvents represent single points in time where something …\nTrait implemented to allow a type to be used as a field …\nA Value which serializes as a string using fmt::Debug.\nA Value which serializes using fmt::Display.\nAn empty field.\nAn opaque key allowing O(1) access to a field in a Span’…\nDescribes the fields present on a span.\nAn iterator over a set of fields.\nA field value of an erased type.\nA set of fields and values for a span.\nVisits typed values.\nAttempts to convert &self into a Field with the specified …\nWraps a type implementing fmt::Debug as a Value that can be\nWraps a type implementing fmt::Display as a Value that can …\nVisits this value with the given Visitor.\nVisit a boolean value.\nVisit a value implementing fmt::Debug.\nRecords a type implementing Error.\nVisit a double-precision floating point value.\nVisit a signed 128-bit integer value.\nVisit a signed 64-bit integer value.\nVisit a string value.\nVisit an unsigned 128-bit integer value.\nVisit an unsigned 64-bit integer value.\nAttaches spans to a std::future::Future.\nA Future that has been instrumented with a tracing Span.\nA Future that has been instrumented with a tracing …\nExtension trait allowing futures to be instrumented with a …\nInstruments this type with the current Span, returning an …\nInstruments this type with the provided Span, returning an …\nAttaches the current default Subscriber to this type, …\nAttaches the provided Subscriber to this type, returning a …\nA filter comparable to a verbosity Level.\nIndicates that a string could not be parsed to a valid …\nThe statically configured maximum trace level.\nIndicates whether the callsite is a span or event.\nDescribes the level of verbosity of a span or event.\nA filter comparable to a verbosity Level.\nMetadata describing a span or event.\nReturned if parsing a Level fails.\nIndicates that a string could not be parsed to a valid …\nTrait implemented by types which have a span Id.\nAttributes provided to a Subscriber describing a new span …\nA guard representing a span which has been entered and is …\nAn owned version of Entered, a guard representing a span …\nIdentifies a span within the context of a subscriber.\nA set of fields recorded by a span.\nA handle representing a span, with the capability to enter …\nReturns the Id of the span that self corresponds to, or …\nA guard that resets the current default dispatcher to the …\nIndicates a Subscriber’s interest in a particular …\nA no-op Subscriber.\nReturned if setting the global dispatcher fails.\nTrait representing the functions required to collect trace …\nNotifies the subscriber that a span ID has been cloned.\nReturns a type representing this subscriber’s view of …\nIf self is the same type as the provided TypeId, returns …\nThis method is deprecated.\nReturns true if a span or event with the specified metadata…\nRecords that a span has been entered.\nRecords that an Event has occurred.\nDetermine if an Event should be recorded.\nRecords that a span has been exited.\nReturns the highest verbosity level that this Subscriber …\nVisit the construction of a new span, returning a new span …\nInvoked when this subscriber becomes a Dispatch.\nRecord a set of values on a span.\nAdds an indication that span follows from the span with …\nRegisters a new callsite with this subscriber, returning …\nSets the Subscriber as the default for the current thread …\nSets this subscriber as the global default for the …\nNotifies the subscriber that a span ID has been dropped, …\nSets this Subscriber as the default for the current thread …\nA convenience trait for rebuilding a View.\nDerive the Rebuild trait.\nRebuild the view.\nA derived style.\nA style.\nA style key.\nA styled value.\nA collection of styles.\nA theme.\nA value.\nThe accent color.\nThe background color.\nCreate a computed style.\nThe contrast color.\nThe danger color.\nThe info color.\nCreate a style key.\nThe outline color.\nThe primary color.\nThe secondary color.\nThe success color.\nThe surface color.\nCreate a style value.\nThe warning color.\nA glyph in the font atlas.\nA collection of fonts.\nAlign text in the center.\nCondensed font stretch.\nA cursive font family.\nA font loaded from data.\nAlign text at the end.\nExpanded font stretch.\nExtra-condensed font stretch.\nExtra-expanded font stretch.\nA fantasy font family.\nA font atlas.\nA font family, by default FontFamily::SansSerif.\nA source for a font.\nA font stretch.\nA font style.\nA font weight.\nA context for loading and rasterizing fonts.\nItalic font style.\nA monospace font family.\nA font family by name, e.g. “Arial”.\nDo not wrap text.\nNormal font stretch, the default.\nNormal font style, the default.\nOblique font style.\nA font loaded from a file.\nA sans-serif font family.\nSemi-condensed font stretch.\nSemi-expanded font stretch.\nA serif font family.\nAlign text at the start.\nAlignment of a section of text.\nAttributes of a section of text.\nA convenient wrapper around a cosmic_text::Buffer.\nWrapping of a section of text.\nUltra-condensed font stretch.\nUltra-expanded font stretch.\nWrap text at the word boundary.\nThe glyph cache.\nThe font family of the text.\nThe font atlas.\nThe font system.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nGet the image of the atlas.\nLoad a font from a file or directory.\nInsert a physical glyph into the atlas.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nThe layout rect of the glyph.\nCreate a new font atlas with the given size.\nThe font size of the text.\nThe font style of the text.\nThe swash cache.\nConvert the text attributes to a cosmic_text::Attrs.\nThe uv coordinates of the glyph in the atlas.\nThe font weight of the text.\nAn ease transition curve.\nA transition easing curve.\nA linear transition curve.\nA transition.\nThe duration of the transition.\nCreate an ease transition with the given duration.\nThe easing curve.\nCreate a linear transition with the given duration.\nThe view is active.\nThe view needs an animation frame.\nThe state of a BoxedView.\nA view that supports dynamic dispatch.\nA boxed dynamic view.\nThe view needs to be drawn.\nThe view is focusable.\nThe view is focused.\nEquivalent to …\nThe view has an active child.\nThe view has a focused child.\nThe view has a hot child.\nThe view is hot.\nEquivalent to Self::HOT | Self::FOCUSED | Self::ACTIVE.\nThe view needs to be laid out.\nA view that has separate ViewState from its content.\nContents of a view, in a sequence.\nThe state of a PodSeq.\nThe state of a Pod.\nThe state of the sequence.\nThe state of the view, see top-level documentation for …\nFlags that indicate what needs to be updated.\nA single UI component.\nFlags that indicate state of a view.\nAn opaque unique identifier for a view.\nA sequence of views.\nState associated with a View.\nGet a flags value with all known bits set.\nGet a flags value with all known bits set.\nCreate a new BoxedView.\nGet a reference to the underlying Any object.\nGet the underlying id as a u64.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nGet the underlying bits value.\nGet the underlying bits value.\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nBuild the sequence state.\nBuild the view state, see top-level documentation for more …\nThe bitwise negation (!) of the bits in a flags value, …\nThe bitwise negation (!) of the bits in a flags value, …\nWhether all set bits in a source flags value are also set …\nWhether all set bits in a source flags value are also set …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nDraw the view, see top-level documentation for more …\nDraw the nth view.\nBuild the view.\nDraw the view.\nHandle an event.\nCalculate the layout.\nRebuild the view.\nGet a flags value with all bits unset.\nGet a flags value with all bits unset.\nHandle an event, see top-level documentation for more …\nHandle an event for the nth view.\nThe bitwise or (|) of the bits in each flags value.\nThe bitwise or (|) of the bits in each flags value.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nConvert from a bits value.\nConvert from a bits value.\nConvert from a bits value exactly.\nConvert from a bits value exactly.\nConvert from a bits value, unsetting any unknown bits.\nConvert from a bits value, unsetting any unknown bits.\nThe bitwise or (|) of the bits in each flags value.\nThe bitwise or (|) of the bits in each flags value.\nGet a flags value with the bits of a flag with the given …\nGet a flags value with the bits of a flag with the given …\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nWhether any set bits in a source flags value are also set …\nWhether any set bits in a source flags value are also set …\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nWhether all known bits in this flags value are set.\nWhether all known bits in this flags value are set.\nWhether all bits in this flags value are unset.\nWhether all bits in this flags value are unset.\nYield a set of contained flags values.\nYield a set of contained flags values.\nYield a set of contained named flags values.\nYield a set of contained named flags values.\nLayout the view, see top-level documentation for more …\nLayout the nth view.\nThe length of the sequence.\nCreate a new ViewId.\nThe bitwise negation (!) of the bits in a flags value, …\nThe bitwise negation (!) of the bits in a flags value, …\nCreate a new Pod view.\nRebuild the sequence state.\nRebuild the view state, see top-level documentation for …\nRebuild the nth view.\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nCall insert when value is true or remove when value is …\nCall insert when value is true or remove when value is …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nA view that aligns its content.\nA view that animates.\nA view that lays out its content with a fixed aspect ratio.\nA view that hooks into the build cycle.\nA button.\nThe derived style for Button.\nA checkbox.\nThe derived style for Checkbox.\nThe click event.\nA click event.\nA click handler.\nA collapsing view.\nThe derived style for Collapsing.\nA color picker.\nThe derived style for ColorPicker.\nA view that constrains its content to a given space.\nA container view.\nThe derived style for Container.\nA view that hooks into the draw cycle.\nA view that handles events.\nThe flex value of a view.\nA flexible view.\nA view that focuses on a part of the data.\nA lens used by Focus.\nA view that only builds the inner view when certain data …\nA view that bridges the gap between impl View and …\nA view that adds padding to its content.\nA view that draws something.\nThe press event.\nA view that handles rebuilds.\nThe release event.\nA scrollable view.\nThe derived style for Scroll.\nA slider.\nThe derived style for Slider.\nA view that stacks it’s content in a line.\nA view that suspends rendering while a future is pending.\nA view that displays text.\nA text input.\nThe derived style for TextInput.\nThe derived style for Text.\nA view that displays some text when the content is hovered.\nThe derived style for Tooltip.\nA view that transforms its content.\nA view that creates a trigger around the content.\nA view that stores some additional data.\nA view that applies a style to its content.\nA view that lays out it’s content in a line wrapping if …\nA view that overlays its content on top of each other.\nThe build callback.\nThe callback after an event is propagated.\nCreate a new Aligned view.\nHow to align the content along the cross axis, within each …\nThe horizontal alignment of the text.\nThe style of Text::align.\nThe vertical alignment of the text.\nThe style of TextInput::align.\nThe horizontal alignment of the text.\nThe style of Tooltip::align.\nHow to align the content along the cross axis.\nThe alignment.\nThe color of the alpha slider.\nThe style of ColorPicker::alpha_color.\nThe flex value.\nCreate a new Animate.\nThe animation callback.\nThe aspect ratio of the content.\nThe axis of the scroll.\nThe axis of the slider.\nThe axis of the stack.\nThe axis.\nCreate a new Container with background.\nThe background color.\nThe style of Checkbox::background.\nThe background color of the header.\nThe style of Collapsing::background.\nThe background color.\nThe style of Container::background.\nThe background color of the slider.\nThe style of Slider::background.\nThe background color of the text.\nThe style of Tooltip::background.\nThe callback before an event is propagated.\nThe border color.\nThe style of Button::border_color.\nThe border color.\nThe style of Checkbox::border_color.\nThe color of the border of the header.\nThe style of Collapsing::border_color.\nThe border color of the color picker.\nThe style of ColorPicker::border_color.\nThe border color.\nThe style of Container::border_color.\nThe border color of the slider.\nThe style of Slider::border_color.\nThe border color of the text.\nThe style of Tooltip::border_color.\nThe border radius.\nThe style of Button::border_radius.\nThe border radius.\nThe style of Checkbox::border_radius.\nThe border radius of the header.\nThe style of Collapsing::border_radius.\nThe border radius.\nThe style of Container::border_radius.\nThe radius of the scrollbar.\nThe style of Scroll::border_radius.\nThe border radius of the slider.\nThe style of Slider::border_radius.\nThe border radius of the text.\nThe style of Tooltip::border_radius.\nThe border width.\nThe style of Button::border_width.\nThe border width.\nThe style of Checkbox::border_width.\nThe border width of the header.\nThe style of Collapsing::border_width.\nThe border width of the color picker.\nThe style of ColorPicker::border_width.\nThe border width.\nThe style of Container::border_width.\nThe border width of the slider.\nThe style of Slider::border_width.\nThe border width of the text.\nThe style of Tooltip::border_width.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Button.\nThe button to listen for.\nThe callback.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Checkbox.\nWhether the checkbox is checked.\nCreate a new Painter view that draws a circle.\nCreate a new Collapsing.\nThe color of the button.\nThe style of Button::color.\nThe color of the checkbox.\nThe style of Checkbox::color.\nThe color of the color picker.\nThe color of the scrollbar.\nThe style of Scroll::color.\nThe foreground color of the slider.\nThe style of Slider::color.\nThe color of the text.\nThe style of Text::color.\nThe color of the text.\nThe style of TextInput::color.\nThe color of text.\nThe style of Tooltip::color.\nCreate a new ColorPicker.\nThe gap between each column.\nCreate a new Constrained view, constraining its content to …\nCreate a new Container.\nThe content.\nThe content.\nThe content.\nThe content view.\nThe content.\nThe content.\nThe content view.\nThe content to align.\nThe content.\nThe content.\nThe content.\nThe content.\nThe content to constrain.\nThe content.\nThe content of the view.\nThe content.\nThe content.\nThe content of the stack.\nThe content to display.\nThe content.\nThe content.\nThe content to overlay.\nWhether the view is open by default.\nThe delay before the tooltip is displayed.\nThe style of Tooltip::delay.\nWhether the item should be clickable when it’s …\nThe draw function.\nCreate a new Painter view that draws an ellipse.\nThe event to listen for.\nCreate a new expanded Flexible view.\nThe distance of the fancy effect.\nThe style of Button::fancy.\nCreate a new Flexible view.\nThe flex value of the view.\nCreate a new Focus.\nThe font family of the text.\nThe style of Text::font_family.\nThe font family of the text.\nThe style of TextInput::font_family.\nThe font family of the text.\nThe style of Tooltip::font_family.\nThe font size of the text.\nThe style of Text::font_size.\nThe font size of the text.\nThe style of TextInput::font_size.\nThe font size of the text.\nThe style of Tooltip::font_size.\nThe font stretch of the text.\nThe style of Text::font_stretch.\nThe font stretch of the text.\nThe style of TextInput::font_stretch.\nThe font stretch of the text.\nThe style of Tooltip::font_stretch.\nThe font.into of the text.\nThe style of Text::font_style.\nThe font.into of the text.\nThe style of TextInput::font_style.\nThe font style of the text.\nThe style of Tooltip::font_style.\nThe font weight of the text.\nThe style of Text::font_weight.\nThe font weight of the text.\nThe style of TextInput::font_weight.\nThe font weight of the text.\nThe style of Tooltip::font_weight.\nThe gap between children.\nThe header.\nCreate a new Constrained view, constraining its content to …\nCreate a new horizontal Scroll.\nCreate a horizontal Stack.\nCreate a horizontal Stack.\nCreate a horizontal Stack, with dynamic content.\nCreate a horizontal Stack, with vector content.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap, with dynamic content.\nCreate a horizontal Wrap, with a vector of content.\nThe color of the icon.\nThe style of Collapsing::icon_color.\nThe size of the icon.\nThe style of Collapsing::icon_size.\nThe inset of the scrollbar.\nThe style of Scroll::inset.\nWhether the view is tight.\nHow to justify the content along the main axis.\nHow to justify the content along the main axis.\nHow to justify the content along the cross axis.\nThe color of the scrollbar knob.\nThe style of Scroll::knob_color.\nCreate a new Aligned view that aligns its content to the …\nThe length of the slider.\nThe style of Slider::length.\nThe color of the lightness slider.\nThe style of ColorPicker::lightness_color.\nThe line height of the text.\nThe style of Text::line_height.\nThe line height of the text.\nThe style of TextInput::line_height.\nThe line height of the text.\nThe style of Tooltip::line_height.\nWhether to mask the content.\nThe style of Container::mask.\nCreate a new Constrained view, constraining its content to …\nCreate a new Constrained view, constraining its content to …\nCreate a new Constrained view, constraining its content to …\nCreate a new Memo.\nCreate a new Constrained view, constraining its content to …\nCreate a new Constrained view, constraining its content to …\nCreate a new Constrained view, constraining its content to …\nWhether the input is multi-line.\nCreate a new BuildHandler.\nCreate a new Clickable, that calls on_click when clicked.\nCreate a new DrawHandler.\nThe draw callback.\nCreate a new EventHandler, with an after callback.\nCreate a new EventHandler, with a before callback.\nThe on_input callback.\nThe callback for when the value changes.\nA callback that is called when an input is received.\nA callback for when the view is opened or closed.\nCreate a new Clickable, that calls on_press when pressed.\nCreate a new RebuildHandler.\nCreate a new Clickable, that calls on_release when …\nA callback that is called when the input is submitted.\nA view that bridges the gap between impl View and …\nWhether the view is open.\nCreate a new Pad view.\nCreate a new Pad view adding padding to the bottom.\nCreate a new Pad view adding padding to the left.\nCreate a new Pad view adding padding to the right.\nCreate a new Pad view adding padding to the top.\nThe padding.\nThe style of Button::padding.\nThe padding.\nThe padding of the text.\nThe style of Tooltip::padding.\nCreate a new Painter view.\nPlaceholder text to display when the input is empty.\nThe color of the placeholder text.\nThe style of TextInput::placeholder_color.\nThe range of the slider.\nThe callback for when a rebuild is requested.\nCreate a new Painter view that draws a rectangle.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Transform view that rotates its content.\nCreate a new Transform view that rotates its content in …\nThe gap between each row.\nCreate a new Transform view that scales its content.\nCreate a new Constrained view, cosntraining its content to …\nThe size of the checkbox.\nThe style of Checkbox::size.\nThe size of the color picker.\nThe style of ColorPicker::size.\nThe size of the view.\nCreate a new Slider.\nThe width of the sliders.\nThe style of ColorPicker::slider_width.\nThe space to constrain the content to.\nThe stroke width of the checkbox.\nThe style of Checkbox::stroke.\nThe style to apply.\nCreate a new Suspense view.\nCreate a new Text.\nThe text.\nThe text.\nThe text to display.\nCreate a formatted Text.\nCreate a new TextInput.\nWhether the view is tight.\nCreate a new Tooltip view.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Transform view.\nThe transform.\nAnimate a transition.\nThe transition of the button.\nThe style of Button::transition.\nThe transition of the checkbox.\nThe style of Checkbox::transition.\nThe transition of the view.\nThe style of Collapsing::transition.\nThe transition of the scrollbar.\nThe style of Scroll::transition.\nAnimate a view when active changes.\nAnimate a view when focused changes.\nAnimate a view when hot changes.\nCreate a new Transform view that translates its content.\nCreate a new Trigger view.\nThe value of the slider.\nCreate a new vertical Scroll.\nCreate a vertical Stack.\nCreate a vertical Stack.\nCreate a vertical Stack, with dynamic content.\nCreate a vertical Stack, with vector content.\nCreate a vertical Wrap.\nCreate a vertical Wrap.\nCreate a vertical Wrap, with dynamic content.\nCreate a vertical Wrap, with a vector of content.\nCreate a new Constrained view, constraining its content to …\nThe width of the scrollbar.\nThe style of Scroll::width.\nThe width of the slider.\nThe style of Slider::width.\nCreate a new WithState that replaces the data with the …\nCreate a new WithState that replaces the data with the …\nCreate a new WithState.\nCreate a new WithState using S::default().\nCreate a view that applies a style to its content.\nCreate a new view unwrapping some data from the state.\nCreate a new view unwrapping some state from the data.\nThe text wrap of the text.\nThe style of Text::wrap.\nThe text wrap of the text.\nThe style of TextInput::wrap.\nThe text wrap of the text.\nThe style of Tooltip::wrap.\nCreate a new ZStack view.\nCreate a new ZStack view.\nSet the color of the window.\nThe root View will have Space::UNBOUNDED, and the window …\nA mouse cursor icon.\nSet the cursor of the window.\nSet whether the window is decorated.\nThe window will have a fixed size equal to Window::size.\nSet the icon of the window.\nSet the ime state of the window.\nSet whether the window is maximized.\nThe state of a pointer.\nSet whether the window is resizable.\nSet the scale of the window.\nSet the size of the window.\nSet the title of the window.\nSet whether the window is visible.\nA window.\nA unique identifier for a window.\nThe sizing of a window.\nThe state of a window.\nAn update to a window.\nThe color of the window.\nThe color of the window.\nWhether the window is decorated.\nWhether the window is decorated.\nGet the difference between a window and a previous state.\nReturns the argument unchanged.\nReturns the argument unchanged.\nThe view the pointer is over.\nThe icon of the window.\nThe icon of the window.\nCalls U::from(self).\nCalls U::from(self).\nWhether the window is maximized.\nWhether the window is maximized.\nThe position of the pointer.\nWhether the window is resizable.\nWhether the window is resizable.\nThe scale of the window.\nThe scale of the window.\nThe size of the window.\nThe size of the window.\nThe sizing of the window.\nThe title of the window.\nThe title of the window.\nWhether the window is visible.\nWhether the window is visible.\nTrait implemented by callsites.\nThe “debug” level.\nDispatch trace data to a Subscriber.\nThe “error” level.\nEvents represent single points in time where something …\nThe “info” level.\nIdentifies a span within the context of a subscriber.\nAttaches spans to a std::future::Future.\nDescribes the level of verbosity of a span or event.\nMetadata describing a span or event.\nA handle representing a span, with the capability to enter …\nTrait representing the functions required to collect trace …\nThe “trace” level.\nA field value of an erased type.\nThe “warn” level.\nReturns the string representation of the Level.\nCallsites represent the source locations from which spans …\nReturns an opaque Identifier that uniquely identifies the …\nConstructs a new Span as child of the given parent span, …\nNotifies the subscriber that a span ID has been cloned.\nNotifies the subscriber that a span ID has been cloned.\nReturns a handle to the span considered by the Subscriber …\nReturns a type representing this subscriber’s view of …\nReturns a type representing this subscriber’s view of …\nConstructs an event at the debug level.\nConstructs a span at the debug level.\nReturns the current default dispatcher\nDispatches trace events to Subscribers.\nIf self is the same type as the provided TypeId, returns …\nReturns some reference to this [Subscriber…\nReturns some reference to this Subscriber value if it is …\nReturns some reference to this Subscriber value if it is …\nReturns some reference to this Subscriber value if it is …\nReturns some reference to the Subscriber this Dispatch …\nCreates a WeakDispatch from this Dispatch.\nThis method is deprecated.\nNotifies the subscriber that a span ID has been dropped.\nReturns true if a span or event with the specified metadata…\nReturns true if a span with the specified metadata would be\nChecks whether a span or event is enabled based on the …\nRecords that a span has been entered.\nEnters this span, returning a guard that will exit the …\nRecords that a span has been can_enter.\nEnters this span, consuming it and returning a guard that …\nConstructs an event at the error level.\nConstructs a span at the error level.\nEvents represent single points in time during the …\nRecords that an Event has occurred.\nRecords that an Event has occurred.\nConstructs a new Event.\nDetermine if an Event should be recorded.\nTests whether an event with the specified level and target …\nRecords that a span has been exited.\nRecords that a span has been exited.\nSpan and Event key-value data.\nReturns a Field for the field with the given name, if one …\nReturns the names of the fields on the described span or …\nReturns the name of the source code file where the span …\nIndicates that the span with the given ID has an indirect …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nConstructs a new span ID from the given NonZeroU64.\nConstructs a new span ID from the given u64.\nReturns true if this Span has a field for the given Field …\nReturns this span’s Id, if it is enabled.\nInstruments this type with the current Span, returning an …\nExecutes the given function in the context of this span.\nConstructs an event at the info level.\nConstructs a span at the info level.\nAttach a span to a std::future::Future.\nInstruments this type with the provided Span, returning an …\nInstruments a function to create and enter a tracing span …\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns the span’s ID as a NonZeroU64.\nReturns the span’s ID as a u64.\nReturns true if this Subscriber is the same type as T.\nReturns true if this Subscriber is the same type as T.\nReturns true if this Subscriber is the same type as T.\nReturns true if this Subscriber is the same type as T.\nReturns true if this Dispatch forwards to a Subscriber of …\nReturns true if this span was disabled by the subscriber …\nReturns true if the callsite kind is Event.\nReturns true if this span was constructed by Span::none …\nReturn true if the callsite kind is Span.\nReturns the level of verbosity of the described span or …\nTrace verbosity level filtering.\nReturns the line number in the source code file where the …\nReturns the highest verbosity level that this Subscriber …\nMetadata describing trace data.\nReturns the metadata associated with the callsite.\nReturns this span’s Metadata, if it is enabled.\nStatically constructs new span metadata.\nReturns the path to the Rust module where the span …\nReturns the name of the span.\nConstructs a new Span with the given metadata and set of …\nConstruct new metadata for a span or event, with a name, …\nReturns a Dispatch that forwards to the given Subscriber.\nConstructs a new disabled span with the given Metadata.\nConstructs a new Span as the root of its own trace tree, …\nVisit the construction of a new span, returning a new span …\nRecord the construction of a new span, returning a new ID …\nConstructs a new span that is completely disabled.\nReturns a new Dispatch that discards events and spans.\nInvoked when this subscriber becomes a Dispatch.\nReturns this span, if it was enabled by the current …\nVisits this value with the given Visitor.\nRecord a set of values on a span.\nRecords that the field described by field has the value …\nRecord a set of values on a span.\nRecords all the fields in the provided ValueSet.\nAdds an indication that span follows from the span with …\nAdds an indication that span follows from the span with …\nRegisters a new callsite with this subscriber, returning …\nRegisters a new callsite with this subscriber, returning …\nSets the Interest for this callsite.\nSpans represent periods of time in which a program was …\nConstructs a new span.\nTests whether a span with the specified level and target …\nCollects and records trace data.\nReturns a string describing the part of the system where …\nConstructs an event at the trace level.\nConstructs a span at the trace level.\nNotifies the subscriber that a span ID has been dropped, …\nNotifies the subscriber that a span ID has been dropped, …\nConstructs an event at the warn level.\nConstructs a span at the warn level.\nInvokes a function with a reference to this span’s ID …\nTrait implemented by callsites.\nA default Callsite implementation.\nUniquely identifies a Callsite\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the callsite’s cached Interest, or registers it …\nCalls U::from(self).\nCalls U::from(self).\nReturns the metadata associated with the callsite.\nReturns a new DefaultCallsite with the specified Metadata.\nClear and reregister interest on every Callsite\nRegister a new Callsite with the global registry.\nRegisters this callsite with the global callsite registry.\nSets the Interest for this callsite.\nA guard that resets the current default dispatcher to the …\nDispatch trace data to a Subscriber.\nReturned if setting the global dispatcher fails.\nWeakDispatch is a version of Dispatch that holds a …\nReturns the argument unchanged.\nExecutes a closure with a reference to this thread’s …\nCalls U::from(self).\nSets the dispatch as the default dispatch for the duration …\nSets this dispatch as the global default for the duration …\nAttempts to upgrade this WeakDispatch to a Dispatch.\nSets this dispatch as the default for the duration of a …\nEvents represent single points in time where something …\nConstructs a new Event with the specified metadata and set …\nConstructs a new Event with the specified metadata and set …\nReturns an iterator over the set of values on this Event.\nReturns the argument unchanged.\nCalls U::from(self).\nReturns true if the new event’s parent should be …\nReturns true if the new event should be a root.\nReturns metadata describing this Event.\nReturns a new Event in the current span, with the …\nReturns a new Event as a child of the specified span, with …\nReturns the new event’s explicitly-specified parent, if …\nVisits all the fields on this Event with the specified …\nTrait implemented to allow a type to be used as a field …\nA Value which serializes as a string using fmt::Debug.\nA Value which serializes using fmt::Display.\nAn empty field.\nAn opaque key allowing O(1) access to a field in a Span’…\nDescribes the fields present on a span.\nAn iterator over a set of fields.\nA field value of an erased type.\nA set of fields and values for a span.\nVisits typed values.\nAttempts to convert &self into a Field with the specified …\nReturns an Identifier that uniquely identifies the Callsite\nReturns an Identifier that uniquely identifies the Callsite\nReturns true if self contains the given field.\nWraps a type implementing fmt::Debug as a Value that can be\nWraps a type implementing fmt::Display as a Value that can …\nReturns the Field named name, or None if no such field …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns whether or not this FieldSet has fields.\nReturns true if this ValueSet contains no values.\nReturns an iterator over the Fields in this FieldSet.\nReturns the number of fields in this FieldSet.\nReturns the number of fields in this ValueSet that would …\nReturns a string representing the name of the field.\nConstructs a new FieldSet with the given array of field …\nVisits this value with the given Visitor.\nVisits all the fields in this ValueSet with the provided …\nVisit a boolean value.\nVisit a value implementing fmt::Debug.\nRecords a type implementing Error.\nVisit a double-precision floating point value.\nVisit a signed 128-bit integer value.\nVisit a signed 64-bit integer value.\nVisit a string value.\nVisit an unsigned 128-bit integer value.\nVisit an unsigned 64-bit integer value.\nAttaches spans to a std::future::Future.\nA Future that has been instrumented with a tracing Span.\nA Future that has been instrumented with a tracing …\nExtension trait allowing futures to be instrumented with a …\nBorrows the Dispatch that is entered when this type is …\nReturns the argument unchanged.\nReturns the argument unchanged.\nInstruments this type with the current Span, returning an …\nBorrows the wrapped type.\nBorrows the wrapped type.\nMutably borrows the wrapped type.\nMutably borrows the wrapped type.\nGet a pinned mutable reference to the wrapped type.\nGet a pinned mutable reference to the wrapped type.\nGet a pinned reference to the wrapped type.\nGet a pinned reference to the wrapped type.\nInstruments this type with the provided Span, returning an …\nCalls U::from(self).\nCalls U::from(self).\nConsumes the Instrumented, returning the wrapped type.\nConsumes the Instrumented, returning the wrapped type.\nBorrows the Span that this type is instrumented by.\nMutably borrows the Span that this type is instrumented by.\nAttaches the current default Subscriber to this type, …\nAttaches the provided Subscriber to this type, returning a …\nA filter comparable to a verbosity Level.\nIndicates that a string could not be parsed to a valid …\nThe statically configured maximum trace level.\nThe “debug” level.\nThe “error” level.\nEvent callsite\nenabled! callsite. Subscribers can assume this Kind means …\nThe “info” level.\nIndicates whether the callsite is a span or event.\nDescribes the level of verbosity of a span or event.\nA filter comparable to a verbosity Level.\nMetadata describing a span or event.\nThe “off” level.\nReturned if parsing a Level fails.\nIndicates that a string could not be parsed to a valid …\nSpan callsite\nThe “trace” level.\nThe “warn” level.\nReturns a LevelFilter that matches the most verbose Level …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns a LevelFilter that enables spans and events with …\nSets that this Kind is a hint.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns the most verbose Level that this filter accepts, …\nReturn true if the callsite kind is Event\nReturn true if the callsite kind is Hint\nReturn true if the callsite kind is Span\nTrait implemented by types which have a span Id.\nAttributes provided to a Subscriber describing a new span …\nA guard representing a span which has been entered and is …\nAn owned version of Entered, a guard representing a span …\nIdentifies a span within the context of a subscriber.\nA set of fields recorded by a span.\nA handle representing a span, with the capability to enter …\nReturns the Id of the span that self corresponds to, or …\nReturns Attributes describing a new child span of the …\nReturns true if this set of Attributes contains a value …\nReturns true if this Record contains a value for the given …\nExits this span, returning the underlying Span.\nReturns the set of all fields defined by this span’s …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns this span’s Id, if it is enabled.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns true if the new span’s parent should be …\nReturns true if this set of Attributes contains no values.\nReturns true if this Record contains no values.\nReturns true if the new span should be a root.\nReturns the number of fields that would be visited from …\nReturns a reference to the new span’s metadata.\nReturns Attributes describing a new child span of the …\nConstructs a new Record from a ValueSet.\nReturns Attributes describing a new span at the root of …\nReturns the new span’s explicitly-specified parent, if …\nRecords all the fields in this set of Attributes with the …\nRecords all the fields in this Record with the provided …\nReturns a reference to a ValueSet containing any values …\nA guard that resets the current default dispatcher to the …\nIndicates a Subscriber’s interest in a particular …\nA no-op Subscriber.\nReturned if setting the global dispatcher fails.\nTrait representing the functions required to collect trace …\nReturns an Interest indicating the subscriber is always …\nNotifies the subscriber that a span ID has been cloned.\nReturns a type representing this subscriber’s view of …\nIf self is the same type as the provided TypeId, returns …\nThis method is deprecated.\nReturns true if a span or event with the specified metadata…\nRecords that a span has been entered.\nRecords that an Event has occurred.\nDetermine if an Event should be recorded.\nRecords that a span has been exited.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns true if the subscriber is always interested in …\nReturns true if the subscriber is never interested in …\nReturns true if the subscriber is sometimes interested in …\nReturns the highest verbosity level that this Subscriber …\nReturns an Interest indicating that the subscriber is …\nReturns a new NoSubscriber.\nVisit the construction of a new span, returning a new span …\nInvoked when this subscriber becomes a Dispatch.\nRecord a set of values on a span.\nAdds an indication that span follows from the span with …\nRegisters a new callsite with this subscriber, returning …\nSets the Subscriber as the default for the current thread …\nSets this subscriber as the global default for the …\nReturns an Interest indicating the subscriber is sometimes …\nNotifies the subscriber that a span ID has been dropped, …\nSets this Subscriber as the default for the current thread …\nThe style key of [Text.align::ALIGN].\nThe style key of [TextInput.align::ALIGN].\nThe style key of [Tooltip.align::ALIGN].\nThe style key of [ColorPicker.alpha_color::ALPHA_COLOR].\nAn affine transformation in 2 dimensional space.\nThe alignment of items along the cross axis.\nA view that aligns its content.\nAlignment of content inside a container.\nA view that animates.\nAn animation frame has passed.\nA view that supports dynamic dispatch.\nThe main application state.\nA builder for an App.\nCommands that can be sent to the application.\nA delegate for handling events in an application.\nA view that lays out its content with a fixed aspect ratio.\nAn axis is a direction in which a layout is applied.\nThe style key of [Checkbox.background::BACKGROUND].\nThe style key of [Collapsing.background::BACKGROUND].\nThe style key of [Container.background::BACKGROUND].\nThe style key of [Slider.background::BACKGROUND].\nThe style key of [Tooltip.background::BACKGROUND].\nBlack font weight (900), the boldest possible.\nBold font weight (700).\nThe style key of [Button.border_color::BORDER_COLOR].\nThe style key of [Checkbox.border_color::BORDER_COLOR].\nThe style key of [Collapsing.border_color::BORDER_COLOR].\nThe style key of [ColorPicker.border_color::BORDER_COLOR].\nThe style key of [Container.border_color::BORDER_COLOR].\nThe style key of [Slider.border_color::BORDER_COLOR].\nThe style key of [Tooltip.border_color::BORDER_COLOR].\nThe style key of [Button.border_radius::BORDER_RADIUS].\nThe style key of [Checkbox.border_radius::BORDER_RADIUS].\nThe style key of [Collapsing.border_radius::BORDER_RADIUS].\nThe style key of [Container.border_radius::BORDER_RADIUS].\nThe style key of [Scroll.border_radius::BORDER_RADIUS].\nThe style key of [Slider.border_radius::BORDER_RADIUS].\nThe style key of [Tooltip.border_radius::BORDER_RADIUS].\nThe style key of [Button.border_width::BORDER_WIDTH].\nThe style key of [Checkbox.border_width::BORDER_WIDTH].\nThe style key of [Collapsing.border_width::BORDER_WIDTH].\nThe style key of [ColorPicker.border_width::BORDER_WIDTH].\nThe style key of [Container.border_width::BORDER_WIDTH].\nThe style key of [Slider.border_width::BORDER_WIDTH].\nThe style key of [Tooltip.border_width::BORDER_WIDTH].\nAlign the content at the bottom of the container.\nAlign the content at the bottom left of the container.\nAlign the content at the bottom right of the container.\nThe back button.\nA base context that is shared between all other contexts.\nThe strokes are joined with a beveled corner.\nWays to blend two colors.\nRadi of the corners on a rounded rectangle.\nThe border width of a rounded rectangle.\nA boxed dynamic view.\nDerive the builder pattern.\nA context for building the view tree.\nA view that hooks into the build cycle.\nA collection of fonts.\nThe end of the stoke is squared off.\nA button.\nThe derived style for Button.\nAlign the content at the center of the container.\nThe style key of [Button.color::COLOR].\nThe style key of [Checkbox.color::COLOR].\nThe style key of [Scroll.color::COLOR].\nThe style key of [Slider.color::COLOR].\nThe style key of [Text.color::COLOR].\nThe style key of [TextInput.color::COLOR].\nThe style key of [Tooltip.color::COLOR].\nA canvas that can be drawn on.\nItems are packed toward the center of the stack.\nItems are packed toward the center of the stack.\nAlign text in the center.\nA checkbox.\nThe derived style for Checkbox.\nReplaces the destination with zero.\nThe click event.\nA click event.\nA click handler.\nA clipboard.\nEvent emitted when a window wants to close.\nThe window requested to be close.\nClose a window.\nA keyboard key-code.\nA collapsing view.\nThe derived style for Collapsing.\nA color with red, green, blue and alpha components.\nA color picker.\nThe derived style for ColorPicker.\nA command was sent.\nA clonable channel for sending Commands.\nA derived style.\nCondensed font stretch.\nA view that constrains its content to a given space.\nA container view.\nThe derived style for Container.\nThe root View will have Space::UNBOUNDED, and the window …\nA cursive font family.\nA mouse cursor icon.\nA bezier curve.\nThe style key of [Tooltip.delay::DELAY].\nA font loaded from data.\nThe context passed to the [Delegate] trait.\nPreserves the destination.\nDestination over source.\nDrag a window.\nA context for drawing the view tree.\nA view that hooks into the draw cycle.\nExtra-bold font weight (800).\nExtra-light font weight (200).\nAn ease transition curve.\nA transition easing curve.\nItems are packed toward the end of the stack.\nItems are packed toward the end of the stack.\nAlign text at the end.\nA point is inside the shape if a ray from the point …\nAn event that can be sent to a view.\nA context for handling events.\nA view that handles events.\nExpanded font stretch.\nExtra-condensed font stretch.\nExtra-expanded font stretch.\nThe style key of [Button.fancy::FANCY].\nA constant used to indicate that a dimension should fill …\nAlias for Self::INFINITY.\nThe infinite space.\nThe style key of [Text.font_family::FONT_FAMILY].\nThe style key of [TextInput.font_family::FONT_FAMILY].\nThe style key of [Tooltip.font_family::FONT_FAMILY].\nThe style key of [Text.font_size::FONT_SIZE].\nThe style key of [TextInput.font_size::FONT_SIZE].\nThe style key of [Tooltip.font_size::FONT_SIZE].\nThe style key of [Text.font_stretch::FONT_STRETCH].\nThe style key of [TextInput.font_stretch::FONT_STRETCH].\nThe style key of [Tooltip.font_stretch::FONT_STRETCH].\nThe style key of [Text.font_style::FONT_STYLE].\nThe style key of [TextInput.font_style::FONT_STYLE].\nThe style key of [Tooltip.font_style::FONT_STYLE].\nThe style key of [Text.font_weight::FONT_WEIGHT].\nThe style key of [TextInput.font_weight::FONT_WEIGHT].\nThe style key of [Tooltip.font_weight::FONT_WEIGHT].\nA fantasy font family.\nItems are stretched to fill the available space.\nRule determining if a point is inside a shape.\nThe window will have a fixed size equal to Window::size.\nThe flex value of a view.\nA flexible view.\nA view that focuses on a part of the data.\nA font family, by default FontFamily::SansSerif.\nA source for a font.\nA font stretch.\nA font style.\nA font weight.\nA context for loading and rasterizing fonts.\nThe forward button.\nThe horizontal axis.\nThe style key of [Collapsing.icon_color::ICON_COLOR].\nThe style key of [Collapsing.icon_size::ICON_SIZE].\nThe identity transformation.\nThe identity matrix.\nThe infinite size.\nThe style key of [Scroll.inset::INSET].\nAn clonable image.\nImage data.\nA unique identifier for an Image.\nItalic font style.\nThe justify content of a stack container.\nThe style key of [Scroll.knob_color::KNOB_COLOR].\nA keyboard key.\nAn event fired when a key is pressed.\nA keyboard key was pressed.\nA keyboard key was released.\nAlign the content at the left of the container.\nThe style key of [Slider.length::LENGTH].\nLight font weight (300).\nThe style key of […\nThe style key of [Text.line_height::LINE_HEIGHT].\nThe style key of [TextInput.line_height::LINE_HEIGHT].\nThe style key of [Tooltip.line_height::LINE_HEIGHT].\nA context for laying out the view tree.\nA lens used by Focus.\nA linear transition curve.\nThe style key of [Container.mask::MASK].\nMedium font weight (500).\nA 2x2 matrix.\nA view that only builds the inner view when certain data …\nThe strokes are joined with a sharp corner.\nModifiers for keyboard and pointer events.\nA monospace font family.\nThe negative unit x point.\nThe negative unit x vector.\nThe negative unit y point.\nThe negative unit y vector.\nNormal font weight (400), the default.\nA font family by name, e.g. “Arial”.\nA point is inside the shape if a ray from the point …\nDo not wrap text.\nNormal font stretch, the default.\nNormal font style, the default.\nThe one point.\nThe one vector.\nOblique font style.\nA view that bridges the gap between impl View and …\nOpen a new window.\nOther buttons.\nThe style key of [Button.padding::PADDING].\nThe style key of [Tooltip.padding::PADDING].\nThe style key of […\nA view that adds padding to its content.\nA padding of a rectangle.\nA paint that can be used to fill or stroke a shape.\nA view that draws something.\nA font loaded from a file.\nA pattern that can be used to fill a shape.\nA pattern.\nA view that has separate ViewState from its content.\nContents of a view, in a sequence.\nA point in 2D space.\nThe state of a pointer.\nA pointer button.\nA unique pointer id.\nA pointer left the window.\nA pointer was moved.\nA pointer moved.\nA pointer button was pressed.\nA pointer button was pressed.\nA pointer button was released.\nA pointer button was released.\nA pointer wheel was scrolled.\nA pointer was scrolled.\nThe press event.\nThe primary button, usually the left mouse button or the …\nQuit the application.\nAlign the content at the right of the container.\nA convenience trait for rebuilding a View.\nDerive the Rebuild trait.\nA context for rebuilding the view tree.\nA view that handles rebuilds.\nA rectangle defined by its minimum and maximum points.\nThe release event.\nThe end of the stroke is rounded.\nThe strokes are joined with a rounded corner.\nSemi-bold font weight (600).\nThe style key of [Checkbox.size::SIZE].\nThe style key of [ColorPicker.size::SIZE].\nThe style key of [ColorPicker.slider_width::SLIDER_WIDTH].\nThe style key of [Checkbox.stroke::STROKE].\nA sans-serif font family.\nA scrollable view.\nThe derived style for Scroll.\nThe secondary button, usually the right mouse button.\nSemi-condensed font stretch.\nSemi-expanded font stretch.\nThe state of a PodSeq.\nA serif font family.\nWays to fill a shape.\nA 2 dimensional size.\nA slider.\nThe derived style for Slider.\nA solid color.\nReplaces the destination with the source.\nSource over destination.\nSpace available to lay out a view.\nItems are evenly distributed in the stack, with half-size …\nItems are evenly distributed in the stack, with equal-size …\nItems are evenly distributed in the stack.\nThe end of the stroke is squared off and extends past the …\nA view that stacks it’s content in a line.\nItems are packed toward the start of the stack.\nItems are packed toward the start of the stack.\nAlign text at the start.\nThe state of a Pod.\nThe state of the sequence.\nThe state of the view, see top-level documentation for …\nItems are stretched to all have the same size.\nProperties of a stroke.\nWays to draw the end of a stroke.\nWays to join two segments of a stroke.\nA style.\nA style key.\nA styled value.\nDerived the styled pattern.\nA collection of styles.\nA view that suspends rendering while a future is pending.\nThin font weight (100), the thinnest possible.\nAlign the content at the top of the container.\nAlign the content at the top left of the container.\nAlign the content at the top right of the container.\nThe style key of [Button.transition::TRANSITION].\nThe style key of [Checkbox.transition::TRANSITION].\nThe style key of [Collapsing.transition::TRANSITION].\nThe style key of [Scroll.transition::TRANSITION].\nThe tertiary button, usually the middle mouse button.\nA view that displays text.\nAlignment of a section of text.\nA convenient wrapper around a cosmic_text::Buffer.\nA text input.\nThe derived style for TextInput.\nThe derived style for Text.\nWrapping of a section of text.\nA theme.\nA view that displays some text when the content is hovered.\nThe derived style for Tooltip.\nA view that transforms its content.\nA transition.\nA view that creates a trigger around the content.\nThe unbounded size.\nThe unbounded space.\nUltra-condensed font stretch.\nUltra-expanded font stretch.\nView state needs to be updated.\nA value.\nA 2D vector.\nThe vertical axis.\nA single UI component.\nA sequence of views.\nState associated with a View.\nThe style key of [Scroll.width::WIDTH].\nThe style key of [Slider.width::WIDTH].\nThe style key of [Text.wrap::WRAP].\nThe style key of [TextInput.wrap::WRAP].\nThe style key of [Tooltip.wrap::WRAP].\nA window.\nA unique identifier for a window.\nThe window was maximized.\nThe window was resized.\nThe window was scaled.\nThe sizing of a window.\nA view that stores some additional data.\nA view that applies a style to its content.\nWrap text at the word boundary.\nA view that lays out it’s content in a line wrapping if …\nThe unit x point.\nThe unit x vector.\nThe unit y point.\nThe unit y vector.\nA BorderRadius with zero radius on all corners.\nA BorderWidth with zero width on all borders.\nThe zero point.\nA rectangle with zero area.\nThe zero size.\nThe zero space.\nThe zero vector.\nA view that overlays its content on top of each other.\nThe alpha component of the color.\nGet the alpha component as an 8 bit integer.\nThe accent color.\nGet whether the view’s active state changed.\nAdd a context.\nAdd a window to the application.\nSet the build callback for after the content is built.\nSet the callback for when an event is emitted.\nThe build callback.\nThe callback after an event is propagated.\nCreate a new Aligned view.\nAlign the content inside the container.\nAligns an item within the given space.\nSet self.align.\nSet self.align.\nSet self.align.\nSet self.align.\nHow to align the content along the cross axis, within each …\nThe horizontal alignment of the text.\nThe style of Text::align.\nThe vertical alignment of the text.\nThe style of TextInput::align.\nThe horizontal alignment of the text.\nThe style of Tooltip::align.\nHow to align the content along the cross axis.\nThe alignment.\nCreate a new BorderRadius with the same radius on all …\nCreate a new BorderWidth with the same width on all …\nCreate a new Padding with the same value for all sides.\nCreate a new point with the same x and y.\nCreate a new size with the same width and height.\nCreate a new vector with the same x and y.\nSet self.alpha_color.\nThe color of the alpha slider.\nThe style of ColorPicker::alpha_color.\nWhether the alt key is held down.\nSet the flex value of the view.\nThe flex value.\nGet the angle of the vector.\nGet the angle between self and other.\nCreate a new Animate.\nRequest an animation frame.\nRequest an animation frame.\nRequest an animation frame.\nThe animation callback.\nWhether the paint should be anti-aliased.\nCreate a new BoxedView.\nCheck if any modifiers are held down.\nCreate a new Stack, with dynamic content.\nCreate a new Wrap, with dynamic content.\nCreate a new horizontal Stack, with dynamic content.\nCreate a new vertical Stack, with dynamic content.\nGet the area of the rectangle.\nGet a reference to the underlying Any object.\nGet a build context.\nGet a build context.\nGet a character from the key.\nConvert the font family to a fontdb::Family.\nGet a layout context.\nGet a rebuild context.\nGet the unique id as a u64.\nThe aspect ratio of the content.\nSet self.axis.\nSet self.axis.\nSet self.axis.\nThe axis of the scroll.\nThe axis of the slider.\nThe axis of the stack.\nThe axis.\nThe blue component of the color.\nGet the blue component as an 8 bit integer.\nCreate a new Container with background.\nSet self.background.\nSet self.background.\nSet self.background.\nSet self.background.\nThe background color.\nThe background color.\nThe style of Checkbox::background.\nThe background color of the header.\nThe style of Collapsing::background.\nThe background color.\nThe style of Container::background.\nThe background color of the slider.\nThe style of Slider::background.\nThe background color of the text.\nThe style of Tooltip::background.\nSet the callback for before an event is emitted.\nThe callback before an event is propagated.\nThe blend mode of the paint.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nThe border color.\nThe style of Button::border_color.\nThe border color.\nThe style of Checkbox::border_color.\nThe color of the border of the header.\nThe style of Collapsing::border_color.\nThe border color of the color picker.\nThe style of ColorPicker::border_color.\nThe border color.\nThe style of Container::border_color.\nThe border color of the slider.\nThe style of Slider::border_color.\nThe border color of the text.\nThe style of Tooltip::border_color.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nThe border radius.\nThe style of Button::border_radius.\nThe border radius.\nThe style of Checkbox::border_radius.\nThe border radius of the header.\nThe style of Collapsing::border_radius.\nThe border radius.\nThe style of Container::border_radius.\nThe radius of the scrollbar.\nThe style of Scroll::border_radius.\nThe border radius of the slider.\nThe style of Slider::border_radius.\nThe border radius of the text.\nThe style of Tooltip::border_radius.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nThe border width.\nThe style of Button::border_width.\nThe border width.\nThe style of Checkbox::border_width.\nThe border width of the header.\nThe style of Collapsing::border_width.\nThe border width of the color picker.\nThe style of ColorPicker::border_width.\nThe border width.\nThe style of Container::border_width.\nThe border width of the slider.\nThe style of Slider::border_width.\nThe border width of the text.\nThe style of Tooltip::border_width.\nCreate a new Aligned view that aligns its content to the …\nGet the bottom edge of the rectangle.\nThe bottom border width.\nThe bottom padding.\nGet the bottom center point of the rectangle.\nCreate a new Aligned view that aligns its content to the …\nGet the bottom left point of the rectangle.\nThe bottom left corner radius.\nCreate a new Aligned view that aligns its content to the …\nGet the bottom right point of the rectangle.\nThe bottom right corner radius.\nGet the bounds of the curve.\nGet the bounds of the text buffer.\nCalculates the size of a text buffer.\nBuild the sequence state.\nBuild the view state, see top-level documentation for more …\nCreate a new application builder.\nBuild the application.\nBuild the sequence state.\nCreate a new Button.\nSet self.button.\nThe button of the pointer.\nThe button of the pointer.\nThe button to listen for.\nThe callback.\nGet the canvas.\nThe cap of the stroke.\nCeil the point by element.\nCeil self by element.\nCeil the vector by element.\nCreate a new Aligned view that aligns its content to the …\nGet the center point of the rectangle.\nGet the left center point of the rectangle.\nGet the right center point of the rectangle.\nCreate a new rectangle with the given center point and …\nCreate a new Checkbox.\nSet self.checked.\nWhether the checkbox is checked.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a new Painter view that draws a circle.\nCreate a curve from a cicrle.\nClamp self to the range [min, max] by element.\nClamp the rectangle to the given rectangle.\nClamp self to the range [min, max] by element.\nClamp self to the range [min, max] by element.\nClear the canvas.\nClear the curve, retaining the allocated memory for reuse.\nWhether the button was clicked.\nGet the Clipboard.\nClose the contour.\nA window was requested to be closed.\nClose a window.\nEmit a command.\nSend a command.\nTry to get the command as a specific type.\nSpawn a future sending a command when it completes.\nSpawn a future sending a command when it completes.\nSend a command without waking the event loop.\nThe code of the key that was pressed.\nCreate a new Collapsing.\nMultiply the image with a color.\nSet the color of the window.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nThe color of the pattern.\nThe color of the window.\nThe color of the button.\nThe style of Button::color.\nThe color of the checkbox.\nThe style of Checkbox::color.\nThe color of the color picker.\nThe color of the scrollbar.\nThe style of Scroll::color.\nThe foreground color of the slider.\nThe style of Slider::color.\nThe color of the text.\nThe style of Text::color.\nThe color of the text.\nThe style of TextInput::color.\nThe color of text.\nThe style of Tooltip::color.\nCreate a new ColorPicker.\nSet self.column_gap.\nThe gap between each column.\nCreate a computed style.\nCheck if the transition is complete.\nCompute the id for this image data.\nDraw a conic curve to a point, with a control point control…\nCreate a new Constrained view, constraining its content to …\nGet the most constraning space between self and `other\nCompute the closest point in the rectangle to the given …\nCreate a new Container.\nCheck if the curve contains a point using the given rule.\nCompute whether the rectangle contains the given point.\nCheck if a context is contained.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nSet self.content.\nThe content.\nThe content.\nThe content.\nThe content view.\nThe content.\nThe content.\nThe content view.\nThe content to align.\nThe content.\nThe content.\nThe content.\nThe content.\nThe content to constrain.\nThe content.\nThe content of the view.\nThe content.\nThe content.\nThe content of the stack.\nThe content to display.\nThe content.\nThe content.\nThe content to overlay.\nGet a context.\nGet a mutable context.\nGet a context or insert a default.\nGet a reference to the Contexts.\nGet a mutable reference to the Contexts.\nThe contrast color.\nGet the length of the cross product of self and other.\nWhether the control key is held down.\nDraw a cubic bezier curve to a point, with control points a…\nGet the cursor of the view.\nThe glyph cache.\nThe danger color.\nCreate the default dark theme.\nDarken the color by the given amount.\nGet the pixels.\nGet the pixels mutably.\nConstructs an event at the debug level.\nSet whether the window is decorated.\nWhether the window is decorated.\nSet self.default_open.\nWhether the view is open by default.\nThe delay before the tooltip is displayed.\nThe style of Tooltip::delay.\nAdd a delegate to the application.\nThe delta of the pointer.\nThe delta of the pointer.\nDesaturates the color by given amount.\nSet self.descendants.\nWhether the item should be clickable when it’s …\nOnly include the annotated item on desktop platforms.\nCompute the determinant of the matrix.\nCompute the dot distance between two points.\nGet the dot product of self and other.\nDowngrade the image to a weak reference.\nDraw the view, see top-level documentation for more …\nRequest a draw of the view tree.\nRequest a draw of the view tree.\nRequest a draw of the view tree.\nSet self.draw.\nThe draw function.\nRasterize a buffer.\nDraw a canvas.\nDraw a canvas.\nDraw the nth view.\nDraw the nth view.\nDraw a single window, returning the scene if it needs to …\nThe duration of the transition.\nBuild the view.\nDraw the view.\nHandle an event.\nCalculate the layout.\nRebuild the view.\nCreate an ease transition with the given duration.\nCreate an ease transition with the given duration.\nThe easing curve.\nCreate a new Painter view that draws an ellipse.\nCreate a curve from an oval.\nConstructs an event at the error level.\nEvaluate the easing at t where 0 <= t <= 1.\nHandle an event.\nHandle an event, see top-level documentation for more …\nHandle an event for the entire application.\nSet self.event.\nThe event to listen for.\nHandle an event for the nth view.\nHandle an event for the nth view.\nCreate a new expanded Flexible view.\nExpand the space by size.\nExtend the styles with another collection of styles.\nFade the color by the given amount.\nSet the fallback view to display while the future is …\nSet self.fancy.\nThe distance of the fancy effect.\nThe style of Button::fancy.\nFill a curve.\nFill a curve.\nDraw a rectangle.\nGet the filter mode.\nIf self is finite, return self, otherwise return zero. …\nClamp a size to the space.\nSet the sizing to WindowSizing::Content.\nGet the flags of the view.\nCreate a new Flexible view.\nThe flex value of the view.\nFloor the point by element.\nFloor self by element.\nFloor the vector by element.\nCreate a new Focus.\nGet whether the view’s focused state changed.\nAdd a font to the application.\nThe font atlas.\nSet self.font_family.\nSet self.font_family.\nThe font family of the text.\nThe style of Text::font_family.\nThe font family of the text.\nThe style of TextInput::font_family.\nThe font family of the text.\nThe style of Tooltip::font_family.\nSet self.font_size.\nSet self.font_size.\nThe font size of the text.\nThe style of Text::font_size.\nThe font size of the text.\nThe style of TextInput::font_size.\nThe font size of the text.\nThe style of Tooltip::font_size.\nSet self.font_stretch.\nSet self.font_stretch.\nThe font stretch of the text.\nThe style of Text::font_stretch.\nThe font stretch of the text.\nThe style of TextInput::font_stretch.\nThe font stretch of the text.\nThe style of Tooltip::font_stretch.\nSet self.font_style.\nSet self.font_style.\nThe font.into of the text.\nThe style of Text::font_style.\nThe font.into of the text.\nThe style of TextInput::font_style.\nThe font style of the text.\nThe style of Tooltip::font_style.\nThe font system.\nSet self.font_weight.\nSet self.font_weight.\nThe font weight of the text.\nThe style of Text::font_weight.\nThe font weight of the text.\nThe style of TextInput::font_weight.\nThe font weight of the text.\nThe style of Tooltip::font_weight.\nGet the Fonts.\nGet the fractional component by element.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new matrix from an angle.\nCreate a new vector from an angle.\nCreate a new pointer id from a hashable value.\nConvert a Linux scancode to a key code.\nCreate a new text buffer from a raw buffer.\nCreate a new matrix from a scale.\nCreate a new space with the same minimum and maximum size.\nCreate a new pointer button from a u16.\nCreate a new pointer id from a u64.\nThe green component of the color.\nGet the green component as an 8 bit integer.\nSet self.gap.\nSet the gap for both the rows and columns.\nThe gap between children.\nGet the clipboard text.\nGet a style.\nGet the value, or a style from the styles.\nEvaluate the transition curve at t.\nGet a context.\nGet a mutable context.\nGet a style, or a default value.\nGet the value, or a style from the styles.\nGet a style, or a default value.\nGet the value, or a style from the styles.\nGet a pixel.\nGet the pointer with pointer_id.\nGet the pointer with pointer_id mutably.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet a window by id.\nGet a mutable window by id.\nCreate a new color with the given gray component.\nGet whether a child view was active last call.\nGet whether a child view was focused last call.\nGet whether a child view was hot last call.\nHandle all pending commands.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nWhether any of the views in the sequence are active.\nGet whether the view has an active child.\nGet whether a child view’s active state changed.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether the view has a focused child.\nGet whether a child view’s focused state changed.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether the view has a hot child.\nGet whether a child view’s hot state changed.\nHat the vector.\nThe header.\nCreate a new Constrained view, constraining its content to …\nGet the height of the image in pixels.\nGet the height of the rectangle.\nGet the height of the window.\nSet the minimum height.\nThe height.\nCreate a new color, with the given hex string.\nParse a color from a hex string.\nCreate a new horizontal Stack.\nCreate a new horizontal Wrap.\nCreate a new horizontal Wrap, with dynamic content.\nCreate a new horizontal Wrap, with a vector of content.\nGet whether the view’s hot state changed.\nDraw a hoverable layer.\nDraw a layer with a view.\nThe view the pointer is over.\nCreate a new horizontal Scroll.\nCreate a new color, with the given hue, saturation and …\nReturns a new color with the given hue, saturation, …\nCreate a new color, with the given hue, saturation, …\nReturns a new color with the given hue, saturation, …\nCreate a horizontal Stack.\nCreate a horizontal Stack.\nCreate a horizontal Stack, with dynamic content.\nCreate a horizontal Stack, with vector content.\nCreate a new color, with the given hue, saturation and …\nReturns a new color with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, value …\nReturns a new color with the given hue, saturation, value …\nCreate a horizontal Wrap.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap, with dynamic content.\nCreate a horizontal Wrap, with a vector of content.\nSet the icon of the window.\nThe icon of the window.\nSet self.icon_color.\nThe color of the icon.\nThe style of Collapsing::icon_color.\nSet self.icon_size.\nThe size of the icon.\nThe style of Collapsing::icon_size.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the ImageId.\nGet the id of the view.\nGet the unique identifier of the pointer.\nGet the unique identifier of the window.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe application is idle.\nCalled when the application is idle.\nThe image of the pattern.\nGet the IME of the view.\nExpand the rectangle to contain the given point.\nLoad a font from a file or directory.\nExpand the rectangle by the given amount.\nThe info color.\nConstructs an event at the info level.\nInitialize the application.\nCalled when the application is initialized.\nInsert a styled value.\nInsert a context.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a style key.\nInsert a style key.\nInsert a style.\nThe inset of the scrollbar.\nThe style of Scroll::inset.\nCompute the intersection of the rectangle with the given …\nCheck if the rectangle intersects the given rectangle.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCompute the inverse transformation.\nCompute the inverse of the matrix.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nCheck if the curve is closed.\nCheck if the event is a command of a specific type.\nCheck if the target platform is desktop.\nCheck if the curve is empty.\nWhether the sequence is empty.\nGet whether the stack is empty.\nGet whether the wrap is empty.\nCheck if the point is finite.\nGet whether the size is finite.\nGet whether the space is finite.\nGet whether the view is focusable.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether a specific view is hovered.\nCheck if the point is infinite.\nGet whether the size is infinite.\nGet whether the space is infinite.\nCheck if the key is pressed.\nCheck if the event represents a key press of a specific …\nCheck if the event represents a key release of a specific …\nCheck if the target platform is mobile.\nCheck if the point is NaN.\nGet whether button is held down on pointer with pointer_id.\nGet whether a button is pressed.\nWhether the view is tight.\nReturns true if the color is translucent.\nReturns true if the color is transparent.\nCheck if the curve is valid.\nCheck if a rect is visible.\nCheck if the target platform is web.\nGet an iterator over the curve segments.\nThe join of the stroke.\nSet self.justify.\nSet self.justify.\nHow to justify the content along the main axis.\nHow to justify the content along the main axis.\nSet self.justify_cross.\nHow to justify the content along the cross axis.\nCreate a style key.\nThe key that was pressed, ignoring modifiers.\nA keyboard key was pressed or released.\nThe color of the scrollbar knob.\nThe style of Scroll::knob_color.\nGet the last point in the curve.\nDraw a layer.\nLayout the view, see top-level documentation for more …\nRequest a layout of the view tree.\nRequest a layout of the view tree.\nRequest a layout of the view tree.\nLayout the items in a stack container.\nLayout the nth view.\nLayout the nth view.\nCreate a new Aligned view that aligns its content to the …\nGet the left edge of the rectangle.\nThe left border width.\nThe left padding.\nThe length of the sequence.\nGet the number of verbs in the curve.\nThe length of the sequence.\nGet the number of views in the stack.\nGet the number of views in the wrap.\nGet the length of the vector.\nSet self.length.\nThe length of the slider.\nThe style of Slider::length.\nGet the length of the vector squared.\nLinearly interpolate between two points.\nCreate the default light theme.\nBrighten the color by the given amount.\nSet self.lightness_color.\nThe color of the lightness slider.\nThe style of ColorPicker::lightness_color.\nSet self.line_height.\nSet self.line_height.\nThe line height of the text.\nThe style of Text::line_height.\nThe line height of the text.\nThe style of TextInput::line_height.\nThe line height of the text.\nThe style of Tooltip::line_height.\nDraw a line to a point.\nCreate a linear transition with the given duration.\nCreate a linear transition with the given duration.\nLoads a font from a FontSource.\nTransform a point from global space to local space.\nLoosen the space, setting the minimum size to zero.\nLoosen the height, setting the minimum height to zero.\nLoosen the width, setting the minimum width to zero.\nGet the luminocity.\nGet the major component of a pair.\nMark the view as animated.\nMark the view as drawn.\nMark the view as laid out.\nSet self.marker.\nSet self.mask.\nWhether to mask the content.\nThe style of Container::mask.\nDraw a layer with a mask.\nDraw a layer with a mask.\nThe matrix of the affine transformation.\nGet the max of self and other by element.\nGet the max of self and other by element.\nGet the max of self and other by element.\nThe maximum point of the rectangle.\nMaximum size the view can be.\nGet the maximum radius of the corners.\nGet the largest element of self.\nCreate a new Constrained view, constraining its content to …\nSet the maximum height.\nCreate a new Constrained view, constraining its content to …\nCreate a new rectangle with the given maximum point and …\nSet the maximum size.\nCreate a new Constrained view, constraining its content to …\nSet the maximum width.\nSet whether the window is maximized.\nWhether the window is maximized.\nCreate a new Memo.\nWhether the meta key is held down.\nGet the min of self and other by element.\nGet the min of self and other by element.\nGet the min of self and other by element.\nThe minimum point of the rectangle.\nMinimum size the view can be.\nGet the minimum radius of the corners.\nGet the smallest element of self.\nCreate a new Constrained view, constraining its content to …\nSet the minimum height.\nCreate a new Constrained view, constraining its content to …\nCreate a new rectangle with the given minimum point and …\nSet the minimum size.\nCreate a new Constrained view, constraining its content to …\nSet the minimum width.\nGet the minor component of a pair.\nThe miter limit of the stroke.\nLinearly interpolate between two colors.\nLinearly interpolate between two colors.\nOnly include the annotated item on mobile platforms.\nThe modifiers that were active.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers changed.\nModify the image data.\nMove a pointer, returning the movement.\nMove to a point.\nSet self.multiline.\nWhether the input is multi-line.\nPremultiply the image alpha.\nReturns the name of the cursor.\nGet whether the view needs an animation frame.\nGet whether the view needs to be drawn.\nGet whether the view needs to be laid out.\nCreate a new application builder.\nCreate a new clipboard from a backend.\nCreate a new base context.\nCreate a new build context.\nCreate a new draw context.\nCreate a new event context.\nCreate a new layout context.\nCreate a new rebuild context.\nCreate a new style.\nCreate a new Animate.\nCreate a new BuildHandler.\nCreate a new DrawHandler.\nCreate a new EventHandler.\nCreate a new Focus.\nCreate a new Memo.\nCreate a new opaque view.\nCreate a new RebuildHandler.\nCreate a new Suspense view.\nCreate a new Trigger.\nCreate a new WithState.\nCreate a new WithStyle view.\nCreate a new BorderRadius.\nCreate a new BorderWidth.\nCreate a new canvas.\nCreate a new curve.\nCreate a new CommandProxy channel.\nCreate a new image data.\nCreate a new image.\nCreate a new alignment.\nCreate a new matrix.\nCreate a new Padding.\nCreate a new point.\nCreate a new rectangle with the given minimum and maximum …\nCreate a new size.\nCreate a new space.\nCreate a new vector.\nCreate a new Styles.\nCreate a new text buffer.\nCreates a new font context.\nCreate a new pod view.\nCreate a new PodSeq.\nCreate a new ViewState with the given ViewId.\nCreate a new pointer.\nCreate a new WindowId.\nCreate a new Window.\nCreate a new aligned view.\nCreates a new Aspect view.\nCreate a new Button.\nCreate a new Checkbox.\nCreate a new Clickable.\nCreate a new Collapsing view.\nCreate a new ColorPicker.\nCreate a new constrained view.\nCreate a new Container.\nCreate a new flexible view.\nCreate a new Pad view.\nCreate a new Painter view.\nCreate a new scrollable view.\nCreate a new Slider.\nCreate a new Stack.\nCreate a new text.\nCreate a new text input view.\nCreate a new tooltip view.\nCreate a new Transform view.\nCreate a new Wrap.\nCreate a new overlay view.\nNormalize the vector.\nGet the offset of the padding.\nGet the offset of the rectangle.\nCreate a new color, with the given hue, saturation and …\nConvert a color from okhsl to sRGB.\nCreate a new color, with the given hue, saturation, …\nConvert a color from okhsl to sRGB.\nCreate a new color, with the given hue, saturation and …\nConvert a color from okhsv to sRGB.\nCreate a new color, with the given hue, saturation, value …\nConvert a color from okhsv to sRGB.\nCreate a new color, with the given lightness, a and b …\nConvert a color from oklab to sRGB.\nCreate a new color, with the given lightness, a, b and …\nConvert a color from oklab to sRGB.\nCreate a new color, with the given lightness, chroma and …\nConvert a color from oklch to sRGB.\nCreate a new color, with the given lightness, chroma, hue …\nConvert a color from oklch to sRGB.\nCreate a new BuildHandler.\nCreate a new Clickable, that calls on_click when clicked.\nCreate a new DrawHandler.\nSet the draw callback.\nThe draw callback.\nCreate a new EventHandler, with an after callback.\nCreate a new EventHandler, with a before callback.\nSet the on_input callback.\nSet the callback for when the value changes.\nSet the callback that is called when an input is received.\nThe on_input callback.\nThe callback for when the value changes.\nA callback that is called when an input is received.\nSet a callback for when the view is opened or closed.\nA callback for when the view is opened or closed.\nCreate a new Clickable, that calls on_press when pressed.\nCreate a new RebuildHandler.\nCreate a new Clickable, that calls on_release when …\nSet the callback that is called when the input is …\nA callback that is called when the input is submitted.\nA view that bridges the gap between impl View and …\nSet self.open.\nWhether the view is open.\nConvenience method to open a window with a view.\nAdd a window to the application.\nThe outline color.\nDraw an overlay, at index.\nDraw an overlay.\nPack a major and minor component into a pair.\nCreate a new Pad view.\nCreate a new Pad view adding padding to the bottom.\nCreate a new Pad view adding padding to the left.\nCreate a new Pad view adding padding to the right.\nCreate a new Pad view adding padding to the top.\nSet self.padding.\nThe padding.\nThe style of Button::padding.\nThe padding.\nThe padding of the text.\nThe style of Tooltip::padding.\nCreate a new Painter view.\nGet the size of the window in physical pixels.\nSet self.placeholder.\nPlaceholder text to display when the input is empty.\nSet self.placeholder_color.\nThe color of the placeholder text.\nThe style of TextInput::placeholder_color.\nCreate a new Pod view.\nA pointer button was pressed or released.\nA pointer left the window.\nA pointer moved.\nA pointer scrolled.\nGet the pointers in the window.\nGet the pointers in the window mutably.\nGet the points in the curve.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nPremultiply the image alpha, returning a new image.\nPrepare the view.\nPrepare a buffer for rendering.\nPrepare text for drawing.\nPrepare text for drawing.\nPress a button.\nPress a button on a pointer.\nThe primary color.\nGet the primitives of the canvas.\nPropagate the state of a child view.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the CommandProxy.\nConvert a from points to pixels.\nPush a view to the stack.\nPush a view to the wrap.\nPush an oval to the curve.\nPush a rectangle to the curve.\nPush the border of a rectangle with rounded corners to the …\nPush a rectangle with rounded corners to the curve.\nDraw a rectangle with rounded corners and a border.\nDraw a quadratic bezier curve to a point, with a control …\nQuit the application.\nThe red component of the color.\nGet the red component as an 8 bit integer.\nSet self.range.\nThe range of the slider.\nGet the raw buffer.\nGet the raw buffer mutably.\nRebuild the view.\nRebuild the sequence state.\nRebuild the view state, see top-level documentation for …\nRebuild all windows.\nRequest a rebuild of the view tree.\nRequest a rebuild of the view tree.\nRebuild the sequence state.\nRebuild the style of Button.\nRebuild the style of Checkbox.\nRebuild the style of Collapsing.\nRebuild the style of ColorPicker.\nRebuild the style of Container.\nRebuild the style of Scroll.\nRebuild the style of Slider.\nRebuild the style of Text.\nRebuild the style of TextInput.\nRebuild the style of Tooltip.\nThe callback for when a rebuild is requested.\nRebuild the nth view.\nRebuild the nth view.\nCreate a new Painter view that draws a rectangle.\nGet the rect of the view in local space.\nGet the rect of the view in local space.\nGet the rect of the view in local space.\nDraw a rectangle.\nCreate a curve from a rectangle.\nGet the rect of the text buffer.\nGet the rect of the view in local coordinates.\nRelease a button, returning whether the button was clicked.\nRelease a button on a pointer.\nRemove a context.\nRemove a pointer.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a window from the application.\nRequest an animation frame of the view tree.\nRequest a draw of the view tree.\nRequest a layout of the view tree.\nSet whether the window is resizable.\nWhether the window is resizable.\nCreate a new color, with the given red, green and blue …\nCreate a new color with the given red, green and blue …\nCreate a new color, with the given red, green, blue and …\nCreate a new color with the given red, green, blue and …\nCreate a new color with the given red, green, blue and …\nCreate a new Aligned view that aligns its content to the …\nGet the right edge of the rectangle.\nThe right border width.\nThe right padding.\nCreate a new Transform view that rotates its content.\nCreate a rotation.\nCreate a new Transform view that rotates its content in …\nDraw a layer with a rotation.\nDraw a layer with a rotation.\nRound the translation.\nRound the point by element.\nRound the rectangle’s minimum point down and its maximum …\nRound self by element.\nRound the vector by element.\nSet self.row_gap.\nThe gap between each row.\nSaturates the color by given amount.\nCreate a new Transform view that scales its content.\nCreate a scale.\nSet the scale of the window.\nThe scale of the window.\nDraw a layer with a scale.\nDraw a layer with a scale.\nThe secondary color.\nSet the clipboard text.\nSet whether the view is active.\nSet whether the view is active.\nSet whether the view is active.\nSet whether the view is active.\nSet the align of the text buffer.\nSet the bounds of the text buffer.\nSet the cursor of the view.\nSet the cursor of the view.\nSet the cursor of the view.\nSet the cursor of the view.\nSet the filter mode.\nSet whether the view is focusable.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is hot.\nSet whether the view is hot.\nSet whether the view is hot.\nSet whether the view is hot.\nSet the ime of the view.\nSet the IME of the view.\nSet the metrics of the text buffer.\nSet a pixel.\nSet the size of the view.\nSet the text of the text buffer.\nSet the transform of the view.\nSet the wrapping mode of the text buffer.\nThe shader of the paint.\nWhether the shift key is held down.\nShrink the rectangle by the given amount.\nShrink the space by size.\nGet the absolute value of the vector.\nCreate a new Constrained view, cosntraining its content to …\nGet the size of the view.\nGet the size of the view.\nGet the size of the view.\nGet the size of the image in pixels.\nGet the size of the padding.\nGet the size of the rectangle.\nGet the size of the text buffer.\nGet the size of the view.\nSet the size of the window.\nSet self.size.\nSet self.size.\nSet self.size.\nThe size of the window.\nThe size of the checkbox.\nThe style of Checkbox::size.\nThe size of the color picker.\nThe style of ColorPicker::size.\nThe size of the view.\nSet the sizing of the window.\nThe sizing of the window.\nCreate a new Slider.\nSet self.slider_width.\nThe width of the sliders.\nThe style of ColorPicker::slider_width.\nGet the WindowSnapshot of the window.\nThe space to constrain the content to.\nSpawn a future.\nSpawn a future that is polled when commands are handled.\nStep the transition.\nStroke a curve.\nStroke a curve.\nSet self.stroke.\nThe stroke width of the checkbox.\nThe style of Checkbox::stroke.\nStroke the curve with the given stroke.\nStyleing and theming.\nAdd a style to the application.\nThe style to apply.\nCreate a collection of styles.\nThe style of Button.\nThe style of Checkbox.\nThe style of Collapsing.\nThe style of ColorPicker.\nThe style of Container.\nThe style of Scroll.\nThe style of Slider.\nThe style of Text.\nThe style of TextInput.\nThe style of Tooltip.\nGet the styles.\nGet the styles.\nGet the styles.\nGet the styles.\nGet the styles.\nThe success color.\nThe surface color.\nCreate a new Suspense view.\nThe swash cache.\nTake all pending requests.\nCreate a new Text.\nDraw a text buffer.\nSet self.text.\nSet the text of the input.\nThe text that was entered.\nThe text.\nThe text.\nThe text to display.\nCreate a formatted Text.\nCreate a new TextInput.\nDraw a raw text buffer.\nAdd a theme to the application.\nWhether the view is tight.\nSet the title of the window.\nThe title of the window.\nConvert the text align to a cosmic_text::Align.\nConvert the text wrap to a cosmic_text::Wrap.\nConvert the font weight to a fontdb::Weight.\nConvert the font stretch to a fontdb::Stretch.\nConvert the font style to a fontdb::Style.\nConvert the color to hex.\nConvert the color to a hue, saturation, lightness tuple.\nConvert the color to a hue, saturation, lightness and …\nConvert the color to a hue, saturation, value tuple.\nConvert the color to a hue, saturation, value and alpha …\nConvert a color from sRGB to okhsl.\nConvert a color from sRGB to okhsl.\nConvert a color from sRGB to okhsv.\nConvert a color from sRGB to okhsv.\nConvert a color from sRGB to oklab.\nConvert a color from sRGB to oklab.\nConvert a color from sRGB to oklch.\nConvert a color from sRGB to oklch.\nConvert the size to a vector.\nConvert the vector to a vector.\nConvert the color to linear sRGB.\nConvert the point to a size.\nConvert the vector to a size.\nConvert the color to linear sRGB.\nConvert the point to a vector.\nConvert the size to a vector.\nCreate a new Tooltip view.\nCreate a new Aligned view that aligns its content to the …\nGet the top edge of the rectangle.\nThe top border width.\nThe top padding.\nGet the top center point of the rectangle.\nCreate a new Aligned view that aligns its content to the …\nGet the top left point of the rectangle.\nThe top left corner radius.\nCreate a new Aligned view that aligns its content to the …\nGet the top right point of the rectangle.\nThe top right corner radius.\nConstructs an event at the trace level.\nCreate a new Transform view.\nGet the transform of the view.\nGet the transform of the view.\nTransform the curve by the given affine transform.\nTransform the rectangle by the given affine transform.\nGet the transform of the view.\nThe transformation of the pattern.\nThe transform.\nDraw a layer with a transform.\nDraw a layer with a transformation.\nAnimate a transition.\nSet self.transition.\nSet self.transition.\nSet self.transition.\nThe transition of the button.\nThe style of Button::transition.\nThe transition of the checkbox.\nThe style of Checkbox::transition.\nThe transition of the view.\nThe style of Collapsing::transition.\nThe transition of the scrollbar.\nThe style of Scroll::transition.\nAnimate a view when active changes.\nAnimate a view when focused changes.\nAnimate a view when hot changes.\nCreate a new Transform view that translates its content.\nCrate a translation.\nTranslate the transform of the view.\nDraw a layer with a translation.\nDraw a layer with a translation.\nThe translation of the affine transformation.\nCreate a new Trigger view.\nDraw a trigger rectangle.\nDraw a trigger rectangle.\nTry to parse a color from a hex string.\nCompute the intersection of the rectangle with the given …\nCreate a new constrained view, with no bounds.\nCompute the union of the rectangle with the given …")
\ No newline at end of file
+searchState.loadedDescShard("ori", 0, "Ori\nOri app module.\nOri core module.\nOri log module.\nA macro to generate boilerplate for the main function.\nConvenient imports for Ori.\nA macro to generate boilerplate for a hot-reloadable …\nThe main application state.\nA builder for an App.\nCommands that can be sent to the application.\nA delegate for handling events in an application.\nRequests that an application can make to the platform.\nClose a window.\nClose a window.\nThe data type of the returned view.\nThe context passed to the [Delegate] trait.\nDrag a window.\nDrag a window.\nTrait for converting a type into a UiBuilder.\nOpen a new window.\nOpen a new window.\nQuit the application.\nQuit the application.\nRedraw a window.\nA builder for a user interface.\nUpdate a window.\nInformation needed to render a window.\nThe canvas to render.\nThe clear color of the window.\nHandle an event.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCalled when the application is idle.\nCalled when the application is initialized.\nCalls U::from(self).\nCalls U::from(self).\nConvert a type into it’s requisite UiBuilder.\nThe size of the window.\nCanvas module.\nClipboard.\nA channel for sending commands to the user interface.\nContexts for views.\nEvents and event handling.\nCreate a formatted Text.\nCreate a horizontal Stack.\nCreate a horizontal Wrap.\nImage data and processing.\nLayout of Views.\nRebuild trait and derive macro.\nStyleing and theming.\nCreate a collection of styles.\nText rendering and layouting.\nTransition utilities.\nView module.\nThe builtin views in Ori.\nCreate a vertical Stack.\nCreate a vertical Wrap.\nWindowing system abstraction layer.\nCreate a new ZStack view.\nWays to anti-alias a shape.\nThe strokes are joined with a beveled corner.\nWays to blend two colors.\nRadi of the corners on a rounded rectangle.\nThe border width of a rounded rectangle.\nThe end of the stoke is squared off.\nA canvas that can be drawn on.\nReplaces the destination with zero.\nA close verb.\nClose the curve.\nA color with red, green, blue and alpha components.\nA cubic verb.\nCubic bezier curve to a point.\nA bezier curve.\nAn iterator over the segments of a curve.\nA segment of a curve.\nA verb that describes the type of curve.\nPreserves the destination.\nDestination over source.\nA type for displaying a color as a hex string.\nA point is inside the shape if a ray from the point …\nFast anti-aliasing.\nA filled curve.\nRule determining if a point is inside a shape.\nAnti-aliasing.\nA layer that can be transformed and masked.\nA line verb.\nLine to a point.\nA mask that can be used to clip a layer.\nThe strokes are joined with a sharp corner.\nA move verb.\nMove to a point.\nA point is inside the shape if a ray from the point …\nNo anti-aliasing.\nA paint that can be used to fill or stroke a shape.\nA pattern that can be used to fill a shape.\nA pattern.\nA primitive that can be drawn on a canvas.\nA quad verb.\nQuadratic bezier curve to a point.\nThe end of the stroke is rounded.\nThe strokes are joined with a rounded corner.\nWays to fill a shape.\nA solid color.\nReplaces the destination with the source.\nSource over destination.\nThe end of the stroke is squared off and extends past the …\nProperties of a stroke.\nA stroked curve.\nWays to draw the end of a stroke.\nWays to join two segments of a stroke.\nThe alpha component of the color.\nWhether the paint should be anti-aliased.\nConvert the hex color display to a &str.\nConvert the hex color display to a &str.\nThe blue component of the color.\nThe blend mode of the paint.\nThe bottom border width.\nThe bottom left corner radius.\nThe bottom right corner radius.\nThe cap of the stroke.\nThe color of the pattern.\nCount the number of primitives.\nThe curve of the mask.\nThe fill rule of the mask.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nThe green component of the color.\nCreate a new color, with the given hex string.\nCreate a new color, with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, …\nCreate a new color, with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, value …\nThe image of the pattern.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nThe join of the stroke.\nThe left border width.\nThe miter limit of the stroke.\nCreate a new mask.\nCreate a new hex color display with the given red, green, …\nCreate a new color, with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, …\nCreate a new color, with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, value …\nCreate a new color, with the given lightness, a and b …\nCreate a new color, with the given lightness, a, b and …\nCreate a new color, with the given lightness, chroma and …\nCreate a new color, with the given lightness, chroma, hue …\nGet the number of points for the verb.\nThe red component of the color.\nCreate a new color, with the given red, green and blue …\nCreate a new color, with the given red, green, blue and …\nThe right border width.\nThe shader of the paint.\nThe top border width.\nThe top left corner radius.\nThe top right corner radius.\nThe transformation of the pattern.\nThe width of the stroke.\nThe curve to draw.\nThe curve to draw.\nThe fill rule of the curve.\nThe mask of the layer.\nThe paint to fill the curve with.\nThe paint to stroke the curve with.\nThe primitives of the layer.\nThe stroke properties of the curve.\nThe transformation of the layer.\nThe view of the layer.\nA clipboard.\nA clipboard backend.\nGet the clipboard text.\nSet the clipboard text.\nA command containing arbitrary data.\nA clonable channel for sending Commands.\nA receiver for Commands.\nA waker for the event loop, triggered when a command is …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nTry to downcast the command to T.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck whether the command is of type T.\nGet the name of the command.\nCreate a new command.\nCreate a new CommandWaker.\nConvert the command into a boxed Any value.\nTry receive a command.\nWake the event loop.\nA base context that is shared between all other contexts.\nA context for building the view tree.\nA context for a view.\nA context for drawing the view tree.\nA context for handling events.\nA context for laying out the view tree.\nA context for rebuilding the view tree.\nCheck if the context is present.\nReturns the argument unchanged.\nGet a context.\nGet a mutable context.\nGet a context or insert a default.\nPush a context.\nCalls U::from(self).\nCheck if there are no contexts.\nGet the number of contexts.\nCreate a new context.\nPop a context.\nAn animation frame has passed.\nThe back button.\nEvent emitted when a window wants to close.\nThe window requested to be close.\nA keyboard key-code.\nA command was sent.\nAn event that can be sent to a view.\nThe forward button.\nInput Method Editor (IME) state.\nA trait for checking if something is a certain key.\nA keyboard key.\nAn event fired when a key is pressed.\nA keyboard key was pressed.\nAn event fired when a key is released.\nA keyboard key was released.\nModifiers for keyboard and pointer events.\nOther buttons.\nA pointer button.\nA unique pointer id.\nA pointer left the window.\nA pointer left the window.\nA pointer was moved.\nA pointer moved.\nA pointer button was pressed.\nA pointer button was pressed.\nA pointer button was released.\nA pointer button was released.\nA pointer wheel was scrolled.\nA pointer was scrolled.\nThe primary button, usually the left mouse button or the …\nThe secondary button, usually the right mouse button.\nThe tertiary button, usually the middle mouse button.\nView state needs to be updated.\nEvent emitted when a window is maximized.\nThe window was maximized.\nEvent emitted when a window is resized.\nThe window was resized.\nEvent emitted when a window is scaled.\nThe window was scaled.\nWhether the alt key is held down.\nThe button of the pointer.\nThe button of the pointer.\nWhether the button was clicked.\nThe code of the key that was pressed.\nThe code of the key that was released.\nThe current composition range.\nWhether the control key is held down.\nThe delta of the pointer.\nThe delta of the pointer.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nThe new height of the window.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck if the key is the given key.\nCheck if the key is released.\nThe key that was pressed, ignoring modifiers.\nThe key that was released, ignoring modifiers.\nWhether the window is maximized or not.\nWhether the meta key is held down.\nThe modifiers that were active.\nThe modifiers that were active.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe new scale factor of the window.\nThe current selection range.\nWhether the shift key is held down.\nGet the new size of the window.\nThe current text being edited.\nThe text that was entered.\nThe new width of the window.\nThe window that wants to close.\nThe window that was resized.\nThe window that was scaled.\nThe window that was maximized.\nA texture managed by the rendering backend.\nAn clonable image.\nAn Image texture.\nImage data.\nA unique identifier for an Image.\nA texture.\nAn opaque backend texture identifier.\nA weak reference to an Image.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new TextureId from an index.\nGet the ImageId.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCreate a new TextureId.\nGet the number of strong references to the image.\nConvert the TextureId to an index.\nGet the number of weak references to the image.\nAn affine transformation in 2 dimensional space.\nThe alignment of items along the cross axis.\nAlignment of content inside a container.\nAn axis is a direction in which a layout is applied.\nItems are packed toward the center of the stack.\nItems are packed toward the center of the stack.\nItems are packed toward the end of the stack.\nItems are packed toward the end of the stack.\nA constant used to indicate that a dimension should fill …\nItems are stretched to fill the available space.\nThe horizontal axis.\nThe justify content of a stack container.\nAn iterator over the positions of items in a stack …\nA 2x2 matrix.\nA padding of a rectangle.\nA point in 2D space.\nA rectangle defined by its minimum and maximum points.\nA 2 dimensional size.\nSpace available to lay out a view.\nItems are evenly distributed in the stack, with half-size …\nItems are evenly distributed in the stack, with equal-size …\nItems are evenly distributed in the stack.\nItems are packed toward the start of the stack.\nItems are packed toward the start of the stack.\nItems are stretched to all have the same size.\nA 2D vector.\nThe vertical axis.\nThe bottom padding.\nReturns the argument unchanged.\nThe height.\nCalls U::from(self).\nThe left padding.\nThe matrix of the affine transformation.\nThe maximum point of the rectangle.\nMaximum size the view can be.\nThe minimum point of the rectangle.\nMinimum size the view can be.\nConvert a from points to pixels.\nThe right padding.\nThe top padding.\nThe translation of the affine transformation.\nThe width.\nThe horizontal alignment.\nThe x axis of the matrix.\nThe x coordinate.\nThe x coordinate.\nThe vertical alignment.\nThe y axis of the matrix.\nThe y coordinate.\nThe y coordinate.\nTrait implemented by callsites.\nDispatch trace data to a Subscriber.\nEvents represent single points in time where something …\nIdentifies a span within the context of a subscriber.\nAttaches spans to a std::future::Future.\nDescribes the level of verbosity of a span or event.\nMetadata describing a span or event.\nA handle representing a span, with the capability to enter …\nTrait representing the functions required to collect trace …\nA field value of an erased type.\nCallsites represent the source locations from which spans …\nNotifies the subscriber that a span ID has been cloned.\nReturns a type representing this subscriber’s view of …\nConstructs an event at the debug level.\nConstructs a span at the debug level.\nDispatches trace events to Subscribers.\nIf self is the same type as the provided TypeId, returns …\nThis method is deprecated.\nReturns true if a span or event with the specified metadata…\nChecks whether a span or event is enabled based on the …\nRecords that a span has been entered.\nConstructs an event at the error level.\nConstructs a span at the error level.\nEvents represent single points in time during the …\nRecords that an Event has occurred.\nConstructs a new Event.\nDetermine if an Event should be recorded.\nTests whether an event with the specified level and target …\nRecords that a span has been exited.\nSpan and Event key-value data.\nInstruments this type with the current Span, returning an …\nConstructs an event at the info level.\nConstructs a span at the info level.\nAttach a span to a std::future::Future.\nInstruments this type with the provided Span, returning an …\nInstruments a function to create and enter a tracing span …\nTrace verbosity level filtering.\nReturns the highest verbosity level that this Subscriber …\nMetadata describing trace data.\nReturns the metadata associated with the callsite.\nStatically constructs new span metadata.\nVisit the construction of a new span, returning a new span …\nInvoked when this subscriber becomes a Dispatch.\nVisits this value with the given Visitor.\nRecord a set of values on a span.\nAdds an indication that span follows from the span with …\nRegisters a new callsite with this subscriber, returning …\nSets the Interest for this callsite.\nSpans represent periods of time in which a program was …\nConstructs a new span.\nTests whether a span with the specified level and target …\nCollects and records trace data.\nConstructs an event at the trace level.\nConstructs a span at the trace level.\nNotifies the subscriber that a span ID has been dropped, …\nConstructs an event at the warn level.\nConstructs a span at the warn level.\nTrait implemented by callsites.\nA default Callsite implementation.\nUniquely identifies a Callsite\nReturns the metadata associated with the callsite.\nClear and reregister interest on every Callsite\nRegister a new Callsite with the global registry.\nSets the Interest for this callsite.\nA guard that resets the current default dispatcher to the …\nDispatch trace data to a Subscriber.\nReturned if setting the global dispatcher fails.\nWeakDispatch is a version of Dispatch that holds a …\nExecutes a closure with a reference to this thread’s …\nSets the dispatch as the default dispatch for the duration …\nSets this dispatch as the global default for the duration …\nSets this dispatch as the default for the duration of a …\nEvents represent single points in time where something …\nTrait implemented to allow a type to be used as a field …\nA Value which serializes as a string using fmt::Debug.\nA Value which serializes using fmt::Display.\nAn empty field.\nAn opaque key allowing O(1) access to a field in a Span’…\nDescribes the fields present on a span.\nAn iterator over a set of fields.\nA field value of an erased type.\nA set of fields and values for a span.\nVisits typed values.\nAttempts to convert &self into a Field with the specified …\nWraps a type implementing fmt::Debug as a Value that can be\nWraps a type implementing fmt::Display as a Value that can …\nVisits this value with the given Visitor.\nVisit a boolean value.\nVisit a value implementing fmt::Debug.\nRecords a type implementing Error.\nVisit a double-precision floating point value.\nVisit a signed 128-bit integer value.\nVisit a signed 64-bit integer value.\nVisit a string value.\nVisit an unsigned 128-bit integer value.\nVisit an unsigned 64-bit integer value.\nAttaches spans to a std::future::Future.\nA Future that has been instrumented with a tracing Span.\nA Future that has been instrumented with a tracing …\nExtension trait allowing futures to be instrumented with a …\nInstruments this type with the current Span, returning an …\nInstruments this type with the provided Span, returning an …\nAttaches the current default Subscriber to this type, …\nAttaches the provided Subscriber to this type, returning a …\nA filter comparable to a verbosity Level.\nIndicates that a string could not be parsed to a valid …\nThe statically configured maximum trace level.\nIndicates whether the callsite is a span or event.\nDescribes the level of verbosity of a span or event.\nA filter comparable to a verbosity Level.\nMetadata describing a span or event.\nReturned if parsing a Level fails.\nIndicates that a string could not be parsed to a valid …\nTrait implemented by types which have a span Id.\nAttributes provided to a Subscriber describing a new span …\nA guard representing a span which has been entered and is …\nAn owned version of Entered, a guard representing a span …\nIdentifies a span within the context of a subscriber.\nA set of fields recorded by a span.\nA handle representing a span, with the capability to enter …\nReturns the Id of the span that self corresponds to, or …\nA guard that resets the current default dispatcher to the …\nIndicates a Subscriber’s interest in a particular …\nA no-op Subscriber.\nReturned if setting the global dispatcher fails.\nTrait representing the functions required to collect trace …\nNotifies the subscriber that a span ID has been cloned.\nReturns a type representing this subscriber’s view of …\nIf self is the same type as the provided TypeId, returns …\nThis method is deprecated.\nReturns true if a span or event with the specified metadata…\nRecords that a span has been entered.\nRecords that an Event has occurred.\nDetermine if an Event should be recorded.\nRecords that a span has been exited.\nReturns the highest verbosity level that this Subscriber …\nVisit the construction of a new span, returning a new span …\nInvoked when this subscriber becomes a Dispatch.\nRecord a set of values on a span.\nAdds an indication that span follows from the span with …\nRegisters a new callsite with this subscriber, returning …\nSets the Subscriber as the default for the current thread …\nSets this subscriber as the global default for the …\nNotifies the subscriber that a span ID has been dropped, …\nSets this Subscriber as the default for the current thread …\nA convenience trait for rebuilding a View.\nDerive the Rebuild trait.\nRebuild the view.\nA derived style.\nA style.\nA style key.\nA styled value.\nA collection of styles.\nA theme.\nA value.\nThe accent color.\nThe background color.\nCreate a computed style.\nThe contrast color.\nThe danger color.\nThe info color.\nCreate a style key.\nThe outline color.\nThe primary color.\nThe secondary color.\nThe success color.\nThe surface color.\nCreate a style value.\nThe warning color.\nA glyph in the font atlas.\nA collection of fonts.\nAlign text in the center.\nCondensed font stretch.\nA cursive font family.\nA font loaded from data.\nAlign text at the end.\nExpanded font stretch.\nExtra-condensed font stretch.\nExtra-expanded font stretch.\nA fantasy font family.\nA font atlas.\nA font family, by default FontFamily::SansSerif.\nA source for a font.\nA font stretch.\nA font style.\nA font weight.\nA context for loading and rasterizing fonts.\nItalic font style.\nA monospace font family.\nA font family by name, e.g. “Arial”.\nDo not wrap text.\nNormal font stretch, the default.\nNormal font style, the default.\nOblique font style.\nA font loaded from a file.\nA sans-serif font family.\nSemi-condensed font stretch.\nSemi-expanded font stretch.\nA serif font family.\nAlign text at the start.\nAlignment of a section of text.\nAttributes of a section of text.\nA convenient wrapper around a cosmic_text::Buffer.\nWrapping of a section of text.\nUltra-condensed font stretch.\nUltra-expanded font stretch.\nWrap text at the word boundary.\nThe glyph cache.\nThe font family of the text.\nThe font atlas.\nThe font system.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nGet the image of the atlas.\nLoad a font from a file or directory.\nInsert a physical glyph into the atlas.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nThe layout rect of the glyph.\nCreate a new font atlas with the given size.\nThe font size of the text.\nThe font style of the text.\nThe swash cache.\nConvert the text attributes to a cosmic_text::Attrs.\nThe uv coordinates of the glyph in the atlas.\nThe font weight of the text.\nAn ease transition curve.\nA transition easing curve.\nA linear transition curve.\nA transition.\nThe duration of the transition.\nCreate an ease transition with the given duration.\nThe easing curve.\nCreate a linear transition with the given duration.\nThe view is active.\nThe view needs an animation frame.\nThe state of a BoxedView.\nA view that supports dynamic dispatch.\nA boxed dynamic view.\nThe view needs to be drawn.\nThe view is focusable.\nThe view is focused.\nEquivalent to …\nThe view has an active child.\nThe view has a focused child.\nThe view has a hot child.\nThe view is hot.\nEquivalent to Self::HOT | Self::FOCUSED | Self::ACTIVE.\nThe view needs to be laid out.\nA view that has separate ViewState from its content.\nContents of a view, in a sequence.\nThe state of a PodSeq.\nThe state of a Pod.\nThe state of the sequence.\nThe state of the view, see top-level documentation for …\nFlags that indicate what needs to be updated.\nA single UI component.\nFlags that indicate state of a view.\nAn opaque unique identifier for a view.\nA sequence of views.\nState associated with a View.\nGet a flags value with all known bits set.\nGet a flags value with all known bits set.\nCreate a new BoxedView.\nGet a reference to the underlying Any object.\nGet the underlying id as a u64.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nGet the underlying bits value.\nGet the underlying bits value.\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nBuild the sequence state.\nBuild the view state, see top-level documentation for more …\nThe bitwise negation (!) of the bits in a flags value, …\nThe bitwise negation (!) of the bits in a flags value, …\nWhether all set bits in a source flags value are also set …\nWhether all set bits in a source flags value are also set …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nDraw the view, see top-level documentation for more …\nDraw the nth view.\nBuild the view.\nDraw the view.\nHandle an event.\nCalculate the layout.\nRebuild the view.\nGet a flags value with all bits unset.\nGet a flags value with all bits unset.\nHandle an event, see top-level documentation for more …\nHandle an event for the nth view.\nThe bitwise or (|) of the bits in each flags value.\nThe bitwise or (|) of the bits in each flags value.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nConvert from a bits value.\nConvert from a bits value.\nConvert from a bits value exactly.\nConvert from a bits value exactly.\nConvert from a bits value, unsetting any unknown bits.\nConvert from a bits value, unsetting any unknown bits.\nThe bitwise or (|) of the bits in each flags value.\nThe bitwise or (|) of the bits in each flags value.\nGet a flags value with the bits of a flag with the given …\nGet a flags value with the bits of a flag with the given …\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nWhether any set bits in a source flags value are also set …\nWhether any set bits in a source flags value are also set …\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nWhether all known bits in this flags value are set.\nWhether all known bits in this flags value are set.\nWhether all bits in this flags value are unset.\nWhether all bits in this flags value are unset.\nYield a set of contained flags values.\nYield a set of contained flags values.\nYield a set of contained named flags values.\nYield a set of contained named flags values.\nLayout the view, see top-level documentation for more …\nLayout the nth view.\nThe length of the sequence.\nCreate a new ViewId.\nThe bitwise negation (!) of the bits in a flags value, …\nThe bitwise negation (!) of the bits in a flags value, …\nCreate a new Pod view.\nRebuild the sequence state.\nRebuild the view state, see top-level documentation for …\nRebuild the nth view.\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nCall insert when value is true or remove when value is …\nCall insert when value is true or remove when value is …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nA view that aligns its content.\nA view that animates.\nA view that lays out its content with a fixed aspect ratio.\nA view that hooks into the build cycle.\nA button.\nThe derived style for Button.\nA checkbox.\nThe derived style for Checkbox.\nThe click event.\nA click event.\nA click handler.\nA collapsing view.\nThe derived style for Collapsing.\nA color picker.\nThe derived style for ColorPicker.\nA view that constrains its content to a given space.\nA container view.\nThe derived style for Container.\nA view that hooks into the draw cycle.\nA view that handles events.\nThe flex value of a view.\nA flexible view.\nA view that focuses on a part of the data.\nA lens used by Focus.\nA view that only builds the inner view when certain data …\nA view that bridges the gap between impl View and …\nA view that adds padding to its content.\nA view that draws something.\nThe press event.\nA view that handles rebuilds.\nThe release event.\nA scrollable view.\nThe derived style for Scroll.\nA slider.\nThe derived style for Slider.\nA view that stacks it’s content in a line.\nA view that suspends rendering while a future is pending.\nA view that displays text.\nA text input.\nThe derived style for TextInput.\nThe derived style for Text.\nA view that displays some text when the content is hovered.\nThe derived style for Tooltip.\nA view that transforms its content.\nA view that creates a trigger around the content.\nA view that stores some additional data.\nA view that applies a style to its content.\nA view that lays out it’s content in a line wrapping if …\nA view that overlays its content on top of each other.\nThe build callback.\nThe callback after an event is propagated.\nCreate a new Aligned view.\nHow to align the content along the cross axis, within each …\nThe horizontal alignment of the text.\nThe style of Text::align.\nThe vertical alignment of the text.\nThe style of TextInput::align.\nThe horizontal alignment of the text.\nThe style of Tooltip::align.\nHow to align the content along the cross axis.\nThe alignment.\nThe color of the alpha slider.\nThe style of ColorPicker::alpha_color.\nThe flex value.\nCreate a new Animate.\nThe animation callback.\nThe aspect ratio of the content.\nThe axis of the scroll.\nThe axis of the slider.\nThe axis of the stack.\nThe axis.\nCreate a new Container with background.\nThe background color.\nThe style of Checkbox::background.\nThe background color of the header.\nThe style of Collapsing::background.\nThe background color.\nThe style of Container::background.\nThe background color of the slider.\nThe style of Slider::background.\nThe background color of the text.\nThe style of Tooltip::background.\nThe callback before an event is propagated.\nThe border color.\nThe style of Button::border_color.\nThe border color.\nThe style of Checkbox::border_color.\nThe color of the border of the header.\nThe style of Collapsing::border_color.\nThe border color of the color picker.\nThe style of ColorPicker::border_color.\nThe border color.\nThe style of Container::border_color.\nThe border color of the slider.\nThe style of Slider::border_color.\nThe border color of the text.\nThe style of Tooltip::border_color.\nThe border radius.\nThe style of Button::border_radius.\nThe border radius.\nThe style of Checkbox::border_radius.\nThe border radius of the header.\nThe style of Collapsing::border_radius.\nThe border radius.\nThe style of Container::border_radius.\nThe radius of the scrollbar.\nThe style of Scroll::border_radius.\nThe border radius of the slider.\nThe style of Slider::border_radius.\nThe border radius of the text.\nThe style of Tooltip::border_radius.\nThe border width.\nThe style of Button::border_width.\nThe border width.\nThe style of Checkbox::border_width.\nThe border width of the header.\nThe style of Collapsing::border_width.\nThe border width of the color picker.\nThe style of ColorPicker::border_width.\nThe border width.\nThe style of Container::border_width.\nThe border width of the slider.\nThe style of Slider::border_width.\nThe border width of the text.\nThe style of Tooltip::border_width.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Button.\nThe button to listen for.\nThe callback.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Checkbox.\nWhether the checkbox is checked.\nCreate a new Painter view that draws a circle.\nCreate a new Collapsing.\nThe color of the button.\nThe style of Button::color.\nThe color of the checkbox.\nThe style of Checkbox::color.\nThe color of the color picker.\nThe color of the scrollbar.\nThe style of Scroll::color.\nThe foreground color of the slider.\nThe style of Slider::color.\nThe color of the text.\nThe style of Text::color.\nThe color of the text.\nThe style of TextInput::color.\nThe color of text.\nThe style of Tooltip::color.\nCreate a new ColorPicker.\nThe gap between each column.\nCreate a new Constrained view, constraining its content to …\nCreate a new Container.\nThe content.\nThe content.\nThe content.\nThe content view.\nThe content.\nThe content.\nThe content view.\nThe content to align.\nThe content.\nThe content.\nThe content.\nThe content.\nThe content to constrain.\nThe content.\nThe content of the view.\nThe content.\nThe content.\nThe content of the stack.\nThe content to display.\nThe content.\nThe content.\nThe content to overlay.\nWhether the view is open by default.\nThe delay before the tooltip is displayed.\nThe style of Tooltip::delay.\nWhether the item should be clickable when it’s …\nThe draw function.\nCreate a new Painter view that draws an ellipse.\nThe event to listen for.\nCreate a new expanded Flexible view.\nThe distance of the fancy effect.\nThe style of Button::fancy.\nCreate a new Flexible view.\nThe flex value of the view.\nCreate a new Focus.\nThe font family of the text.\nThe style of Text::font_family.\nThe font family of the text.\nThe style of TextInput::font_family.\nThe font family of the text.\nThe style of Tooltip::font_family.\nThe font size of the text.\nThe style of Text::font_size.\nThe font size of the text.\nThe style of TextInput::font_size.\nThe font size of the text.\nThe style of Tooltip::font_size.\nThe font stretch of the text.\nThe style of Text::font_stretch.\nThe font stretch of the text.\nThe style of TextInput::font_stretch.\nThe font stretch of the text.\nThe style of Tooltip::font_stretch.\nThe font.into of the text.\nThe style of Text::font_style.\nThe font.into of the text.\nThe style of TextInput::font_style.\nThe font style of the text.\nThe style of Tooltip::font_style.\nThe font weight of the text.\nThe style of Text::font_weight.\nThe font weight of the text.\nThe style of TextInput::font_weight.\nThe font weight of the text.\nThe style of Tooltip::font_weight.\nThe gap between children.\nThe header.\nCreate a new Constrained view, constraining its content to …\nCreate a new horizontal Scroll.\nCreate a horizontal Stack.\nCreate a horizontal Stack.\nCreate a horizontal Stack, with dynamic content.\nCreate a horizontal Stack, with vector content.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap, with dynamic content.\nCreate a horizontal Wrap, with a vector of content.\nThe color of the icon.\nThe style of Collapsing::icon_color.\nThe size of the icon.\nThe style of Collapsing::icon_size.\nThe inset of the scrollbar.\nThe style of Scroll::inset.\nWhether the view is tight.\nHow to justify the content along the main axis.\nHow to justify the content along the main axis.\nHow to justify the content along the cross axis.\nThe color of the scrollbar knob.\nThe style of Scroll::knob_color.\nCreate a new Aligned view that aligns its content to the …\nThe length of the slider.\nThe style of Slider::length.\nThe color of the lightness slider.\nThe style of ColorPicker::lightness_color.\nThe line height of the text.\nThe style of Text::line_height.\nThe line height of the text.\nThe style of TextInput::line_height.\nThe line height of the text.\nThe style of Tooltip::line_height.\nWhether to mask the content.\nThe style of Container::mask.\nCreate a new Constrained view, constraining its content to …\nCreate a new Constrained view, constraining its content to …\nCreate a new Constrained view, constraining its content to …\nCreate a new Memo.\nCreate a new Constrained view, constraining its content to …\nCreate a new Constrained view, constraining its content to …\nCreate a new Constrained view, constraining its content to …\nWhether the input is multi-line.\nCreate a new BuildHandler.\nCreate a new Clickable, that calls on_click when clicked.\nCreate a new DrawHandler.\nThe draw callback.\nCreate a new EventHandler, with an after callback.\nCreate a new EventHandler, with a before callback.\nThe on_input callback.\nThe callback for when the value changes.\nA callback that is called when an input is received.\nA callback for when the view is opened or closed.\nCreate a new Clickable, that calls on_press when pressed.\nCreate a new RebuildHandler.\nCreate a new Clickable, that calls on_release when …\nA callback that is called when the input is submitted.\nA view that bridges the gap between impl View and …\nWhether the view is open.\nCreate a new Pad view.\nCreate a new Pad view adding padding to the bottom.\nCreate a new Pad view adding padding to the left.\nCreate a new Pad view adding padding to the right.\nCreate a new Pad view adding padding to the top.\nThe padding.\nThe style of Button::padding.\nThe padding.\nThe padding of the text.\nThe style of Tooltip::padding.\nCreate a new Painter view.\nPlaceholder text to display when the input is empty.\nThe color of the placeholder text.\nThe style of TextInput::placeholder_color.\nThe range of the slider.\nThe callback for when a rebuild is requested.\nCreate a new Painter view that draws a rectangle.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Transform view that rotates its content.\nCreate a new Transform view that rotates its content in …\nThe gap between each row.\nCreate a new Transform view that scales its content.\nCreate a new Constrained view, cosntraining its content to …\nThe size of the checkbox.\nThe style of Checkbox::size.\nThe size of the color picker.\nThe style of ColorPicker::size.\nThe size of the view.\nCreate a new Slider.\nThe width of the sliders.\nThe style of ColorPicker::slider_width.\nThe space to constrain the content to.\nThe stroke width of the checkbox.\nThe style of Checkbox::stroke.\nThe style to apply.\nCreate a new Suspense view.\nCreate a new Text.\nThe text.\nThe text.\nThe text to display.\nCreate a formatted Text.\nCreate a new TextInput.\nWhether the view is tight.\nCreate a new Tooltip view.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Transform view.\nThe transform.\nAnimate a transition.\nThe transition of the button.\nThe style of Button::transition.\nThe transition of the checkbox.\nThe style of Checkbox::transition.\nThe transition of the view.\nThe style of Collapsing::transition.\nThe transition of the scrollbar.\nThe style of Scroll::transition.\nAnimate a view when active changes.\nAnimate a view when focused changes.\nAnimate a view when hot changes.\nCreate a new Transform view that translates its content.\nCreate a new Trigger view.\nThe value of the slider.\nCreate a new vertical Scroll.\nCreate a vertical Stack.\nCreate a vertical Stack.\nCreate a vertical Stack, with dynamic content.\nCreate a vertical Stack, with vector content.\nCreate a vertical Wrap.\nCreate a vertical Wrap.\nCreate a vertical Wrap, with dynamic content.\nCreate a vertical Wrap, with a vector of content.\nCreate a new Constrained view, constraining its content to …\nThe width of the scrollbar.\nThe style of Scroll::width.\nThe width of the slider.\nThe style of Slider::width.\nCreate a new WithState that replaces the data with the …\nCreate a new WithState that replaces the data with the …\nCreate a new WithState.\nCreate a new WithState using S::default().\nCreate a view that applies a style to its content.\nCreate a new view unwrapping some data from the state.\nCreate a new view unwrapping some state from the data.\nThe text wrap of the text.\nThe style of Text::wrap.\nThe text wrap of the text.\nThe style of TextInput::wrap.\nThe text wrap of the text.\nThe style of Tooltip::wrap.\nCreate a new ZStack view.\nCreate a new ZStack view.\nSet the color of the window.\nThe root View will have Space::UNBOUNDED, and the window …\nA mouse cursor icon.\nSet the cursor of the window.\nSet whether the window is decorated.\nThe window will have a fixed size equal to Window::size.\nSet the icon of the window.\nSet the ime state of the window.\nSet whether the window is maximized.\nThe state of a pointer.\nSet whether the window is resizable.\nSet the scale of the window.\nSet the size of the window.\nSet the title of the window.\nSet whether the window is visible.\nA window.\nA unique identifier for a window.\nThe sizing of a window.\nThe state of a window.\nAn update to a window.\nThe color of the window.\nThe color of the window.\nWhether the window is decorated.\nWhether the window is decorated.\nGet the difference between a window and a previous state.\nReturns the argument unchanged.\nReturns the argument unchanged.\nThe view the pointer is over.\nThe icon of the window.\nThe icon of the window.\nCalls U::from(self).\nCalls U::from(self).\nWhether the window is maximized.\nWhether the window is maximized.\nThe position of the pointer.\nWhether the window is resizable.\nWhether the window is resizable.\nThe scale of the window.\nThe scale of the window.\nThe size of the window.\nThe size of the window.\nThe sizing of the window.\nThe title of the window.\nThe title of the window.\nWhether the window is visible.\nWhether the window is visible.\nTrait implemented by callsites.\nThe “debug” level.\nDispatch trace data to a Subscriber.\nThe “error” level.\nEvents represent single points in time where something …\nThe “info” level.\nIdentifies a span within the context of a subscriber.\nAttaches spans to a std::future::Future.\nDescribes the level of verbosity of a span or event.\nMetadata describing a span or event.\nA handle representing a span, with the capability to enter …\nTrait representing the functions required to collect trace …\nThe “trace” level.\nA field value of an erased type.\nThe “warn” level.\nReturns the string representation of the Level.\nCallsites represent the source locations from which spans …\nReturns an opaque Identifier that uniquely identifies the …\nConstructs a new Span as child of the given parent span, …\nNotifies the subscriber that a span ID has been cloned.\nNotifies the subscriber that a span ID has been cloned.\nReturns a handle to the span considered by the Subscriber …\nReturns a type representing this subscriber’s view of …\nReturns a type representing this subscriber’s view of …\nConstructs an event at the debug level.\nConstructs a span at the debug level.\nReturns the current default dispatcher\nDispatches trace events to Subscribers.\nIf self is the same type as the provided TypeId, returns …\nReturns some reference to this [Subscriber…\nReturns some reference to this Subscriber value if it is …\nReturns some reference to this Subscriber value if it is …\nReturns some reference to this Subscriber value if it is …\nReturns some reference to the Subscriber this Dispatch …\nCreates a WeakDispatch from this Dispatch.\nThis method is deprecated.\nNotifies the subscriber that a span ID has been dropped.\nReturns true if a span or event with the specified metadata…\nReturns true if a span with the specified metadata would be\nChecks whether a span or event is enabled based on the …\nRecords that a span has been entered.\nEnters this span, returning a guard that will exit the …\nRecords that a span has been can_enter.\nEnters this span, consuming it and returning a guard that …\nConstructs an event at the error level.\nConstructs a span at the error level.\nEvents represent single points in time during the …\nRecords that an Event has occurred.\nRecords that an Event has occurred.\nConstructs a new Event.\nDetermine if an Event should be recorded.\nTests whether an event with the specified level and target …\nRecords that a span has been exited.\nRecords that a span has been exited.\nSpan and Event key-value data.\nReturns a Field for the field with the given name, if one …\nReturns the names of the fields on the described span or …\nReturns the name of the source code file where the span …\nIndicates that the span with the given ID has an indirect …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nConstructs a new span ID from the given NonZeroU64.\nConstructs a new span ID from the given u64.\nReturns true if this Span has a field for the given Field …\nReturns this span’s Id, if it is enabled.\nInstruments this type with the current Span, returning an …\nExecutes the given function in the context of this span.\nConstructs an event at the info level.\nConstructs a span at the info level.\nAttach a span to a std::future::Future.\nInstruments this type with the provided Span, returning an …\nInstruments a function to create and enter a tracing span …\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns the span’s ID as a NonZeroU64.\nReturns the span’s ID as a u64.\nReturns true if this Subscriber is the same type as T.\nReturns true if this Subscriber is the same type as T.\nReturns true if this Subscriber is the same type as T.\nReturns true if this Subscriber is the same type as T.\nReturns true if this Dispatch forwards to a Subscriber of …\nReturns true if this span was disabled by the subscriber …\nReturns true if the callsite kind is Event.\nReturns true if this span was constructed by Span::none …\nReturn true if the callsite kind is Span.\nReturns the level of verbosity of the described span or …\nTrace verbosity level filtering.\nReturns the line number in the source code file where the …\nReturns the highest verbosity level that this Subscriber …\nMetadata describing trace data.\nReturns the metadata associated with the callsite.\nReturns this span’s Metadata, if it is enabled.\nStatically constructs new span metadata.\nReturns the path to the Rust module where the span …\nReturns the name of the span.\nConstructs a new Span with the given metadata and set of …\nConstruct new metadata for a span or event, with a name, …\nReturns a Dispatch that forwards to the given Subscriber.\nConstructs a new disabled span with the given Metadata.\nConstructs a new Span as the root of its own trace tree, …\nVisit the construction of a new span, returning a new span …\nRecord the construction of a new span, returning a new ID …\nConstructs a new span that is completely disabled.\nReturns a new Dispatch that discards events and spans.\nInvoked when this subscriber becomes a Dispatch.\nReturns this span, if it was enabled by the current …\nVisits this value with the given Visitor.\nRecord a set of values on a span.\nRecords that the field described by field has the value …\nRecord a set of values on a span.\nRecords all the fields in the provided ValueSet.\nAdds an indication that span follows from the span with …\nAdds an indication that span follows from the span with …\nRegisters a new callsite with this subscriber, returning …\nRegisters a new callsite with this subscriber, returning …\nSets the Interest for this callsite.\nSpans represent periods of time in which a program was …\nConstructs a new span.\nTests whether a span with the specified level and target …\nCollects and records trace data.\nReturns a string describing the part of the system where …\nConstructs an event at the trace level.\nConstructs a span at the trace level.\nNotifies the subscriber that a span ID has been dropped, …\nNotifies the subscriber that a span ID has been dropped, …\nConstructs an event at the warn level.\nConstructs a span at the warn level.\nInvokes a function with a reference to this span’s ID …\nTrait implemented by callsites.\nA default Callsite implementation.\nUniquely identifies a Callsite\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the callsite’s cached Interest, or registers it …\nCalls U::from(self).\nCalls U::from(self).\nReturns the metadata associated with the callsite.\nReturns a new DefaultCallsite with the specified Metadata.\nClear and reregister interest on every Callsite\nRegister a new Callsite with the global registry.\nRegisters this callsite with the global callsite registry.\nSets the Interest for this callsite.\nA guard that resets the current default dispatcher to the …\nDispatch trace data to a Subscriber.\nReturned if setting the global dispatcher fails.\nWeakDispatch is a version of Dispatch that holds a …\nReturns the argument unchanged.\nExecutes a closure with a reference to this thread’s …\nCalls U::from(self).\nSets the dispatch as the default dispatch for the duration …\nSets this dispatch as the global default for the duration …\nAttempts to upgrade this WeakDispatch to a Dispatch.\nSets this dispatch as the default for the duration of a …\nEvents represent single points in time where something …\nConstructs a new Event with the specified metadata and set …\nConstructs a new Event with the specified metadata and set …\nReturns an iterator over the set of values on this Event.\nReturns the argument unchanged.\nCalls U::from(self).\nReturns true if the new event’s parent should be …\nReturns true if the new event should be a root.\nReturns metadata describing this Event.\nReturns a new Event in the current span, with the …\nReturns a new Event as a child of the specified span, with …\nReturns the new event’s explicitly-specified parent, if …\nVisits all the fields on this Event with the specified …\nTrait implemented to allow a type to be used as a field …\nA Value which serializes as a string using fmt::Debug.\nA Value which serializes using fmt::Display.\nAn empty field.\nAn opaque key allowing O(1) access to a field in a Span’…\nDescribes the fields present on a span.\nAn iterator over a set of fields.\nA field value of an erased type.\nA set of fields and values for a span.\nVisits typed values.\nAttempts to convert &self into a Field with the specified …\nReturns an Identifier that uniquely identifies the Callsite\nReturns an Identifier that uniquely identifies the Callsite\nReturns true if self contains the given field.\nWraps a type implementing fmt::Debug as a Value that can be\nWraps a type implementing fmt::Display as a Value that can …\nReturns the Field named name, or None if no such field …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns whether or not this FieldSet has fields.\nReturns true if this ValueSet contains no values.\nReturns an iterator over the Fields in this FieldSet.\nReturns the number of fields in this FieldSet.\nReturns the number of fields in this ValueSet that would …\nReturns a string representing the name of the field.\nConstructs a new FieldSet with the given array of field …\nVisits this value with the given Visitor.\nVisits all the fields in this ValueSet with the provided …\nVisit a boolean value.\nVisit a value implementing fmt::Debug.\nRecords a type implementing Error.\nVisit a double-precision floating point value.\nVisit a signed 128-bit integer value.\nVisit a signed 64-bit integer value.\nVisit a string value.\nVisit an unsigned 128-bit integer value.\nVisit an unsigned 64-bit integer value.\nAttaches spans to a std::future::Future.\nA Future that has been instrumented with a tracing Span.\nA Future that has been instrumented with a tracing …\nExtension trait allowing futures to be instrumented with a …\nBorrows the Dispatch that is entered when this type is …\nReturns the argument unchanged.\nReturns the argument unchanged.\nInstruments this type with the current Span, returning an …\nBorrows the wrapped type.\nBorrows the wrapped type.\nMutably borrows the wrapped type.\nMutably borrows the wrapped type.\nGet a pinned mutable reference to the wrapped type.\nGet a pinned mutable reference to the wrapped type.\nGet a pinned reference to the wrapped type.\nGet a pinned reference to the wrapped type.\nInstruments this type with the provided Span, returning an …\nCalls U::from(self).\nCalls U::from(self).\nConsumes the Instrumented, returning the wrapped type.\nConsumes the Instrumented, returning the wrapped type.\nBorrows the Span that this type is instrumented by.\nMutably borrows the Span that this type is instrumented by.\nAttaches the current default Subscriber to this type, …\nAttaches the provided Subscriber to this type, returning a …\nA filter comparable to a verbosity Level.\nIndicates that a string could not be parsed to a valid …\nThe statically configured maximum trace level.\nThe “debug” level.\nThe “error” level.\nEvent callsite\nenabled! callsite. Subscribers can assume this Kind means …\nThe “info” level.\nIndicates whether the callsite is a span or event.\nDescribes the level of verbosity of a span or event.\nA filter comparable to a verbosity Level.\nMetadata describing a span or event.\nThe “off” level.\nReturned if parsing a Level fails.\nIndicates that a string could not be parsed to a valid …\nSpan callsite\nThe “trace” level.\nThe “warn” level.\nReturns a LevelFilter that matches the most verbose Level …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns a LevelFilter that enables spans and events with …\nSets that this Kind is a hint.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns the most verbose Level that this filter accepts, …\nReturn true if the callsite kind is Event\nReturn true if the callsite kind is Hint\nReturn true if the callsite kind is Span\nTrait implemented by types which have a span Id.\nAttributes provided to a Subscriber describing a new span …\nA guard representing a span which has been entered and is …\nAn owned version of Entered, a guard representing a span …\nIdentifies a span within the context of a subscriber.\nA set of fields recorded by a span.\nA handle representing a span, with the capability to enter …\nReturns the Id of the span that self corresponds to, or …\nReturns Attributes describing a new child span of the …\nReturns true if this set of Attributes contains a value …\nReturns true if this Record contains a value for the given …\nExits this span, returning the underlying Span.\nReturns the set of all fields defined by this span’s …\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns this span’s Id, if it is enabled.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns true if the new span’s parent should be …\nReturns true if this set of Attributes contains no values.\nReturns true if this Record contains no values.\nReturns true if the new span should be a root.\nReturns the number of fields that would be visited from …\nReturns a reference to the new span’s metadata.\nReturns Attributes describing a new child span of the …\nConstructs a new Record from a ValueSet.\nReturns Attributes describing a new span at the root of …\nReturns the new span’s explicitly-specified parent, if …\nRecords all the fields in this set of Attributes with the …\nRecords all the fields in this Record with the provided …\nReturns a reference to a ValueSet containing any values …\nA guard that resets the current default dispatcher to the …\nIndicates a Subscriber’s interest in a particular …\nA no-op Subscriber.\nReturned if setting the global dispatcher fails.\nTrait representing the functions required to collect trace …\nReturns an Interest indicating the subscriber is always …\nNotifies the subscriber that a span ID has been cloned.\nReturns a type representing this subscriber’s view of …\nIf self is the same type as the provided TypeId, returns …\nThis method is deprecated.\nReturns true if a span or event with the specified metadata…\nRecords that a span has been entered.\nRecords that an Event has occurred.\nDetermine if an Event should be recorded.\nRecords that a span has been exited.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nReturns true if the subscriber is always interested in …\nReturns true if the subscriber is never interested in …\nReturns true if the subscriber is sometimes interested in …\nReturns the highest verbosity level that this Subscriber …\nReturns an Interest indicating that the subscriber is …\nReturns a new NoSubscriber.\nVisit the construction of a new span, returning a new span …\nInvoked when this subscriber becomes a Dispatch.\nRecord a set of values on a span.\nAdds an indication that span follows from the span with …\nRegisters a new callsite with this subscriber, returning …\nSets the Subscriber as the default for the current thread …\nSets this subscriber as the global default for the …\nReturns an Interest indicating the subscriber is sometimes …\nNotifies the subscriber that a span ID has been dropped, …\nSets this Subscriber as the default for the current thread …\nThe style key of [Text.align::ALIGN].\nThe style key of [TextInput.align::ALIGN].\nThe style key of [Tooltip.align::ALIGN].\nThe style key of [ColorPicker.alpha_color::ALPHA_COLOR].\nAn affine transformation in 2 dimensional space.\nThe alignment of items along the cross axis.\nA view that aligns its content.\nAlignment of content inside a container.\nA view that animates.\nAn animation frame has passed.\nA view that supports dynamic dispatch.\nThe main application state.\nA builder for an App.\nCommands that can be sent to the application.\nA delegate for handling events in an application.\nA view that lays out its content with a fixed aspect ratio.\nAn axis is a direction in which a layout is applied.\nThe style key of [Checkbox.background::BACKGROUND].\nThe style key of [Collapsing.background::BACKGROUND].\nThe style key of [Container.background::BACKGROUND].\nThe style key of [Slider.background::BACKGROUND].\nThe style key of [Tooltip.background::BACKGROUND].\nBlack font weight (900), the boldest possible.\nBold font weight (700).\nThe style key of [Button.border_color::BORDER_COLOR].\nThe style key of [Checkbox.border_color::BORDER_COLOR].\nThe style key of [Collapsing.border_color::BORDER_COLOR].\nThe style key of [ColorPicker.border_color::BORDER_COLOR].\nThe style key of [Container.border_color::BORDER_COLOR].\nThe style key of [Slider.border_color::BORDER_COLOR].\nThe style key of [Tooltip.border_color::BORDER_COLOR].\nThe style key of [Button.border_radius::BORDER_RADIUS].\nThe style key of [Checkbox.border_radius::BORDER_RADIUS].\nThe style key of [Collapsing.border_radius::BORDER_RADIUS].\nThe style key of [Container.border_radius::BORDER_RADIUS].\nThe style key of [Scroll.border_radius::BORDER_RADIUS].\nThe style key of [Slider.border_radius::BORDER_RADIUS].\nThe style key of [Tooltip.border_radius::BORDER_RADIUS].\nThe style key of [Button.border_width::BORDER_WIDTH].\nThe style key of [Checkbox.border_width::BORDER_WIDTH].\nThe style key of [Collapsing.border_width::BORDER_WIDTH].\nThe style key of [ColorPicker.border_width::BORDER_WIDTH].\nThe style key of [Container.border_width::BORDER_WIDTH].\nThe style key of [Slider.border_width::BORDER_WIDTH].\nThe style key of [Tooltip.border_width::BORDER_WIDTH].\nAlign the content at the bottom of the container.\nAlign the content at the bottom left of the container.\nAlign the content at the bottom right of the container.\nThe back button.\nA base context that is shared between all other contexts.\nThe strokes are joined with a beveled corner.\nWays to blend two colors.\nRadi of the corners on a rounded rectangle.\nThe border width of a rounded rectangle.\nA boxed dynamic view.\nDerive the builder pattern.\nA context for building the view tree.\nA view that hooks into the build cycle.\nA collection of fonts.\nThe end of the stoke is squared off.\nA button.\nThe derived style for Button.\nAlign the content at the center of the container.\nThe style key of [Button.color::COLOR].\nThe style key of [Checkbox.color::COLOR].\nThe style key of [Scroll.color::COLOR].\nThe style key of [Slider.color::COLOR].\nThe style key of [Text.color::COLOR].\nThe style key of [TextInput.color::COLOR].\nThe style key of [Tooltip.color::COLOR].\nA canvas that can be drawn on.\nItems are packed toward the center of the stack.\nItems are packed toward the center of the stack.\nAlign text in the center.\nA checkbox.\nThe derived style for Checkbox.\nReplaces the destination with zero.\nThe click event.\nA click event.\nA click handler.\nA clipboard.\nEvent emitted when a window wants to close.\nThe window requested to be close.\nClose a window.\nA keyboard key-code.\nA collapsing view.\nThe derived style for Collapsing.\nA color with red, green, blue and alpha components.\nA color picker.\nThe derived style for ColorPicker.\nA command was sent.\nA clonable channel for sending Commands.\nA derived style.\nCondensed font stretch.\nA view that constrains its content to a given space.\nA container view.\nThe derived style for Container.\nThe root View will have Space::UNBOUNDED, and the window …\nA cursive font family.\nA mouse cursor icon.\nA bezier curve.\nThe style key of [Tooltip.delay::DELAY].\nA font loaded from data.\nThe context passed to the [Delegate] trait.\nPreserves the destination.\nDestination over source.\nDrag a window.\nA context for drawing the view tree.\nA view that hooks into the draw cycle.\nExtra-bold font weight (800).\nExtra-light font weight (200).\nAn ease transition curve.\nA transition easing curve.\nItems are packed toward the end of the stack.\nItems are packed toward the end of the stack.\nAlign text at the end.\nA point is inside the shape if a ray from the point …\nAn event that can be sent to a view.\nA context for handling events.\nA view that handles events.\nExpanded font stretch.\nExtra-condensed font stretch.\nExtra-expanded font stretch.\nThe style key of [Button.fancy::FANCY].\nA constant used to indicate that a dimension should fill …\nAlias for Self::INFINITY.\nThe infinite space.\nThe style key of [Text.font_family::FONT_FAMILY].\nThe style key of [TextInput.font_family::FONT_FAMILY].\nThe style key of [Tooltip.font_family::FONT_FAMILY].\nThe style key of [Text.font_size::FONT_SIZE].\nThe style key of [TextInput.font_size::FONT_SIZE].\nThe style key of [Tooltip.font_size::FONT_SIZE].\nThe style key of [Text.font_stretch::FONT_STRETCH].\nThe style key of [TextInput.font_stretch::FONT_STRETCH].\nThe style key of [Tooltip.font_stretch::FONT_STRETCH].\nThe style key of [Text.font_style::FONT_STYLE].\nThe style key of [TextInput.font_style::FONT_STYLE].\nThe style key of [Tooltip.font_style::FONT_STYLE].\nThe style key of [Text.font_weight::FONT_WEIGHT].\nThe style key of [TextInput.font_weight::FONT_WEIGHT].\nThe style key of [Tooltip.font_weight::FONT_WEIGHT].\nA fantasy font family.\nItems are stretched to fill the available space.\nRule determining if a point is inside a shape.\nThe window will have a fixed size equal to Window::size.\nThe flex value of a view.\nA flexible view.\nA view that focuses on a part of the data.\nA font family, by default FontFamily::SansSerif.\nA source for a font.\nA font stretch.\nA font style.\nA font weight.\nA context for loading and rasterizing fonts.\nThe forward button.\nThe horizontal axis.\nThe style key of [Collapsing.icon_color::ICON_COLOR].\nThe style key of [Collapsing.icon_size::ICON_SIZE].\nThe identity transformation.\nThe identity matrix.\nThe infinite size.\nThe style key of [Scroll.inset::INSET].\nAn clonable image.\nImage data.\nA unique identifier for an Image.\nItalic font style.\nThe justify content of a stack container.\nThe style key of [Scroll.knob_color::KNOB_COLOR].\nA keyboard key.\nAn event fired when a key is pressed.\nA keyboard key was pressed.\nA keyboard key was released.\nAlign the content at the left of the container.\nThe style key of [Slider.length::LENGTH].\nLight font weight (300).\nThe style key of […\nThe style key of [Text.line_height::LINE_HEIGHT].\nThe style key of [TextInput.line_height::LINE_HEIGHT].\nThe style key of [Tooltip.line_height::LINE_HEIGHT].\nA context for laying out the view tree.\nA lens used by Focus.\nA linear transition curve.\nThe style key of [Container.mask::MASK].\nMedium font weight (500).\nA 2x2 matrix.\nA view that only builds the inner view when certain data …\nThe strokes are joined with a sharp corner.\nModifiers for keyboard and pointer events.\nA monospace font family.\nThe negative unit x point.\nThe negative unit x vector.\nThe negative unit y point.\nThe negative unit y vector.\nNormal font weight (400), the default.\nA font family by name, e.g. “Arial”.\nA point is inside the shape if a ray from the point …\nDo not wrap text.\nNormal font stretch, the default.\nNormal font style, the default.\nThe one point.\nThe one vector.\nOblique font style.\nA view that bridges the gap between impl View and …\nOpen a new window.\nOther buttons.\nThe style key of [Button.padding::PADDING].\nThe style key of [Tooltip.padding::PADDING].\nThe style key of […\nA view that adds padding to its content.\nA padding of a rectangle.\nA paint that can be used to fill or stroke a shape.\nA view that draws something.\nA font loaded from a file.\nA pattern that can be used to fill a shape.\nA pattern.\nA view that has separate ViewState from its content.\nContents of a view, in a sequence.\nA point in 2D space.\nThe state of a pointer.\nA pointer button.\nA unique pointer id.\nA pointer left the window.\nA pointer was moved.\nA pointer moved.\nA pointer button was pressed.\nA pointer button was pressed.\nA pointer button was released.\nA pointer button was released.\nA pointer wheel was scrolled.\nA pointer was scrolled.\nThe press event.\nThe primary button, usually the left mouse button or the …\nQuit the application.\nAlign the content at the right of the container.\nA convenience trait for rebuilding a View.\nDerive the Rebuild trait.\nA context for rebuilding the view tree.\nA view that handles rebuilds.\nA rectangle defined by its minimum and maximum points.\nThe release event.\nThe end of the stroke is rounded.\nThe strokes are joined with a rounded corner.\nSemi-bold font weight (600).\nThe style key of [Checkbox.size::SIZE].\nThe style key of [ColorPicker.size::SIZE].\nThe style key of [ColorPicker.slider_width::SLIDER_WIDTH].\nThe style key of [Checkbox.stroke::STROKE].\nA sans-serif font family.\nA scrollable view.\nThe derived style for Scroll.\nThe secondary button, usually the right mouse button.\nSemi-condensed font stretch.\nSemi-expanded font stretch.\nThe state of a PodSeq.\nA serif font family.\nWays to fill a shape.\nA 2 dimensional size.\nA slider.\nThe derived style for Slider.\nA solid color.\nReplaces the destination with the source.\nSource over destination.\nSpace available to lay out a view.\nItems are evenly distributed in the stack, with half-size …\nItems are evenly distributed in the stack, with equal-size …\nItems are evenly distributed in the stack.\nThe end of the stroke is squared off and extends past the …\nA view that stacks it’s content in a line.\nItems are packed toward the start of the stack.\nItems are packed toward the start of the stack.\nAlign text at the start.\nThe state of a Pod.\nThe state of the sequence.\nThe state of the view, see top-level documentation for …\nItems are stretched to all have the same size.\nProperties of a stroke.\nWays to draw the end of a stroke.\nWays to join two segments of a stroke.\nA style.\nA style key.\nA styled value.\nDerived the styled pattern.\nA collection of styles.\nA view that suspends rendering while a future is pending.\nThin font weight (100), the thinnest possible.\nAlign the content at the top of the container.\nAlign the content at the top left of the container.\nAlign the content at the top right of the container.\nThe style key of [Button.transition::TRANSITION].\nThe style key of [Checkbox.transition::TRANSITION].\nThe style key of [Collapsing.transition::TRANSITION].\nThe style key of [Scroll.transition::TRANSITION].\nThe tertiary button, usually the middle mouse button.\nA view that displays text.\nAlignment of a section of text.\nA convenient wrapper around a cosmic_text::Buffer.\nA text input.\nThe derived style for TextInput.\nThe derived style for Text.\nWrapping of a section of text.\nA theme.\nA view that displays some text when the content is hovered.\nThe derived style for Tooltip.\nA view that transforms its content.\nA transition.\nA view that creates a trigger around the content.\nThe unbounded size.\nThe unbounded space.\nUltra-condensed font stretch.\nUltra-expanded font stretch.\nView state needs to be updated.\nA value.\nA 2D vector.\nThe vertical axis.\nA single UI component.\nA sequence of views.\nState associated with a View.\nThe style key of [Scroll.width::WIDTH].\nThe style key of [Slider.width::WIDTH].\nThe style key of [Text.wrap::WRAP].\nThe style key of [TextInput.wrap::WRAP].\nThe style key of [Tooltip.wrap::WRAP].\nA window.\nA unique identifier for a window.\nThe window was maximized.\nThe window was resized.\nThe window was scaled.\nThe sizing of a window.\nA view that stores some additional data.\nA view that applies a style to its content.\nWrap text at the word boundary.\nA view that lays out it’s content in a line wrapping if …\nThe unit x point.\nThe unit x vector.\nThe unit y point.\nThe unit y vector.\nA BorderRadius with zero radius on all corners.\nA BorderWidth with zero width on all borders.\nThe zero point.\nA rectangle with zero area.\nThe zero size.\nThe zero space.\nThe zero vector.\nA view that overlays its content on top of each other.\nThe alpha component of the color.\nGet the alpha component as an 8 bit integer.\nThe accent color.\nGet whether the view’s active state changed.\nAdd a context.\nAdd a window to the application.\nSet the build callback for after the content is built.\nSet the callback for when an event is emitted.\nThe build callback.\nThe callback after an event is propagated.\nCreate a new Aligned view.\nAlign the content inside the container.\nAligns an item within the given space.\nSet self.align.\nSet self.align.\nSet self.align.\nSet self.align.\nHow to align the content along the cross axis, within each …\nThe horizontal alignment of the text.\nThe style of Text::align.\nThe vertical alignment of the text.\nThe style of TextInput::align.\nThe horizontal alignment of the text.\nThe style of Tooltip::align.\nHow to align the content along the cross axis.\nThe alignment.\nCreate a new BorderRadius with the same radius on all …\nCreate a new BorderWidth with the same width on all …\nCreate a new Padding with the same value for all sides.\nCreate a new point with the same x and y.\nCreate a new size with the same width and height.\nCreate a new vector with the same x and y.\nSet self.alpha_color.\nThe color of the alpha slider.\nThe style of ColorPicker::alpha_color.\nWhether the alt key is held down.\nSet the flex value of the view.\nThe flex value.\nGet the angle of the vector.\nGet the angle between self and other.\nCreate a new Animate.\nRequest an animation frame.\nRequest an animation frame.\nRequest an animation frame.\nThe animation callback.\nWhether the paint should be anti-aliased.\nCreate a new BoxedView.\nCheck if any modifiers are held down.\nCreate a new Stack, with dynamic content.\nCreate a new Wrap, with dynamic content.\nCreate a new horizontal Stack, with dynamic content.\nCreate a new vertical Stack, with dynamic content.\nGet the area of the rectangle.\nGet a reference to the underlying Any object.\nGet a build context.\nGet a build context.\nGet a character from the key.\nConvert the font family to a fontdb::Family.\nGet a layout context.\nGet a rebuild context.\nGet the unique id as a u64.\nThe aspect ratio of the content.\nSet self.axis.\nSet self.axis.\nSet self.axis.\nSet self.axis.\nThe axis of the scroll.\nThe axis of the slider.\nThe axis of the stack.\nThe axis.\nThe blue component of the color.\nGet the blue component as an 8 bit integer.\nCreate a new Container with background.\nSet self.background.\nSet self.background.\nSet self.background.\nSet self.background.\nThe background color.\nThe background color.\nThe style of Checkbox::background.\nThe background color of the header.\nThe style of Collapsing::background.\nThe background color.\nThe style of Container::background.\nThe background color of the slider.\nThe style of Slider::background.\nThe background color of the text.\nThe style of Tooltip::background.\nSet the callback for before an event is emitted.\nThe callback before an event is propagated.\nThe blend mode of the paint.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nThe border color.\nThe style of Button::border_color.\nThe border color.\nThe style of Checkbox::border_color.\nThe color of the border of the header.\nThe style of Collapsing::border_color.\nThe border color of the color picker.\nThe style of ColorPicker::border_color.\nThe border color.\nThe style of Container::border_color.\nThe border color of the slider.\nThe style of Slider::border_color.\nThe border color of the text.\nThe style of Tooltip::border_color.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nThe border radius.\nThe style of Button::border_radius.\nThe border radius.\nThe style of Checkbox::border_radius.\nThe border radius of the header.\nThe style of Collapsing::border_radius.\nThe border radius.\nThe style of Container::border_radius.\nThe radius of the scrollbar.\nThe style of Scroll::border_radius.\nThe border radius of the slider.\nThe style of Slider::border_radius.\nThe border radius of the text.\nThe style of Tooltip::border_radius.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nThe border width.\nThe style of Button::border_width.\nThe border width.\nThe style of Checkbox::border_width.\nThe border width of the header.\nThe style of Collapsing::border_width.\nThe border width of the color picker.\nThe style of ColorPicker::border_width.\nThe border width.\nThe style of Container::border_width.\nThe border width of the slider.\nThe style of Slider::border_width.\nThe border width of the text.\nThe style of Tooltip::border_width.\nCreate a new Aligned view that aligns its content to the …\nGet the bottom edge of the rectangle.\nThe bottom border width.\nThe bottom padding.\nGet the bottom center point of the rectangle.\nCreate a new Aligned view that aligns its content to the …\nGet the bottom left point of the rectangle.\nThe bottom left corner radius.\nCreate a new Aligned view that aligns its content to the …\nGet the bottom right point of the rectangle.\nThe bottom right corner radius.\nGet the bounds of the curve.\nGet the bounds of the text buffer.\nCalculates the size of a text buffer.\nBuild the sequence state.\nBuild the view state, see top-level documentation for more …\nCreate a new application builder.\nBuild the application.\nBuild the sequence state.\nCreate a new Button.\nSet self.button.\nThe button of the pointer.\nThe button of the pointer.\nThe button to listen for.\nThe callback.\nGet the canvas.\nThe cap of the stroke.\nCeil the point by element.\nCeil self by element.\nCeil the vector by element.\nCreate a new Aligned view that aligns its content to the …\nGet the center point of the rectangle.\nGet the left center point of the rectangle.\nGet the right center point of the rectangle.\nCreate a new rectangle with the given center point and …\nCreate a new Checkbox.\nSet self.checked.\nWhether the checkbox is checked.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a new Painter view that draws a circle.\nCreate a curve from a cicrle.\nClamp self to the range [min, max] by element.\nClamp the rectangle to the given rectangle.\nClamp self to the range [min, max] by element.\nClamp self to the range [min, max] by element.\nClear the canvas.\nClear the curve, retaining the allocated memory for reuse.\nWhether the button was clicked.\nGet the Clipboard.\nClose the contour.\nA window was requested to be closed.\nClose a window.\nEmit a command.\nSend a command.\nTry to get the command as a specific type.\nSpawn a future sending a command when it completes.\nSpawn a future sending a command when it completes.\nSend a command without waking the event loop.\nThe code of the key that was pressed.\nCreate a new Collapsing.\nMultiply the image with a color.\nSet the color of the window.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nThe color of the pattern.\nThe color of the window.\nThe color of the button.\nThe style of Button::color.\nThe color of the checkbox.\nThe style of Checkbox::color.\nThe color of the color picker.\nThe color of the scrollbar.\nThe style of Scroll::color.\nThe foreground color of the slider.\nThe style of Slider::color.\nThe color of the text.\nThe style of Text::color.\nThe color of the text.\nThe style of TextInput::color.\nThe color of text.\nThe style of Tooltip::color.\nCreate a new ColorPicker.\nSet self.column_gap.\nThe gap between each column.\nCreate a computed style.\nCheck if the transition is complete.\nCompute the id for this image data.\nDraw a conic curve to a point, with a control point control…\nCreate a new Constrained view, constraining its content to …\nGet the most constraning space between self and `other\nCompute the closest point in the rectangle to the given …\nCreate a new Container.\nCheck if the curve contains a point using the given rule.\nCompute whether the rectangle contains the given point.\nCheck if a context is contained.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nSet self.content.\nThe content.\nThe content.\nThe content.\nThe content view.\nThe content.\nThe content.\nThe content view.\nThe content to align.\nThe content.\nThe content.\nThe content.\nThe content.\nThe content to constrain.\nThe content.\nThe content of the view.\nThe content.\nThe content.\nThe content of the stack.\nThe content to display.\nThe content.\nThe content.\nThe content to overlay.\nGet a context.\nGet a mutable context.\nGet a context or insert a default.\nGet a reference to the Contexts.\nGet a mutable reference to the Contexts.\nThe contrast color.\nGet the length of the cross product of self and other.\nWhether the control key is held down.\nDraw a cubic bezier curve to a point, with control points a…\nGet the cursor of the view.\nThe glyph cache.\nThe danger color.\nCreate the default dark theme.\nDarken the color by the given amount.\nGet the pixels.\nGet the pixels mutably.\nConstructs an event at the debug level.\nSet whether the window is decorated.\nWhether the window is decorated.\nSet self.default_open.\nWhether the view is open by default.\nThe delay before the tooltip is displayed.\nThe style of Tooltip::delay.\nAdd a delegate to the application.\nThe delta of the pointer.\nThe delta of the pointer.\nDesaturates the color by given amount.\nSet self.descendants.\nWhether the item should be clickable when it’s …\nOnly include the annotated item on desktop platforms.\nCompute the determinant of the matrix.\nCompute the dot distance between two points.\nGet the dot product of self and other.\nDowngrade the image to a weak reference.\nDraw the view, see top-level documentation for more …\nRequest a draw of the view tree.\nRequest a draw of the view tree.\nRequest a draw of the view tree.\nSet self.draw.\nThe draw function.\nRasterize a buffer.\nDraw a canvas.\nDraw a canvas.\nDraw the nth view.\nDraw the nth view.\nDraw a single window, returning the scene if it needs to …\nThe duration of the transition.\nBuild the view.\nDraw the view.\nHandle an event.\nCalculate the layout.\nRebuild the view.\nCreate an ease transition with the given duration.\nCreate an ease transition with the given duration.\nThe easing curve.\nCreate a new Painter view that draws an ellipse.\nCreate a curve from an oval.\nConstructs an event at the error level.\nEvaluate the easing at t where 0 <= t <= 1.\nHandle an event.\nHandle an event, see top-level documentation for more …\nHandle an event for the entire application.\nSet self.event.\nThe event to listen for.\nHandle an event for the nth view.\nHandle an event for the nth view.\nCreate a new expanded Flexible view.\nExpand the space by size.\nExtend the styles with another collection of styles.\nFade the color by the given amount.\nSet the fallback view to display while the future is …\nSet self.fancy.\nThe distance of the fancy effect.\nThe style of Button::fancy.\nFill a curve.\nFill a curve.\nDraw a rectangle.\nGet the filter mode.\nIf self is finite, return self, otherwise return zero. …\nClamp a size to the space.\nSet the sizing to WindowSizing::Content.\nGet the flags of the view.\nCreate a new Flexible view.\nThe flex value of the view.\nFloor the point by element.\nFloor self by element.\nFloor the vector by element.\nCreate a new Focus.\nGet whether the view’s focused state changed.\nAdd a font to the application.\nThe font atlas.\nSet self.font_family.\nSet self.font_family.\nThe font family of the text.\nThe style of Text::font_family.\nThe font family of the text.\nThe style of TextInput::font_family.\nThe font family of the text.\nThe style of Tooltip::font_family.\nSet self.font_size.\nSet self.font_size.\nThe font size of the text.\nThe style of Text::font_size.\nThe font size of the text.\nThe style of TextInput::font_size.\nThe font size of the text.\nThe style of Tooltip::font_size.\nSet self.font_stretch.\nSet self.font_stretch.\nThe font stretch of the text.\nThe style of Text::font_stretch.\nThe font stretch of the text.\nThe style of TextInput::font_stretch.\nThe font stretch of the text.\nThe style of Tooltip::font_stretch.\nSet self.font_style.\nSet self.font_style.\nThe font.into of the text.\nThe style of Text::font_style.\nThe font.into of the text.\nThe style of TextInput::font_style.\nThe font style of the text.\nThe style of Tooltip::font_style.\nThe font system.\nSet self.font_weight.\nSet self.font_weight.\nThe font weight of the text.\nThe style of Text::font_weight.\nThe font weight of the text.\nThe style of TextInput::font_weight.\nThe font weight of the text.\nThe style of Tooltip::font_weight.\nGet the Fonts.\nGet the fractional component by element.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new matrix from an angle.\nCreate a new vector from an angle.\nCreate a new pointer id from a hashable value.\nConvert a Linux scancode to a key code.\nCreate a new text buffer from a raw buffer.\nCreate a new matrix from a scale.\nCreate a new space with the same minimum and maximum size.\nCreate a new pointer button from a u16.\nCreate a new pointer id from a u64.\nThe green component of the color.\nGet the green component as an 8 bit integer.\nSet self.gap.\nSet the gap for both the rows and columns.\nThe gap between children.\nGet the clipboard text.\nGet a style.\nGet the value, or a style from the styles.\nEvaluate the transition curve at t.\nGet a context.\nGet a mutable context.\nGet a style, or a default value.\nGet the value, or a style from the styles.\nGet a style, or a default value.\nGet the value, or a style from the styles.\nGet a pixel.\nGet the pointer with pointer_id.\nGet the pointer with pointer_id mutably.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet a window by id.\nGet a mutable window by id.\nCreate a new color with the given gray component.\nGet whether a child view was active last call.\nGet whether a child view was focused last call.\nGet whether a child view was hot last call.\nHandle all pending commands.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nWhether any of the views in the sequence are active.\nGet whether the view has an active child.\nGet whether a child view’s active state changed.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether the view has a focused child.\nGet whether a child view’s focused state changed.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether the view has a hot child.\nGet whether a child view’s hot state changed.\nHat the vector.\nThe header.\nCreate a new Constrained view, constraining its content to …\nGet the height of the image in pixels.\nGet the height of the rectangle.\nGet the height of the window.\nSet the minimum height.\nThe height.\nCreate a new color, with the given hex string.\nParse a color from a hex string.\nCreate a new horizontal Stack.\nCreate a new horizontal Wrap.\nCreate a new horizontal Wrap, with dynamic content.\nCreate a new horizontal Wrap, with a vector of content.\nGet whether the view’s hot state changed.\nDraw a hoverable layer.\nDraw a layer with a view.\nThe view the pointer is over.\nCreate a new horizontal Scroll.\nCreate a new color, with the given hue, saturation and …\nReturns a new color with the given hue, saturation, …\nCreate a new color, with the given hue, saturation, …\nReturns a new color with the given hue, saturation, …\nCreate a horizontal Stack.\nCreate a horizontal Stack.\nCreate a horizontal Stack, with dynamic content.\nCreate a horizontal Stack, with vector content.\nCreate a new color, with the given hue, saturation and …\nReturns a new color with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, value …\nReturns a new color with the given hue, saturation, value …\nCreate a horizontal Wrap.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap, with dynamic content.\nCreate a horizontal Wrap, with a vector of content.\nSet the icon of the window.\nThe icon of the window.\nSet self.icon_color.\nThe color of the icon.\nThe style of Collapsing::icon_color.\nSet self.icon_size.\nThe size of the icon.\nThe style of Collapsing::icon_size.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the ImageId.\nGet the id of the view.\nGet the unique identifier of the pointer.\nGet the unique identifier of the window.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe application is idle.\nCalled when the application is idle.\nThe image of the pattern.\nGet the IME of the view.\nExpand the rectangle to contain the given point.\nLoad a font from a file or directory.\nExpand the rectangle by the given amount.\nThe info color.\nConstructs an event at the info level.\nInitialize the application.\nCalled when the application is initialized.\nInsert a styled value.\nInsert a context.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a style key.\nInsert a style key.\nInsert a style.\nSet self.inset.\nThe inset of the scrollbar.\nThe style of Scroll::inset.\nCompute the intersection of the rectangle with the given …\nCheck if the rectangle intersects the given rectangle.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCompute the inverse transformation.\nCompute the inverse of the matrix.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nCheck if the curve is closed.\nCheck if the event is a command of a specific type.\nCheck if the target platform is desktop.\nCheck if the curve is empty.\nWhether the sequence is empty.\nGet whether the stack is empty.\nGet whether the wrap is empty.\nCheck if the point is finite.\nGet whether the size is finite.\nGet whether the space is finite.\nGet whether the view is focusable.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether a specific view is hovered.\nCheck if the point is infinite.\nGet whether the size is infinite.\nGet whether the space is infinite.\nCheck if the key is pressed.\nCheck if the event represents a key press of a specific …\nCheck if the event represents a key release of a specific …\nCheck if the target platform is mobile.\nCheck if the point is NaN.\nGet whether button is held down on pointer with pointer_id.\nGet whether a button is pressed.\nWhether the view is tight.\nReturns true if the color is translucent.\nReturns true if the color is transparent.\nCheck if the curve is valid.\nCheck if a rect is visible.\nCheck if the target platform is web.\nGet an iterator over the curve segments.\nThe join of the stroke.\nSet self.justify.\nSet self.justify.\nHow to justify the content along the main axis.\nHow to justify the content along the main axis.\nSet self.justify_cross.\nHow to justify the content along the cross axis.\nCreate a style key.\nThe key that was pressed, ignoring modifiers.\nA keyboard key was pressed or released.\nSet self.knob_color.\nThe color of the scrollbar knob.\nThe style of Scroll::knob_color.\nGet the last point in the curve.\nDraw a layer.\nLayout the view, see top-level documentation for more …\nRequest a layout of the view tree.\nRequest a layout of the view tree.\nRequest a layout of the view tree.\nLayout the items in a stack container.\nLayout the nth view.\nLayout the nth view.\nCreate a new Aligned view that aligns its content to the …\nGet the left edge of the rectangle.\nThe left border width.\nThe left padding.\nThe length of the sequence.\nGet the number of verbs in the curve.\nThe length of the sequence.\nGet the number of views in the stack.\nGet the number of views in the wrap.\nGet the length of the vector.\nSet self.length.\nThe length of the slider.\nThe style of Slider::length.\nGet the length of the vector squared.\nLinearly interpolate between two points.\nCreate the default light theme.\nBrighten the color by the given amount.\nSet self.lightness_color.\nThe color of the lightness slider.\nThe style of ColorPicker::lightness_color.\nSet self.line_height.\nSet self.line_height.\nThe line height of the text.\nThe style of Text::line_height.\nThe line height of the text.\nThe style of TextInput::line_height.\nThe line height of the text.\nThe style of Tooltip::line_height.\nDraw a line to a point.\nCreate a linear transition with the given duration.\nCreate a linear transition with the given duration.\nLoads a font from a FontSource.\nTransform a point from global space to local space.\nLoosen the space, setting the minimum size to zero.\nLoosen the height, setting the minimum height to zero.\nLoosen the width, setting the minimum width to zero.\nGet the luminocity.\nGet the major component of a pair.\nMark the view as animated.\nMark the view as drawn.\nMark the view as laid out.\nSet self.marker.\nSet self.mask.\nWhether to mask the content.\nThe style of Container::mask.\nDraw a layer with a mask.\nDraw a layer with a mask.\nThe matrix of the affine transformation.\nGet the max of self and other by element.\nGet the max of self and other by element.\nGet the max of self and other by element.\nThe maximum point of the rectangle.\nMaximum size the view can be.\nGet the maximum radius of the corners.\nGet the largest element of self.\nCreate a new Constrained view, constraining its content to …\nSet the maximum height.\nCreate a new Constrained view, constraining its content to …\nCreate a new rectangle with the given maximum point and …\nSet the maximum size.\nCreate a new Constrained view, constraining its content to …\nSet the maximum width.\nSet whether the window is maximized.\nWhether the window is maximized.\nCreate a new Memo.\nWhether the meta key is held down.\nGet the min of self and other by element.\nGet the min of self and other by element.\nGet the min of self and other by element.\nThe minimum point of the rectangle.\nMinimum size the view can be.\nGet the minimum radius of the corners.\nGet the smallest element of self.\nCreate a new Constrained view, constraining its content to …\nSet the minimum height.\nCreate a new Constrained view, constraining its content to …\nCreate a new rectangle with the given minimum point and …\nSet the minimum size.\nCreate a new Constrained view, constraining its content to …\nSet the minimum width.\nGet the minor component of a pair.\nThe miter limit of the stroke.\nLinearly interpolate between two colors.\nLinearly interpolate between two colors.\nOnly include the annotated item on mobile platforms.\nThe modifiers that were active.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers changed.\nModify the image data.\nMove a pointer, returning the movement.\nMove to a point.\nSet self.multiline.\nWhether the input is multi-line.\nPremultiply the image alpha.\nReturns the name of the cursor.\nGet whether the view needs an animation frame.\nGet whether the view needs to be drawn.\nGet whether the view needs to be laid out.\nCreate a new application builder.\nCreate a new clipboard from a backend.\nCreate a new base context.\nCreate a new build context.\nCreate a new draw context.\nCreate a new event context.\nCreate a new layout context.\nCreate a new rebuild context.\nCreate a new style.\nCreate a new Animate.\nCreate a new BuildHandler.\nCreate a new DrawHandler.\nCreate a new EventHandler.\nCreate a new Focus.\nCreate a new Memo.\nCreate a new opaque view.\nCreate a new RebuildHandler.\nCreate a new Suspense view.\nCreate a new Trigger.\nCreate a new WithState.\nCreate a new WithStyle view.\nCreate a new BorderRadius.\nCreate a new BorderWidth.\nCreate a new canvas.\nCreate a new curve.\nCreate a new CommandProxy channel.\nCreate a new image data.\nCreate a new image.\nCreate a new alignment.\nCreate a new matrix.\nCreate a new Padding.\nCreate a new point.\nCreate a new rectangle with the given minimum and maximum …\nCreate a new size.\nCreate a new space.\nCreate a new vector.\nCreate a new Styles.\nCreate a new text buffer.\nCreates a new font context.\nCreate a new pod view.\nCreate a new PodSeq.\nCreate a new ViewState with the given ViewId.\nCreate a new pointer.\nCreate a new WindowId.\nCreate a new Window.\nCreate a new aligned view.\nCreates a new Aspect view.\nCreate a new Button.\nCreate a new Checkbox.\nCreate a new Clickable.\nCreate a new Collapsing view.\nCreate a new ColorPicker.\nCreate a new constrained view.\nCreate a new Container.\nCreate a new flexible view.\nCreate a new Pad view.\nCreate a new Painter view.\nCreate a new scrollable view.\nCreate a new Slider.\nCreate a new Stack.\nCreate a new text.\nCreate a new text input view.\nCreate a new tooltip view.\nCreate a new Transform view.\nCreate a new Wrap.\nCreate a new overlay view.\nNormalize the vector.\nGet the offset of the padding.\nGet the offset of the rectangle.\nCreate a new color, with the given hue, saturation and …\nConvert a color from okhsl to sRGB.\nCreate a new color, with the given hue, saturation, …\nConvert a color from okhsl to sRGB.\nCreate a new color, with the given hue, saturation and …\nConvert a color from okhsv to sRGB.\nCreate a new color, with the given hue, saturation, value …\nConvert a color from okhsv to sRGB.\nCreate a new color, with the given lightness, a and b …\nConvert a color from oklab to sRGB.\nCreate a new color, with the given lightness, a, b and …\nConvert a color from oklab to sRGB.\nCreate a new color, with the given lightness, chroma and …\nConvert a color from oklch to sRGB.\nCreate a new color, with the given lightness, chroma, hue …\nConvert a color from oklch to sRGB.\nCreate a new BuildHandler.\nCreate a new Clickable, that calls on_click when clicked.\nCreate a new DrawHandler.\nSet the draw callback.\nThe draw callback.\nCreate a new EventHandler, with an after callback.\nCreate a new EventHandler, with a before callback.\nSet the on_input callback.\nSet the callback for when the value changes.\nSet the callback that is called when an input is received.\nThe on_input callback.\nThe callback for when the value changes.\nA callback that is called when an input is received.\nSet a callback for when the view is opened or closed.\nA callback for when the view is opened or closed.\nCreate a new Clickable, that calls on_press when pressed.\nCreate a new RebuildHandler.\nCreate a new Clickable, that calls on_release when …\nSet the callback that is called when the input is …\nA callback that is called when the input is submitted.\nA view that bridges the gap between impl View and …\nSet self.open.\nWhether the view is open.\nConvenience method to open a window with a view.\nAdd a window to the application.\nThe outline color.\nDraw an overlay, at index.\nDraw an overlay.\nPack a major and minor component into a pair.\nCreate a new Pad view.\nCreate a new Pad view adding padding to the bottom.\nCreate a new Pad view adding padding to the left.\nCreate a new Pad view adding padding to the right.\nCreate a new Pad view adding padding to the top.\nSet self.padding.\nThe padding.\nThe style of Button::padding.\nThe padding.\nThe padding of the text.\nThe style of Tooltip::padding.\nCreate a new Painter view.\nGet the size of the window in physical pixels.\nSet self.placeholder.\nPlaceholder text to display when the input is empty.\nSet self.placeholder_color.\nThe color of the placeholder text.\nThe style of TextInput::placeholder_color.\nCreate a new Pod view.\nA pointer button was pressed or released.\nA pointer left the window.\nA pointer moved.\nA pointer scrolled.\nGet the pointers in the window.\nGet the pointers in the window mutably.\nGet the points in the curve.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nPremultiply the image alpha, returning a new image.\nPrepare the view.\nPrepare a buffer for rendering.\nPrepare text for drawing.\nPrepare text for drawing.\nPress a button.\nPress a button on a pointer.\nThe primary color.\nGet the primitives of the canvas.\nPropagate the state of a child view.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the CommandProxy.\nConvert a from points to pixels.\nPush a view to the stack.\nPush a view to the wrap.\nPush an oval to the curve.\nPush a rectangle to the curve.\nPush the border of a rectangle with rounded corners to the …\nPush a rectangle with rounded corners to the curve.\nDraw a rectangle with rounded corners and a border.\nDraw a quadratic bezier curve to a point, with a control …\nQuit the application.\nThe red component of the color.\nGet the red component as an 8 bit integer.\nSet self.range.\nThe range of the slider.\nGet the raw buffer.\nGet the raw buffer mutably.\nRebuild the view.\nRebuild the sequence state.\nRebuild the view state, see top-level documentation for …\nRebuild all windows.\nRequest a rebuild of the view tree.\nRequest a rebuild of the view tree.\nRebuild the sequence state.\nRebuild the style of Button.\nRebuild the style of Checkbox.\nRebuild the style of Collapsing.\nRebuild the style of ColorPicker.\nRebuild the style of Container.\nRebuild the style of Scroll.\nRebuild the style of Slider.\nRebuild the style of Text.\nRebuild the style of TextInput.\nRebuild the style of Tooltip.\nThe callback for when a rebuild is requested.\nRebuild the nth view.\nRebuild the nth view.\nCreate a new Painter view that draws a rectangle.\nGet the rect of the view in local space.\nGet the rect of the view in local space.\nGet the rect of the view in local space.\nDraw a rectangle.\nCreate a curve from a rectangle.\nGet the rect of the text buffer.\nGet the rect of the view in local coordinates.\nRelease a button, returning whether the button was clicked.\nRelease a button on a pointer.\nRemove a context.\nRemove a pointer.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a window from the application.\nRequest an animation frame of the view tree.\nRequest a draw of the view tree.\nRequest a layout of the view tree.\nSet whether the window is resizable.\nWhether the window is resizable.\nCreate a new color, with the given red, green and blue …\nCreate a new color with the given red, green and blue …\nCreate a new color, with the given red, green, blue and …\nCreate a new color with the given red, green, blue and …\nCreate a new color with the given red, green, blue and …\nCreate a new Aligned view that aligns its content to the …\nGet the right edge of the rectangle.\nThe right border width.\nThe right padding.\nCreate a new Transform view that rotates its content.\nCreate a rotation.\nCreate a new Transform view that rotates its content in …\nDraw a layer with a rotation.\nDraw a layer with a rotation.\nRound the translation.\nRound the point by element.\nRound the rectangle’s minimum point down and its maximum …\nRound self by element.\nRound the vector by element.\nSet self.row_gap.\nThe gap between each row.\nSaturates the color by given amount.\nCreate a new Transform view that scales its content.\nCreate a scale.\nSet the scale of the window.\nThe scale of the window.\nDraw a layer with a scale.\nDraw a layer with a scale.\nThe secondary color.\nSet the clipboard text.\nSet whether the view is active.\nSet whether the view is active.\nSet whether the view is active.\nSet whether the view is active.\nSet the align of the text buffer.\nSet the bounds of the text buffer.\nSet the cursor of the view.\nSet the cursor of the view.\nSet the cursor of the view.\nSet the cursor of the view.\nSet the filter mode.\nSet whether the view is focusable.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is hot.\nSet whether the view is hot.\nSet whether the view is hot.\nSet whether the view is hot.\nSet the ime of the view.\nSet the IME of the view.\nSet the metrics of the text buffer.\nSet a pixel.\nSet the size of the view.\nSet the text of the text buffer.\nSet the transform of the view.\nSet the wrapping mode of the text buffer.\nThe shader of the paint.\nWhether the shift key is held down.\nShrink the rectangle by the given amount.\nShrink the space by size.\nGet the absolute value of the vector.\nCreate a new Constrained view, cosntraining its content to …\nGet the size of the view.\nGet the size of the view.\nGet the size of the view.\nGet the size of the image in pixels.\nGet the size of the padding.\nGet the size of the rectangle.\nGet the size of the text buffer.\nGet the size of the view.\nSet the size of the window.\nSet self.size.\nSet self.size.\nSet self.size.\nThe size of the window.\nThe size of the checkbox.\nThe style of Checkbox::size.\nThe size of the color picker.\nThe style of ColorPicker::size.\nThe size of the view.\nSet the sizing of the window.\nThe sizing of the window.\nCreate a new Slider.\nSet self.slider_width.\nThe width of the sliders.\nThe style of ColorPicker::slider_width.\nGet the WindowSnapshot of the window.\nThe space to constrain the content to.\nSpawn a future.\nSpawn a future that is polled when commands are handled.\nStep the transition.\nStroke a curve.\nStroke a curve.\nSet self.stroke.\nThe stroke width of the checkbox.\nThe style of Checkbox::stroke.\nStroke the curve with the given stroke.\nStyleing and theming.\nAdd a style to the application.\nThe style to apply.\nCreate a collection of styles.\nThe style of Button.\nThe style of Checkbox.\nThe style of Collapsing.\nThe style of ColorPicker.\nThe style of Container.\nThe style of Scroll.\nThe style of Slider.\nThe style of Text.\nThe style of TextInput.\nThe style of Tooltip.\nGet the styles.\nGet the styles.\nGet the styles.\nGet the styles.\nGet the styles.\nThe success color.\nThe surface color.\nCreate a new Suspense view.\nThe swash cache.\nTake all pending requests.\nCreate a new Text.\nDraw a text buffer.\nSet self.text.\nSet the text of the input.\nThe text that was entered.\nThe text.\nThe text.\nThe text to display.\nCreate a formatted Text.\nCreate a new TextInput.\nDraw a raw text buffer.\nAdd a theme to the application.\nWhether the view is tight.\nSet the title of the window.\nThe title of the window.\nConvert the text align to a cosmic_text::Align.\nConvert the text wrap to a cosmic_text::Wrap.\nConvert the font weight to a fontdb::Weight.\nConvert the font stretch to a fontdb::Stretch.\nConvert the font style to a fontdb::Style.\nConvert the color to hex.\nConvert the color to a hue, saturation, lightness tuple.\nConvert the color to a hue, saturation, lightness and …\nConvert the color to a hue, saturation, value tuple.\nConvert the color to a hue, saturation, value and alpha …\nConvert a color from sRGB to okhsl.\nConvert a color from sRGB to okhsl.\nConvert a color from sRGB to okhsv.\nConvert a color from sRGB to okhsv.\nConvert a color from sRGB to oklab.\nConvert a color from sRGB to oklab.\nConvert a color from sRGB to oklch.\nConvert a color from sRGB to oklch.\nConvert the size to a vector.\nConvert the vector to a vector.\nConvert the color to linear sRGB.\nConvert the point to a size.\nConvert the vector to a size.\nConvert the color to linear sRGB.\nConvert the point to a vector.\nConvert the size to a vector.\nCreate a new Tooltip view.\nCreate a new Aligned view that aligns its content to the …\nGet the top edge of the rectangle.\nThe top border width.\nThe top padding.\nGet the top center point of the rectangle.\nCreate a new Aligned view that aligns its content to the …\nGet the top left point of the rectangle.\nThe top left corner radius.\nCreate a new Aligned view that aligns its content to the …\nGet the top right point of the rectangle.\nThe top right corner radius.\nConstructs an event at the trace level.\nCreate a new Transform view.\nGet the transform of the view.\nGet the transform of the view.\nTransform the curve by the given affine transform.\nTransform the rectangle by the given affine transform.\nGet the transform of the view.\nThe transformation of the pattern.\nThe transform.\nDraw a layer with a transform.\nDraw a layer with a transformation.\nAnimate a transition.\nSet self.transition.\nSet self.transition.\nSet self.transition.\nSet self.transition.\nThe transition of the button.\nThe style of Button::transition.\nThe transition of the checkbox.\nThe style of Checkbox::transition.\nThe transition of the view.\nThe style of Collapsing::transition.\nThe transition of the scrollbar.\nThe style of Scroll::transition.\nAnimate a view when active changes.\nAnimate a view when focused changes.\nAnimate a view when hot changes.\nCreate a new Transform view that translates its content.\nCrate a translation.\nTranslate the transform of the view.\nDraw a layer with a translation.\nDraw a layer with a translation.\nThe translation of the affine transformation.\nCreate a new Trigger view.\nDraw a trigger rectangle.\nDraw a trigger rectangle.\nTry to parse a color from a hex string.")
\ No newline at end of file
diff --git a/search.desc/ori/ori-desc-1-.js b/search.desc/ori/ori-desc-1-.js
index c3a64d073..749d111ee 100644
--- a/search.desc/ori/ori-desc-1-.js
+++ b/search.desc/ori/ori-desc-1-.js
@@ -1 +1 @@
-searchState.loadedDescShard("ori", 1, "Unpack a pair into it’s (major, minor) components.\nGet the Update of the view.\nUpdate the hovered state of a window.\nUpdate the window.\nCreate a style value.\nSet self.value.\nThe value of the slider.\nCreate a new Stack, with vector content.\nCreate a new Wrap, with a vector of content.\nCreate a new horizontal Stack, with vector content.\nCreate a new vertical Stack, with vector content.\nGet the verbs in the curve.\nCreate a new vertical Stack.\nCreate a new vertical Wrap.\nCreate a new vertical Wrap, with dynamic content.\nCreate a new vertical Wrap, with a vector of content.\nGet the view at a point.\nSet whether the window is visible.\nWhether the window is visible.\nCreate a new vertical Scroll.\nCreate a vertical Stack.\nCreate a vertical Stack.\nCreate a vertical Stack, with dynamic content.\nCreate a vertical Stack, with vector content.\nCreate a vertical Wrap.\nCreate a vertical Wrap.\nCreate a vertical Wrap, with dynamic content.\nCreate a vertical Wrap, with a vector of content.\nWake the event loop.\nConstructs an event at the warn level.\nThe warning color.\nGet whether the view was active last call.\nGet whether the view was focused last call.\nGet whether the view was hot last call.\nOnly include the annotated item on web platforms.\nCreate a new Constrained view, constraining its content to …\nGet the width of the image in pixels.\nGet the width of the rectangle.\nGet the width of the window.\nSet the minimum width.\nSet self.width.\nThe width of the stroke.\nThe width.\nThe width of the scrollbar.\nThe style of Scroll::width.\nThe width of the slider.\nThe style of Slider::width.\nAdd a window to the application.\nGet the window.\nGet the window.\nGet the window.\nGet the window.\nGet the window.\nThe window that wants to close.\nHandle an event for a single window.\nThe maximized state of a window changed.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nA window was resized.\nA window was scaled.\nPush a view to the stack.\nPush a view to the wrap.\nCreate a new WithState that replaces the data with the …\nCreate a new WithState that replaces the data with the …\nCreate a new WithState.\nCreate a new WithState using S::default().\nCreate a view that applies a style to its content.\nCreate a new view unwrapping some data from the state.\nCreate a new view unwrapping some state from the data.\nSet self.wrap.\nSet self.wrap.\nThe text wrap of the text.\nThe style of Text::wrap.\nThe text wrap of the text.\nThe style of TextInput::wrap.\nThe text wrap of the text.\nThe style of Tooltip::wrap.\nThe horizontal alignment.\nThe x axis of the matrix.\nThe x coordinate.\nThe x coordinate.\nThe vertical alignment.\nThe y axis of the matrix.\nThe y coordinate.\nThe y coordinate.\nCreate a new ZStack view.\nCreate a new ZStack view.\nA derived style.\nA style.\nA style key.\nA styled value.\nA collection of styles.\nA theme.\nA value.\nThe accent color.\nThe background color.\nCreate a computed style.\nThe contrast color.\nThe danger color.\nThe info color.\nCreate a style key.\nThe outline color.\nThe primary color.\nThe secondary color.\nThe success color.\nThe surface color.\nCreate a style value.\nThe warning color.")
\ No newline at end of file
+searchState.loadedDescShard("ori", 1, "Compute the intersection of the rectangle with the given …\nCreate a new constrained view, with no bounds.\nCompute the union of the rectangle with the given …\nUnpack a pair into it’s (major, minor) components.\nGet the Update of the view.\nUpdate the hovered state of a window.\nUpdate the window.\nCreate a style value.\nSet self.value.\nThe value of the slider.\nCreate a new Stack, with vector content.\nCreate a new Wrap, with a vector of content.\nCreate a new horizontal Stack, with vector content.\nCreate a new vertical Stack, with vector content.\nGet the verbs in the curve.\nCreate a new vertical Stack.\nCreate a new vertical Wrap.\nCreate a new vertical Wrap, with dynamic content.\nCreate a new vertical Wrap, with a vector of content.\nGet the view at a point.\nSet whether the window is visible.\nWhether the window is visible.\nCreate a new vertical Scroll.\nCreate a vertical Stack.\nCreate a vertical Stack.\nCreate a vertical Stack, with dynamic content.\nCreate a vertical Stack, with vector content.\nCreate a vertical Wrap.\nCreate a vertical Wrap.\nCreate a vertical Wrap, with dynamic content.\nCreate a vertical Wrap, with a vector of content.\nWake the event loop.\nConstructs an event at the warn level.\nThe warning color.\nGet whether the view was active last call.\nGet whether the view was focused last call.\nGet whether the view was hot last call.\nOnly include the annotated item on web platforms.\nCreate a new Constrained view, constraining its content to …\nGet the width of the image in pixels.\nGet the width of the rectangle.\nGet the width of the window.\nSet the minimum width.\nSet self.width.\nSet self.width.\nThe width of the stroke.\nThe width.\nThe width of the scrollbar.\nThe style of Scroll::width.\nThe width of the slider.\nThe style of Slider::width.\nAdd a window to the application.\nGet the window.\nGet the window.\nGet the window.\nGet the window.\nGet the window.\nThe window that wants to close.\nHandle an event for a single window.\nThe maximized state of a window changed.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nA window was resized.\nA window was scaled.\nPush a view to the stack.\nPush a view to the wrap.\nCreate a new WithState that replaces the data with the …\nCreate a new WithState that replaces the data with the …\nCreate a new WithState.\nCreate a new WithState using S::default().\nCreate a view that applies a style to its content.\nCreate a new view unwrapping some data from the state.\nCreate a new view unwrapping some state from the data.\nSet self.wrap.\nSet self.wrap.\nThe text wrap of the text.\nThe style of Text::wrap.\nThe text wrap of the text.\nThe style of TextInput::wrap.\nThe text wrap of the text.\nThe style of Tooltip::wrap.\nThe horizontal alignment.\nThe x axis of the matrix.\nThe x coordinate.\nThe x coordinate.\nThe vertical alignment.\nThe y axis of the matrix.\nThe y coordinate.\nThe y coordinate.\nCreate a new ZStack view.\nCreate a new ZStack view.\nA derived style.\nA style.\nA style key.\nA styled value.\nA collection of styles.\nA theme.\nA value.\nThe accent color.\nThe background color.\nCreate a computed style.\nThe contrast color.\nThe danger color.\nThe info color.\nCreate a style key.\nThe outline color.\nThe primary color.\nThe secondary color.\nThe success color.\nThe surface color.\nCreate a style value.\nThe warning color.")
\ No newline at end of file
diff --git a/search.desc/ori_core/ori_core-desc-0-.js b/search.desc/ori_core/ori_core-desc-0-.js
index e40a0e4a8..3fd32e836 100644
--- a/search.desc/ori_core/ori_core-desc-0-.js
+++ b/search.desc/ori_core/ori_core-desc-0-.js
@@ -1 +1 @@
-searchState.loadedDescShard("ori_core", 0, "Core library for the Ori UI framework.\nCanvas module.\nClipboard.\nA channel for sending commands to the user interface.\nContexts for views.\nEvents and event handling.\nCreate a formatted Text.\nCreate a horizontal Stack.\nCreate a horizontal Wrap.\nImage data and processing.\nLayout of Views.\nRebuild trait and derive macro.\nStyleing and theming.\nCreate a collection of styles.\nText rendering and layouting.\nTransition utilities.\nView module.\nThe builtin views in Ori.\nCreate a vertical Stack.\nCreate a vertical Wrap.\nWindowing system abstraction layer.\nCreate a new ZStack view.\nWays to anti-alias a shape.\nThe strokes are joined with a beveled corner.\nWays to blend two colors.\nRadi of the corners on a rounded rectangle.\nThe border width of a rounded rectangle.\nThe end of the stoke is squared off.\nA canvas that can be drawn on.\nReplaces the destination with zero.\nA close verb.\nClose the curve.\nA color with red, green, blue and alpha components.\nA cubic verb.\nCubic bezier curve to a point.\nA bezier curve.\nAn iterator over the segments of a curve.\nA segment of a curve.\nA verb that describes the type of curve.\nPreserves the destination.\nDestination over source.\nA type for displaying a color as a hex string.\nA point is inside the shape if a ray from the point …\nFast anti-aliasing.\nA filled curve.\nRule determining if a point is inside a shape.\nAnti-aliasing.\nA layer that can be transformed and masked.\nA line verb.\nLine to a point.\nA mask that can be used to clip a layer.\nThe strokes are joined with a sharp corner.\nA move verb.\nMove to a point.\nA point is inside the shape if a ray from the point …\nNo anti-aliasing.\nA paint that can be used to fill or stroke a shape.\nA pattern that can be used to fill a shape.\nA pattern.\nA primitive that can be drawn on a canvas.\nA quad verb.\nQuadratic bezier curve to a point.\nThe end of the stroke is rounded.\nThe strokes are joined with a rounded corner.\nWays to fill a shape.\nA solid color.\nReplaces the destination with the source.\nSource over destination.\nThe end of the stroke is squared off and extends past the …\nProperties of a stroke.\nA stroked curve.\nWays to draw the end of a stroke.\nWays to join two segments of a stroke.\nA BorderRadius with zero radius on all corners.\nA BorderWidth with zero width on all borders.\nThe alpha component of the color.\nGet the alpha component as an 8 bit integer.\nCreate a new BorderRadius with the same radius on all …\nCreate a new BorderWidth with the same width on all …\nWhether the paint should be anti-aliased.\nConvert the hex color display to a &str.\nConvert the hex color display to a &str.\nThe blue component of the color.\nGet the blue component as an 8 bit integer.\nThe blend mode of the paint.\nThe bottom border width.\nThe bottom left corner radius.\nThe bottom right corner radius.\nGet the bounds of the curve.\nThe cap of the stroke.\nCreate a curve from a cicrle.\nClear the canvas.\nClear the curve, retaining the allocated memory for reuse.\nClose the contour.\nThe color of the pattern.\nDraw a conic curve to a point, with a control point control…\nCheck if the curve contains a point using the given rule.\nCount the number of primitives.\nDraw a cubic bezier curve to a point, with control points a…\nThe curve of the mask.\nDarken the color by the given amount.\nDesaturates the color by given amount.\nDraw a canvas.\nCreate a curve from an oval.\nFade the color by the given amount.\nFill a curve.\nThe fill rule of the mask.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nThe green component of the color.\nGet the green component as an 8 bit integer.\nCreate a new color with the given gray component.\nCreate a new color, with the given hex string.\nParse a color from a hex string.\nDraw a layer with a view.\nCreate a new color, with the given hue, saturation and …\nReturns a new color with the given hue, saturation, …\nCreate a new color, with the given hue, saturation, …\nReturns a new color with the given hue, saturation, …\nCreate a new color, with the given hue, saturation and …\nReturns a new color with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, value …\nReturns a new color with the given hue, saturation, value …\nThe image of the pattern.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck if the curve is closed.\nCheck if the curve is empty.\nReturns true if the color is translucent.\nReturns true if the color is transparent.\nCheck if the curve is valid.\nGet an iterator over the curve segments.\nThe join of the stroke.\nGet the last point in the curve.\nDraw a layer.\nThe left border width.\nGet the number of verbs in the curve.\nBrighten the color by the given amount.\nDraw a line to a point.\nGet the luminocity.\nDraw a layer with a mask.\nGet the maximum radius of the corners.\nGet the minimum radius of the corners.\nThe miter limit of the stroke.\nLinearly interpolate between two colors.\nLinearly interpolate between two colors.\nMove to a point.\nCreate a new BorderRadius.\nCreate a new BorderWidth.\nCreate a new mask.\nCreate a new canvas.\nCreate a new hex color display with the given red, green, …\nCreate a new curve.\nCreate a new color, with the given hue, saturation and …\nConvert a color from okhsl to sRGB.\nCreate a new color, with the given hue, saturation, …\nConvert a color from okhsl to sRGB.\nCreate a new color, with the given hue, saturation and …\nConvert a color from okhsv to sRGB.\nCreate a new color, with the given hue, saturation, value …\nConvert a color from okhsv to sRGB.\nCreate a new color, with the given lightness, a and b …\nConvert a color from oklab to sRGB.\nCreate a new color, with the given lightness, a, b and …\nConvert a color from oklab to sRGB.\nCreate a new color, with the given lightness, chroma and …\nConvert a color from oklch to sRGB.\nCreate a new color, with the given lightness, chroma, hue …\nConvert a color from oklch to sRGB.\nDraw an overlay.\nGet the number of points for the verb.\nGet the points in the curve.\nGet the primitives of the canvas.\nPush an oval to the curve.\nPush a rectangle to the curve.\nPush the border of a rectangle with rounded corners to the …\nPush a rectangle with rounded corners to the curve.\nDraw a quadratic bezier curve to a point, with a control …\nThe red component of the color.\nGet the red component as an 8 bit integer.\nDraw a rectangle.\nCreate a curve from a rectangle.\nCreate a new color, with the given red, green and blue …\nCreate a new color with the given red, green and blue …\nCreate a new color, with the given red, green, blue and …\nCreate a new color with the given red, green, blue and …\nCreate a new color with the given red, green, blue and …\nThe right border width.\nDraw a layer with a rotation.\nSaturates the color by given amount.\nDraw a layer with a scale.\nThe shader of the paint.\nStroke a curve.\nStroke the curve with the given stroke.\nConvert the color to hex.\nConvert the color to a hue, saturation, lightness tuple.\nConvert the color to a hue, saturation, lightness and …\nConvert the color to a hue, saturation, value tuple.\nConvert the color to a hue, saturation, value and alpha …\nConvert a color from sRGB to okhsl.\nConvert a color from sRGB to okhsl.\nConvert a color from sRGB to okhsv.\nConvert a color from sRGB to okhsv.\nConvert a color from sRGB to oklab.\nConvert a color from sRGB to oklab.\nConvert a color from sRGB to oklch.\nConvert a color from sRGB to oklch.\nConvert the color to linear sRGB.\nConvert the color to linear sRGB.\nThe top border width.\nThe top left corner radius.\nThe top right corner radius.\nTransform the curve by the given affine transform.\nThe transformation of the pattern.\nDraw a layer with a transformation.\nDraw a layer with a translation.\nDraw a trigger rectangle.\nTry to parse a color from a hex string.\nGet the verbs in the curve.\nGet the view at a point.\nThe width of the stroke.\nThe curve to draw.\nThe curve to draw.\nThe fill rule of the curve.\nThe mask of the layer.\nThe paint to fill the curve with.\nThe paint to stroke the curve with.\nThe primitives of the layer.\nThe stroke properties of the curve.\nThe transformation of the layer.\nThe view of the layer.\nA clipboard.\nA clipboard backend.\nReturns the argument unchanged.\nGet the clipboard text.\nGet the clipboard text.\nCalls U::from(self).\nCreate a new clipboard from a backend.\nSet the clipboard text.\nSet the clipboard text.\nA command containing arbitrary data.\nA clonable channel for sending Commands.\nA receiver for Commands.\nA waker for the event loop, triggered when a command is …\nSend a command.\nSpawn a future sending a command when it completes.\nSend a command without waking the event loop.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nTry to downcast the command to T.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck whether the command is of type T.\nGet the name of the command.\nCreate a new command.\nCreate a new CommandWaker.\nCreate a new CommandProxy channel.\nSpawn a future that is polled when commands are handled.\nConvert the command into a boxed Any value.\nTry receive a command.\nWake the event loop.\nWake the event loop.\nA base context that is shared between all other contexts.\nA context for building the view tree.\nA context for a view.\nA context for drawing the view tree.\nA context for handling events.\nA context for laying out the view tree.\nA context for rebuilding the view tree.\nGet whether the view’s active state changed.\nRequest an animation frame.\nRequest an animation frame.\nRequest an animation frame.\nGet a build context.\nGet a build context.\nGet a layout context.\nGet a rebuild context.\nGet the canvas.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nGet the Clipboard.\nEmit a command.\nSpawn a future sending a command when it completes.\nCheck if the context is present.\nCheck if a context is contained.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nGet a context.\nGet a mutable context.\nGet a context or insert a default.\nGet a reference to the Contexts.\nGet a mutable reference to the Contexts.\nRequest a draw of the view tree.\nRequest a draw of the view tree.\nRequest a draw of the view tree.\nDraw a canvas.\nFill a curve.\nDraw a rectangle.\nGet whether the view’s focused state changed.\nGet the Fonts.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nGet a context.\nGet a context.\nGet a mutable context.\nGet a mutable context.\nGet a context or insert a default.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet whether a child view was active last call.\nGet whether a child view was focused last call.\nGet whether a child view was hot last call.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view’s active state changed.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view’s focused state changed.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view’s hot state changed.\nGet whether the view’s hot state changed.\nDraw a hoverable layer.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nPush a context.\nInsert a context.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nCheck if there are no contexts.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nCheck if a rect is visible.\nRequest a layout of the view tree.\nRequest a layout of the view tree.\nRequest a layout of the view tree.\nGet the number of contexts.\nTransform a point from global space to local space.\nDraw a layer with a mask.\nCreate a new base context.\nCreate a new build context.\nCreate a new draw context.\nCreate a new event context.\nCreate a new layout context.\nCreate a new rebuild context.\nCreate a new context.\nDraw an overlay, at index.\nPrepare text for drawing.\nPrepare text for drawing.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the CommandProxy.\nDraw a rectangle with rounded corners and a border.\nRequest a rebuild of the view tree.\nGet the rect of the view in local space.\nGet the rect of the view in local space.\nGet the rect of the view in local space.\nPop a context.\nRemove a context.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nDraw a layer with a rotation.\nDraw a layer with a scale.\nSet whether the view is active.\nSet whether the view is active.\nSet whether the view is active.\nSet the cursor of the view.\nSet the cursor of the view.\nSet the cursor of the view.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is hot.\nSet whether the view is hot.\nSet whether the view is hot.\nSet the ime of the view.\nGet the size of the view.\nGet the size of the view.\nGet the size of the view.\nSpawn a future.\nStroke a curve.\nGet the styles.\nGet the styles.\nGet the styles.\nGet the styles.\nGet the styles.\nDraw a text buffer.\nDraw a raw text buffer.\nGet the transform of the view.\nGet the transform of the view.\nDraw a layer with a transform.\nDraw a layer with a translation.\nDraw a trigger rectangle.\nGet whether the view was active last call.\nGet whether the view was focused last call.\nGet whether the view was hot last call.\nGet the window.\nGet the window.\nGet the window.\nGet the window.\nGet the window.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nAn animation frame has passed.\nThe back button.\nEvent emitted when a window wants to close.\nThe window requested to be close.\nA keyboard key-code.\nA command was sent.\nAn event that can be sent to a view.\nThe forward button.\nInput Method Editor (IME) state.\nA trait for checking if something is a certain key.\nA keyboard key.\nAn event fired when a key is pressed.\nA keyboard key was pressed.\nAn event fired when a key is released.\nA keyboard key was released.\nModifiers for keyboard and pointer events.\nOther buttons.\nA pointer button.\nA unique pointer id.\nA pointer left the window.\nA pointer left the window.\nA pointer was moved.\nA pointer moved.\nA pointer button was pressed.\nA pointer button was pressed.\nA pointer button was released.\nA pointer button was released.\nA pointer wheel was scrolled.\nA pointer was scrolled.\nThe primary button, usually the left mouse button or the …\nThe secondary button, usually the right mouse button.\nThe tertiary button, usually the middle mouse button.\nView state needs to be updated.\nEvent emitted when a window is maximized.\nThe window was maximized.\nEvent emitted when a window is resized.\nThe window was resized.\nEvent emitted when a window is scaled.\nThe window was scaled.\nWhether the alt key is held down.\nCheck if any modifiers are held down.\nGet a character from the key.\nGet the unique id as a u64.\nThe button of the pointer.\nThe button of the pointer.\nWhether the button was clicked.\nTry to get the command as a specific type.\nThe code of the key that was pressed.\nThe code of the key that was released.\nThe current composition range.\nWhether the control key is held down.\nThe delta of the pointer.\nThe delta of the pointer.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new pointer id from a hashable value.\nConvert a Linux scancode to a key code.\nCreate a new pointer button from a u16.\nCreate a new pointer id from a u64.\nThe new height of the window.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck if the key is the given key.\nCheck if the event is a command of a specific type.\nCheck if the key is pressed.\nCheck if the key is released.\nCheck if the event represents a key press of a specific …\nCheck if the event represents a key release of a specific …\nThe key that was pressed, ignoring modifiers.\nThe key that was released, ignoring modifiers.\nWhether the window is maximized or not.\nWhether the meta key is held down.\nThe modifiers that were active.\nThe modifiers that were active.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe new scale factor of the window.\nThe current selection range.\nWhether the shift key is held down.\nGet the new size of the window.\nThe current text being edited.\nThe text that was entered.\nThe new width of the window.\nThe window that wants to close.\nThe window that was resized.\nThe window that was scaled.\nThe window that was maximized.\nA texture managed by the rendering backend.\nAn clonable image.\nAn Image texture.\nImage data.\nA unique identifier for an Image.\nA texture.\nAn opaque backend texture identifier.\nA weak reference to an Image.\nMultiply the image with a color.\nCompute the id for this image data.\nGet the pixels.\nGet the pixels mutably.\nDowngrade the image to a weak reference.\nGet the filter mode.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new TextureId from an index.\nGet a pixel.\nGet the height of the image in pixels.\nGet the ImageId.\nGet the ImageId.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nModify the image data.\nPremultiply the image alpha.\nCreate a new image data.\nCreate a new image.\nCreate a new TextureId.\nPremultiply the image alpha, returning a new image.\nSet the filter mode.\nSet a pixel.\nGet the size of the image in pixels.\nGet the number of strong references to the image.\nConvert the TextureId to an index.\nGet the number of weak references to the image.\nGet the width of the image in pixels.\nAn affine transformation in 2 dimensional space.\nThe alignment of items along the cross axis.\nAlignment of content inside a container.\nAn axis is a direction in which a layout is applied.\nAlign the content at the bottom of the container.\nAlign the content at the bottom left of the container.\nAlign the content at the bottom right of the container.\nAlign the content at the center of the container.\nItems are packed toward the center of the stack.\nItems are packed toward the center of the stack.\nItems are packed toward the end of the stack.\nItems are packed toward the end of the stack.\nA constant used to indicate that a dimension should fill …\nAlias for Self::INFINITY.\nThe infinite space.\nItems are stretched to fill the available space.\nThe horizontal axis.\nThe identity transformation.\nThe identity matrix.\nThe infinite size.\nThe justify content of a stack container.\nAn iterator over the positions of items in a stack …\nAlign the content at the left of the container.\nA 2x2 matrix.\nThe negative unit x point.\nThe negative unit x vector.\nThe negative unit y point.\nThe negative unit y vector.\nThe one point.\nThe one vector.\nA padding of a rectangle.\nA point in 2D space.\nAlign the content at the right of the container.\nA rectangle defined by its minimum and maximum points.\nA 2 dimensional size.\nSpace available to lay out a view.\nItems are evenly distributed in the stack, with half-size …\nItems are evenly distributed in the stack, with equal-size …\nItems are evenly distributed in the stack.\nItems are packed toward the start of the stack.\nItems are packed toward the start of the stack.\nItems are stretched to all have the same size.\nAlign the content at the top of the container.\nAlign the content at the top left of the container.\nAlign the content at the top right of the container.\nThe unbounded size.\nThe unbounded space.\nA 2D vector.\nThe vertical axis.\nThe unit x point.\nThe unit x vector.\nThe unit y point.\nThe unit y vector.\nThe zero point.\nA rectangle with zero area.\nThe zero size.\nThe zero space.\nThe zero vector.\nAlign the content inside the container.\nAligns an item within the given space.\nCreate a new Padding with the same value for all sides.\nCreate a new point with the same x and y.\nCreate a new size with the same width and height.\nCreate a new vector with the same x and y.\nGet the angle of the vector.\nGet the angle between self and other.\nGet the area of the rectangle.\nGet the bottom edge of the rectangle.\nThe bottom padding.\nGet the bottom center point of the rectangle.\nGet the bottom left point of the rectangle.\nGet the bottom right point of the rectangle.\nCeil the point by element.\nCeil self by element.\nCeil the vector by element.\nGet the center point of the rectangle.\nGet the left center point of the rectangle.\nGet the right center point of the rectangle.\nCreate a new rectangle with the given center point and …\nClamp self to the range [min, max] by element.\nClamp the rectangle to the given rectangle.\nClamp self to the range [min, max] by element.\nClamp self to the range [min, max] by element.\nGet the most constraning space between self and `other\nCompute the closest point in the rectangle to the given …\nCompute whether the rectangle contains the given point.\nGet the length of the cross product of self and other.\nCompute the determinant of the matrix.\nCompute the dot distance between two points.\nGet the dot product of self and other.\nExpand the space by size.\nIf self is finite, return self, otherwise return zero. …\nClamp a size to the space.\nFloor the point by element.\nFloor self by element.\nFloor the vector by element.\nGet the fractional component by element.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new matrix from an angle.\nCreate a new vector from an angle.\nCreate a new matrix from a scale.\nCreate a new space with the same minimum and maximum size.\nHat the vector.\nGet the height of the rectangle.\nThe height.\nExpand the rectangle to contain the given point.\nExpand the rectangle by the given amount.\nCompute the intersection of the rectangle with the given …\nCheck if the rectangle intersects the given rectangle.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCompute the inverse transformation.\nCompute the inverse of the matrix.\nCheck if the point is finite.\nGet whether the size is finite.\nGet whether the space is finite.\nCheck if the point is infinite.\nGet whether the size is infinite.\nGet whether the space is infinite.\nCheck if the point is NaN.\nLayout the items in a stack container.\nGet the left edge of the rectangle.\nThe left padding.\nGet the length of the vector.\nGet the length of the vector squared.\nLinearly interpolate between two points.\nLoosen the space, setting the minimum size to zero.\nLoosen the height, setting the minimum height to zero.\nLoosen the width, setting the minimum width to zero.\nGet the major component of a pair.\nThe matrix of the affine transformation.\nGet the max of self and other by element.\nGet the max of self and other by element.\nGet the max of self and other by element.\nThe maximum point of the rectangle.\nMaximum size the view can be.\nGet the largest element of self.\nCreate a new rectangle with the given maximum point and …\nGet the min of self and other by element.\nGet the min of self and other by element.\nGet the min of self and other by element.\nThe minimum point of the rectangle.\nMinimum size the view can be.\nGet the smallest element of self.\nCreate a new rectangle with the given minimum point and …\nGet the minor component of a pair.\nCreate a new alignment.\nCreate a new matrix.\nCreate a new Padding.\nCreate a new point.\nCreate a new rectangle with the given minimum and maximum …\nCreate a new size.\nCreate a new space.\nCreate a new vector.\nNormalize the vector.\nGet the offset of the padding.\nGet the offset of the rectangle.\nPack a major and minor component into a pair.\nConvert a from points to pixels.\nGet the right edge of the rectangle.\nThe right padding.\nCreate a rotation.\nRound the translation.\nRound the point by element.\nRound the rectangle’s minimum point down and its maximum …\nRound self by element.\nRound the vector by element.\nCreate a scale.\nShrink the rectangle by the given amount.\nShrink the space by size.\nGet the absolute value of the vector.\nGet the size of the padding.\nGet the size of the rectangle.\nConvert the size to a vector.\nConvert the vector to a vector.\nConvert the point to a size.\nConvert the vector to a size.\nConvert the point to a vector.\nConvert the size to a vector.\nGet the top edge of the rectangle.\nThe top padding.\nGet the top center point of the rectangle.\nGet the top left point of the rectangle.\nGet the top right point of the rectangle.\nTransform the rectangle by the given affine transform.\nCrate a translation.\nThe translation of the affine transformation.\nCompute the intersection of the rectangle with the given …\nCompute the union of the rectangle with the given …\nUnpack a pair into it’s (major, minor) components.\nGet the width of the rectangle.\nThe width.\nThe horizontal alignment.\nThe x axis of the matrix.\nThe x coordinate.\nThe x coordinate.\nThe vertical alignment.\nThe y axis of the matrix.\nThe y coordinate.\nThe y coordinate.\nA convenience trait for rebuilding a View.\nDerive the Rebuild trait.\nRebuild the view.\nA derived style.\nA style.\nA style key.\nA styled value.\nA collection of styles.\nA theme.\nA value.\nThe accent color.\nThe background color.\nCreate a computed style.\nThe contrast color.\nThe danger color.\nCreate the default dark theme.\nExtend the styles with another collection of styles.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nGet a style.\nGet the value, or a style from the styles.\nGet a style, or a default value.\nGet the value, or a style from the styles.\nGet a style, or a default value.\nGet the value, or a style from the styles.\nThe info color.\nInsert a styled value.\nInsert a style key.\nInsert a style key.\nInsert a style.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCreate a style key.\nCreate the default light theme.\nCreate a new style.\nCreate a new Styles.\nThe outline color.\nThe primary color.\nThe secondary color.\nCreate a collection of styles.\nThe success color.\nThe surface color.\nCreate a style value.\nThe warning color.\nA glyph in the font atlas.\nBlack font weight (900), the boldest possible.\nBold font weight (700).\nA collection of fonts.\nAlign text in the center.\nCondensed font stretch.\nA cursive font family.\nA font loaded from data.\nExtra-bold font weight (800).\nExtra-light font weight (200).\nAlign text at the end.\nExpanded font stretch.\nExtra-condensed font stretch.\nExtra-expanded font stretch.\nA fantasy font family.\nA font atlas.\nA font family, by default FontFamily::SansSerif.\nA source for a font.\nA font stretch.\nA font style.\nA font weight.\nA context for loading and rasterizing fonts.\nItalic font style.\nLight font weight (300).\nMedium font weight (500).\nA monospace font family.\nNormal font weight (400), the default.\nA font family by name, e.g. “Arial”.\nDo not wrap text.\nNormal font stretch, the default.\nNormal font style, the default.\nOblique font style.\nA font loaded from a file.\nSemi-bold font weight (600).\nA sans-serif font family.\nSemi-condensed font stretch.\nSemi-expanded font stretch.\nA serif font family.\nAlign text at the start.\nThin font weight (100), the thinnest possible.\nAlignment of a section of text.\nAttributes of a section of text.\nA convenient wrapper around a cosmic_text::Buffer.\nWrapping of a section of text.\nUltra-condensed font stretch.\nUltra-expanded font stretch.\nWrap text at the word boundary.\nConvert the font family to a fontdb::Family.\nGet the bounds of the text buffer.\nCalculates the size of a text buffer.\nThe glyph cache.\nRasterize a buffer.\nThe font family of the text.\nThe font atlas.\nThe font system.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new text buffer from a raw buffer.\nGet the image of the atlas.\nLoad a font from a file or directory.\nInsert a physical glyph into the atlas.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nThe layout rect of the glyph.\nLoads a font from a FontSource.\nCreate a new font atlas with the given size.\nCreate a new text buffer.\nCreates a new font context.\nPrepare a buffer for rendering.\nGet the raw buffer.\nGet the raw buffer mutably.\nGet the rect of the text buffer.\nSet the align of the text buffer.\nSet the bounds of the text buffer.\nSet the metrics of the text buffer.\nSet the text of the text buffer.\nSet the wrapping mode of the text buffer.\nGet the size of the text buffer.\nThe font size of the text.\nThe font style of the text.\nThe swash cache.\nConvert the text align to a cosmic_text::Align.\nConvert the text wrap to a cosmic_text::Wrap.\nConvert the text attributes to a cosmic_text::Attrs.\nConvert the font weight to a fontdb::Weight.\nConvert the font stretch to a fontdb::Stretch.\nConvert the font style to a fontdb::Style.\nThe uv coordinates of the glyph in the atlas.\nThe font weight of the text.\nAn ease transition curve.\nA transition easing curve.\nA linear transition curve.\nA transition.\nCheck if the transition is complete.\nThe duration of the transition.\nCreate an ease transition with the given duration.\nCreate an ease transition with the given duration.\nThe easing curve.\nEvaluate the easing at t where 0 <= t <= 1.\nReturns the argument unchanged.\nReturns the argument unchanged.\nEvaluate the transition curve at t.\nCalls U::from(self).\nCalls U::from(self).\nCreate a linear transition with the given duration.\nCreate a linear transition with the given duration.\nStep the transition.\nThe view is active.\nThe view needs an animation frame.\nThe state of a BoxedView.\nA view that supports dynamic dispatch.\nA boxed dynamic view.\nThe view needs to be drawn.\nThe view is focusable.\nThe view is focused.\nEquivalent to …\nThe view has an active child.\nThe view has a focused child.\nThe view has a hot child.\nThe view is hot.\nEquivalent to Self::HOT | Self::FOCUSED | Self::ACTIVE.\nThe view needs to be laid out.\nA view that has separate ViewState from its content.\nContents of a view, in a sequence.\nThe state of a PodSeq.\nThe state of a Pod.\nThe state of the sequence.\nThe state of the view, see top-level documentation for …\nFlags that indicate what needs to be updated.\nA single UI component.\nFlags that indicate state of a view.\nAn opaque unique identifier for a view.\nA sequence of views.\nState associated with a View.\nGet a flags value with all known bits set.\nGet a flags value with all known bits set.\nCreate a new BoxedView.\nGet a reference to the underlying Any object.\nGet the underlying id as a u64.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nGet the underlying bits value.\nGet the underlying bits value.\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nBuild the sequence state.\nBuild the view state, see top-level documentation for more …\nBuild the sequence state.\nThe bitwise negation (!) of the bits in a flags value, …\nThe bitwise negation (!) of the bits in a flags value, …\nWhether all set bits in a source flags value are also set …\nWhether all set bits in a source flags value are also set …\nCheck if the view has the property T.\nGet the cursor of the view.\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nDraw the view, see top-level documentation for more …\nDraw the nth view.\nDraw the nth view.\nBuild the view.\nDraw the view.\nHandle an event.\nCalculate the layout.\nRebuild the view.\nGet a flags value with all bits unset.\nGet a flags value with all bits unset.\nHandle an event, see top-level documentation for more …\nHandle an event for the nth view.\nHandle an event for the nth view.\nThe bitwise or (|) of the bits in each flags value.\nThe bitwise or (|) of the bits in each flags value.\nGet the flags of the view.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nConvert from a bits value.\nConvert from a bits value.\nConvert from a bits value exactly.\nConvert from a bits value exactly.\nConvert from a bits value, unsetting any unknown bits.\nConvert from a bits value, unsetting any unknown bits.\nThe bitwise or (|) of the bits in each flags value.\nThe bitwise or (|) of the bits in each flags value.\nGet a flags value with the bits of a flag with the given …\nGet a flags value with the bits of a flag with the given …\nGet the property T of the view.\nGet the property T of the view mutably.\nWhether any of the views in the sequence are active.\nGet whether the view has an active child.\nGet whether the view has a focused child.\nGet whether the view has a hot child.\nGet the id of the view.\nGet the IME of the view.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nInsert a property into the view.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nWhether any set bits in a source flags value are also set …\nWhether any set bits in a source flags value are also set …\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nGet whether the view is active.\nWhether all known bits in this flags value are set.\nWhether all known bits in this flags value are set.\nWhether the sequence is empty.\nWhether all bits in this flags value are unset.\nWhether all bits in this flags value are unset.\nGet whether the view is focusable.\nGet whether the view is focused.\nGet whether the view is hot.\nYield a set of contained flags values.\nYield a set of contained flags values.\nYield a set of contained named flags values.\nYield a set of contained named flags values.\nLayout the view, see top-level documentation for more …\nLayout the nth view.\nLayout the nth view.\nThe length of the sequence.\nThe length of the sequence.\nMark the view as animated.\nMark the view as drawn.\nMark the view as laid out.\nGet whether the view needs an animation frame.\nGet whether the view needs to be drawn.\nGet whether the view needs to be laid out.\nCreate a new pod view.\nCreate a new PodSeq.\nCreate a new ViewId.\nCreate a new ViewState with the given ViewId.\nThe bitwise negation (!) of the bits in a flags value, …\nThe bitwise negation (!) of the bits in a flags value, …\nCreate a new Pod view.\nPrepare the view.\nPropagate the state of a child view.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a value.\nRebuild the sequence state.\nRebuild the view state, see top-level documentation for …\nRebuild the sequence state.\nRebuild the nth view.\nRebuild the nth view.\nGet the rect of the view in local coordinates.\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nRemove a property from the view.\nRequest an animation frame of the view tree.\nRequest a draw of the view tree.\nRequest a layout of the view tree.\nCall insert when value is true or remove when value is …\nCall insert when value is true or remove when value is …\nSet whether the view is active.\nSet the cursor of the view.\nSet whether the view is focusable.\nSet whether the view is focused.\nSet whether the view is hot.\nSet the IME of the view.\nSet the size of the view.\nSet the transform of the view.\nGet the size of the view.\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nGet the transform of the view.\nTranslate the transform of the view.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nGet the Update of the view.\nThe style key of [Text.align::ALIGN].\nThe style key of [TextInput.align::ALIGN].\nThe style key of [Tooltip.align::ALIGN].\nThe style key of [ColorPicker.alpha_color::ALPHA_COLOR].\nA view that aligns its content.\nA view that animates.\nA view that lays out its content with a fixed aspect ratio.\nThe style key of [Checkbox.background::BACKGROUND].\nThe style key of [Collapsing.background::BACKGROUND].\nThe style key of [Container.background::BACKGROUND].\nThe style key of [Slider.background::BACKGROUND].\nThe style key of [Tooltip.background::BACKGROUND].\nThe style key of [Button.border_color::BORDER_COLOR].\nThe style key of [Checkbox.border_color::BORDER_COLOR].\nThe style key of [Collapsing.border_color::BORDER_COLOR].\nThe style key of [ColorPicker.border_color::BORDER_COLOR].\nThe style key of [Container.border_color::BORDER_COLOR].\nThe style key of [Slider.border_color::BORDER_COLOR].\nThe style key of [Tooltip.border_color::BORDER_COLOR].\nThe style key of [Button.border_radius::BORDER_RADIUS].\nThe style key of [Checkbox.border_radius::BORDER_RADIUS].\nThe style key of [Collapsing.border_radius::BORDER_RADIUS].\nThe style key of [Container.border_radius::BORDER_RADIUS].\nThe style key of [Scroll.border_radius::BORDER_RADIUS].\nThe style key of [Slider.border_radius::BORDER_RADIUS].\nThe style key of [Tooltip.border_radius::BORDER_RADIUS].\nThe style key of [Button.border_width::BORDER_WIDTH].\nThe style key of [Checkbox.border_width::BORDER_WIDTH].\nThe style key of [Collapsing.border_width::BORDER_WIDTH].\nThe style key of [ColorPicker.border_width::BORDER_WIDTH].\nThe style key of [Container.border_width::BORDER_WIDTH].\nThe style key of [Slider.border_width::BORDER_WIDTH].\nThe style key of [Tooltip.border_width::BORDER_WIDTH].\nA view that hooks into the build cycle.\nA button.\nThe derived style for Button.\nThe style key of [Button.color::COLOR].\nThe style key of [Checkbox.color::COLOR].\nThe style key of [Scroll.color::COLOR].\nThe style key of [Slider.color::COLOR].\nThe style key of [Text.color::COLOR].\nThe style key of [TextInput.color::COLOR].\nThe style key of [Tooltip.color::COLOR].\nA checkbox.\nThe derived style for Checkbox.\nThe click event.\nA click event.\nA click handler.\nA collapsing view.\nThe derived style for Collapsing.\nA color picker.\nThe derived style for ColorPicker.\nA view that constrains its content to a given space.\nA container view.\nThe derived style for Container.\nThe style key of [Tooltip.delay::DELAY].\nA view that hooks into the draw cycle.\nA view that handles events.\nThe style key of [Button.fancy::FANCY].\nThe style key of [Text.font_family::FONT_FAMILY].\nThe style key of [TextInput.font_family::FONT_FAMILY].\nThe style key of [Tooltip.font_family::FONT_FAMILY].\nThe style key of [Text.font_size::FONT_SIZE].\nThe style key of [TextInput.font_size::FONT_SIZE].\nThe style key of [Tooltip.font_size::FONT_SIZE].\nThe style key of [Text.font_stretch::FONT_STRETCH].\nThe style key of [TextInput.font_stretch::FONT_STRETCH].\nThe style key of [Tooltip.font_stretch::FONT_STRETCH].\nThe style key of [Text.font_style::FONT_STYLE].\nThe style key of [TextInput.font_style::FONT_STYLE].\nThe style key of [Tooltip.font_style::FONT_STYLE].\nThe style key of [Text.font_weight::FONT_WEIGHT].\nThe style key of [TextInput.font_weight::FONT_WEIGHT].\nThe style key of [Tooltip.font_weight::FONT_WEIGHT].\nThe flex value of a view.\nA flexible view.\nA view that focuses on a part of the data.\nThe style key of [Collapsing.icon_color::ICON_COLOR].\nThe style key of [Collapsing.icon_size::ICON_SIZE].\nThe style key of [Scroll.inset::INSET].\nThe style key of [Scroll.knob_color::KNOB_COLOR].\nThe style key of [Slider.length::LENGTH].\nThe style key of […\nThe style key of [Text.line_height::LINE_HEIGHT].\nThe style key of [TextInput.line_height::LINE_HEIGHT].\nThe style key of [Tooltip.line_height::LINE_HEIGHT].\nA lens used by Focus.\nThe style key of [Container.mask::MASK].\nA view that only builds the inner view when certain data …\nA view that bridges the gap between impl View and …\nThe style key of [Button.padding::PADDING].\nThe style key of [Tooltip.padding::PADDING].\nThe style key of […\nA view that adds padding to its content.\nA view that draws something.\nThe press event.\nA view that handles rebuilds.\nThe release event.\nThe style key of [Checkbox.size::SIZE].\nThe style key of [ColorPicker.size::SIZE].\nThe style key of [ColorPicker.slider_width::SLIDER_WIDTH].\nThe style key of [Checkbox.stroke::STROKE].\nA scrollable view.\nThe derived style for Scroll.\nA slider.\nThe derived style for Slider.\nA view that stacks it’s content in a line.\nA view that suspends rendering while a future is pending.\nThe style key of [Button.transition::TRANSITION].\nThe style key of [Checkbox.transition::TRANSITION].\nThe style key of [Collapsing.transition::TRANSITION].\nThe style key of [Scroll.transition::TRANSITION].\nA view that displays text.\nA text input.\nThe derived style for TextInput.\nThe derived style for Text.\nA view that displays some text when the content is hovered.\nThe derived style for Tooltip.\nA view that transforms its content.\nA view that creates a trigger around the content.\nThe style key of [Scroll.width::WIDTH].\nThe style key of [Slider.width::WIDTH].\nThe style key of [Text.wrap::WRAP].\nThe style key of [TextInput.wrap::WRAP].\nThe style key of [Tooltip.wrap::WRAP].\nA view that stores some additional data.\nA view that applies a style to its content.\nA view that lays out it’s content in a line wrapping if …\nA view that overlays its content on top of each other.\nSet the build callback for after the content is built.\nSet the callback for when an event is emitted.\nThe build callback.\nThe callback after an event is propagated.\nCreate a new Aligned view.\nSet self.align.\nSet self.align.\nSet self.align.\nSet self.align.\nHow to align the content along the cross axis, within each …\nThe horizontal alignment of the text.\nThe style of Text::align.\nThe vertical alignment of the text.\nThe style of TextInput::align.\nThe horizontal alignment of the text.\nThe style of Tooltip::align.\nHow to align the content along the cross axis.\nThe alignment.\nSet self.alpha_color.\nThe color of the alpha slider.\nThe style of ColorPicker::alpha_color.\nSet the flex value of the view.\nThe flex value.\nCreate a new Animate.\nThe animation callback.\nCreate a new Stack, with dynamic content.\nCreate a new Wrap, with dynamic content.\nCreate a new horizontal Stack, with dynamic content.\nCreate a new vertical Stack, with dynamic content.\nThe aspect ratio of the content.\nSet self.axis.\nSet self.axis.\nSet self.axis.\nThe axis of the scroll.\nThe axis of the slider.\nThe axis of the stack.\nThe axis.\nCreate a new Container with background.\nSet self.background.\nSet self.background.\nSet self.background.\nSet self.background.\nThe background color.\nThe style of Checkbox::background.\nThe background color of the header.\nThe style of Collapsing::background.\nThe background color.\nThe style of Container::background.\nThe background color of the slider.\nThe style of Slider::background.\nThe background color of the text.\nThe style of Tooltip::background.\nSet the callback for before an event is emitted.\nThe callback before an event is propagated.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nThe border color.\nThe style of Button::border_color.\nThe border color.\nThe style of Checkbox::border_color.\nThe color of the border of the header.\nThe style of Collapsing::border_color.\nThe border color of the color picker.\nThe style of ColorPicker::border_color.\nThe border color.\nThe style of Container::border_color.\nThe border color of the slider.\nThe style of Slider::border_color.\nThe border color of the text.\nThe style of Tooltip::border_color.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nThe border radius.\nThe style of Button::border_radius.\nThe border radius.\nThe style of Checkbox::border_radius.\nThe border radius of the header.\nThe style of Collapsing::border_radius.\nThe border radius.\nThe style of Container::border_radius.\nThe radius of the scrollbar.\nThe style of Scroll::border_radius.\nThe border radius of the slider.\nThe style of Slider::border_radius.\nThe border radius of the text.\nThe style of Tooltip::border_radius.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nThe border width.\nThe style of Button::border_width.\nThe border width.\nThe style of Checkbox::border_width.\nThe border width of the header.\nThe style of Collapsing::border_width.\nThe border width of the color picker.\nThe style of ColorPicker::border_width.\nThe border width.\nThe style of Container::border_width.\nThe border width of the slider.\nThe style of Slider::border_width.\nThe border width of the text.\nThe style of Tooltip::border_width.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Button.\nSet self.button.\nThe button to listen for.\nThe callback.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Checkbox.\nSet self.checked.\nWhether the checkbox is checked.\nCreate a new Painter view that draws a circle.\nCreate a new Collapsing.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nThe color of the button.\nThe style of Button::color.\nThe color of the checkbox.\nThe style of Checkbox::color.\nThe color of the color picker.\nThe color of the scrollbar.\nThe style of Scroll::color.\nThe foreground color of the slider.\nThe style of Slider::color.\nThe color of the text.\nThe style of Text::color.\nThe color of the text.\nThe style of TextInput::color.\nThe color of text.\nThe style of Tooltip::color.\nCreate a new ColorPicker.\nSet self.column_gap.\nThe gap between each column.\nCreate a new Constrained view, constraining its content to …\nCreate a new Container.\nSet self.content.\nThe content.\nThe content.\nThe content.\nThe content view.\nThe content.\nThe content.\nThe content view.\nThe content to align.\nThe content.\nThe content.\nThe content.\nThe content.\nThe content to constrain.\nThe content.\nThe content of the view.\nThe content.\nThe content.\nThe content of the stack.\nThe content to display.\nThe content.\nThe content.\nThe content to overlay.\nSet self.default_open.\nWhether the view is open by default.\nThe delay before the tooltip is displayed.\nThe style of Tooltip::delay.\nSet self.descendants.\nWhether the item should be clickable when it’s …\nSet self.draw.\nThe draw function.\nCreate a new Painter view that draws an ellipse.\nSet self.event.\nThe event to listen for.\nCreate a new expanded Flexible view.\nSet the fallback view to display while the future is …\nSet self.fancy.\nThe distance of the fancy effect.\nThe style of Button::fancy.\nCreate a new Flexible view.\nThe flex value of the view.\nCreate a new Focus.\nSet self.font_family.\nSet self.font_family.\nThe font family of the text.\nThe style of Text::font_family.\nThe font family of the text.\nThe style of TextInput::font_family.\nThe font family of the text.\nThe style of Tooltip::font_family.\nSet self.font_size.\nSet self.font_size.\nThe font size of the text.\nThe style of Text::font_size.\nThe font size of the text.\nThe style of TextInput::font_size.\nThe font size of the text.\nThe style of Tooltip::font_size.\nSet self.font_stretch.\nSet self.font_stretch.\nThe font stretch of the text.\nThe style of Text::font_stretch.\nThe font stretch of the text.\nThe style of TextInput::font_stretch.\nThe font stretch of the text.\nThe style of Tooltip::font_stretch.\nSet self.font_style.\nSet self.font_style.\nThe font.into of the text.\nThe style of Text::font_style.\nThe font.into of the text.\nThe style of TextInput::font_style.\nThe font style of the text.\nThe style of Tooltip::font_style.\nSet self.font_weight.\nSet self.font_weight.\nThe font weight of the text.\nThe style of Text::font_weight.\nThe font weight of the text.\nThe style of TextInput::font_weight.\nThe font weight of the text.\nThe style of Tooltip::font_weight.\nCreate a formatted Text.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nSet self.gap.\nSet the gap for both the rows and columns.\nThe gap between children.\nThe header.\nCreate a new Constrained view, constraining its content to …\nSet the minimum height.\nCreate a new horizontal Stack.\nCreate a new horizontal Wrap.\nCreate a new horizontal Wrap, with dynamic content.\nCreate a new horizontal Wrap, with a vector of content.\nCreate a new horizontal Scroll.\nCreate a horizontal Stack.\nCreate a horizontal Stack.\nCreate a horizontal Stack.\nCreate a horizontal Stack, with dynamic content.\nCreate a horizontal Stack, with vector content.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap, with dynamic content.\nCreate a horizontal Wrap, with a vector of content.\nSet self.icon_color.\nThe color of the icon.\nThe style of Collapsing::icon_color.\nSet self.icon_size.\nThe size of the icon.\nThe style of Collapsing::icon_size.\nThe inset of the scrollbar.\nThe style of Scroll::inset.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nGet whether the stack is empty.\nGet whether the wrap is empty.\nWhether the view is tight.\nSet self.justify.\nSet self.justify.\nHow to justify the content along the main axis.\nHow to justify the content along the main axis.\nSet self.justify_cross.\nHow to justify the content along the cross axis.\nThe color of the scrollbar knob.\nThe style of Scroll::knob_color.\nCreate a new Aligned view that aligns its content to the …\nGet the number of views in the stack.\nGet the number of views in the wrap.\nSet self.length.\nThe length of the slider.\nThe style of Slider::length.\nSet self.lightness_color.\nThe color of the lightness slider.\nThe style of ColorPicker::lightness_color.\nSet self.line_height.\nSet self.line_height.\nThe line height of the text.\nThe style of Text::line_height.\nThe line height of the text.\nThe style of TextInput::line_height.\nThe line height of the text.\nThe style of Tooltip::line_height.\nSet self.marker.\nSet self.mask.\nWhether to mask the content.\nThe style of Container::mask.\nCreate a new Constrained view, constraining its content to …\nSet the maximum height.\nCreate a new Constrained view, constraining its content to …\nSet the maximum size.\nCreate a new Constrained view, constraining its content to …\nSet the maximum width.\nCreate a new Memo.\nCreate a new Constrained view, constraining its content to …\nSet the minimum height.\nCreate a new Constrained view, constraining its content to …\nSet the minimum size.\nCreate a new Constrained view, constraining its content to …\nSet the minimum width.\nSet self.multiline.\nWhether the input is multi-line.\nCreate a new Animate.\nCreate a new BuildHandler.\nCreate a new DrawHandler.\nCreate a new EventHandler.\nCreate a new Focus.\nCreate a new Memo.\nCreate a new opaque view.\nCreate a new RebuildHandler.\nCreate a new Suspense view.\nCreate a new Trigger.\nCreate a new WithState.\nCreate a new WithStyle view.\nCreate a new aligned view.\nCreates a new Aspect view.\nCreate a new Button.\nCreate a new Checkbox.\nCreate a new Clickable.\nCreate a new Collapsing view.\nCreate a new ColorPicker.\nCreate a new constrained view.\nCreate a new Container.\nCreate a new flexible view.\nCreate a new Pad view.\nCreate a new Painter view.\nCreate a new scrollable view.\nCreate a new Slider.\nCreate a new Stack.\nCreate a new text.\nCreate a new text input view.\nCreate a new tooltip view.\nCreate a new Transform view.\nCreate a new Wrap.\nCreate a new overlay view.\nCreate a new BuildHandler.\nCreate a new Clickable, that calls on_click when clicked.\nCreate a new DrawHandler.\nSet the draw callback.\nThe draw callback.\nCreate a new EventHandler, with an after callback.\nCreate a new EventHandler, with a before callback.\nSet the on_input callback.\nSet the callback for when the value changes.\nSet the callback that is called when an input is received.\nThe on_input callback.\nThe callback for when the value changes.\nA callback that is called when an input is received.\nSet a callback for when the view is opened or closed.\nA callback for when the view is opened or closed.\nCreate a new Clickable, that calls on_press when pressed.\nCreate a new RebuildHandler.\nCreate a new Clickable, that calls on_release when …\nSet the callback that is called when the input is …\nA callback that is called when the input is submitted.\nA view that bridges the gap between impl View and …\nSet self.open.\nWhether the view is open.\nCreate a new Pad view.\nCreate a new Pad view adding padding to the bottom.\nCreate a new Pad view adding padding to the left.\nCreate a new Pad view adding padding to the right.\nCreate a new Pad view adding padding to the top.\nSet self.padding.\nThe padding.\nThe style of Button::padding.\nThe padding.\nThe padding of the text.\nThe style of Tooltip::padding.\nCreate a new Painter view.\nSet self.placeholder.\nPlaceholder text to display when the input is empty.\nSet self.placeholder_color.\nThe color of the placeholder text.\nThe style of TextInput::placeholder_color.\nPush a view to the stack.\nPush a view to the wrap.\nSet self.range.\nThe range of the slider.\nRebuild the style of Button.\nRebuild the style of Checkbox.\nRebuild the style of Collapsing.\nRebuild the style of ColorPicker.\nRebuild the style of Container.\nRebuild the style of Scroll.\nRebuild the style of Slider.\nRebuild the style of Text.\nRebuild the style of TextInput.\nRebuild the style of Tooltip.\nThe callback for when a rebuild is requested.\nCreate a new Painter view that draws a rectangle.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Transform view that rotates its content.\nCreate a new Transform view that rotates its content in …\nSet self.row_gap.\nThe gap between each row.\nCreate a new Transform view that scales its content.\nCreate a new Constrained view, cosntraining its content to …\nSet self.size.\nSet self.size.\nSet self.size.\nThe size of the checkbox.\nThe style of Checkbox::size.\nThe size of the color picker.\nThe style of ColorPicker::size.\nThe size of the view.\nCreate a new Slider.\nSet self.slider_width.\nThe width of the sliders.\nThe style of ColorPicker::slider_width.\nThe space to constrain the content to.\nSet self.stroke.\nThe stroke width of the checkbox.\nThe style of Checkbox::stroke.\nThe style to apply.\nThe style of Button.\nThe style of Checkbox.\nThe style of Collapsing.\nThe style of ColorPicker.\nThe style of Container.\nThe style of Scroll.\nThe style of Slider.\nThe style of Text.\nThe style of TextInput.\nThe style of Tooltip.\nCreate a new Suspense view.\nCreate a new Text.\nSet self.text.\nSet the text of the input.\nThe text.\nThe text.\nThe text to display.\nCreate a formatted Text.\nCreate a new TextInput.\nWhether the view is tight.\nCreate a new Tooltip view.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Transform view.\nThe transform.\nAnimate a transition.\nSet self.transition.\nSet self.transition.\nSet self.transition.\nThe transition of the button.\nThe style of Button::transition.\nThe transition of the checkbox.\nThe style of Checkbox::transition.\nThe transition of the view.\nThe style of Collapsing::transition.\nThe transition of the scrollbar.\nThe style of Scroll::transition.\nAnimate a view when active changes.\nAnimate a view when focused changes.\nAnimate a view when hot changes.\nCreate a new Transform view that translates its content.\nCreate a new Trigger view.\nCreate a new constrained view, with no bounds.\nSet self.value.\nThe value of the slider.\nCreate a new Stack, with vector content.\nCreate a new Wrap, with a vector of content.\nCreate a new horizontal Stack, with vector content.\nCreate a new vertical Stack, with vector content.\nCreate a new vertical Stack.\nCreate a new vertical Wrap.\nCreate a new vertical Wrap, with dynamic content.\nCreate a new vertical Wrap, with a vector of content.\nCreate a new vertical Scroll.\nCreate a vertical Stack.\nCreate a vertical Stack.\nCreate a vertical Stack.\nCreate a vertical Stack, with dynamic content.\nCreate a vertical Stack, with vector content.\nCreate a vertical Wrap.\nCreate a vertical Wrap.\nCreate a vertical Wrap.\nCreate a vertical Wrap, with dynamic content.\nCreate a vertical Wrap, with a vector of content.\nCreate a new Constrained view, constraining its content to …\nSet the minimum width.\nSet self.width.\nThe width of the scrollbar.\nThe style of Scroll::width.\nThe width of the slider.\nThe style of Slider::width.\nPush a view to the stack.\nPush a view to the wrap.\nCreate a new WithState that replaces the data with the …\nCreate a new WithState that replaces the data with the …\nCreate a new WithState.\nCreate a new WithState using S::default().\nCreate a view that applies a style to its content.\nCreate a new view unwrapping some data from the state.\nCreate a new view unwrapping some state from the data.\nSet self.wrap.\nSet self.wrap.\nThe text wrap of the text.\nThe style of Text::wrap.\nThe text wrap of the text.\nThe style of TextInput::wrap.\nThe text wrap of the text.\nThe style of Tooltip::wrap.\nCreate a new ZStack view.\nCreate a new ZStack view.\nCreate a new ZStack view.\nSet the color of the window.\nThe root View will have Space::UNBOUNDED, and the window …\nA mouse cursor icon.\nSet the cursor of the window.\nSet whether the window is decorated.\nThe window will have a fixed size equal to Window::size.\nSet the icon of the window.\nSet the ime state of the window.\nSet whether the window is maximized.\nThe state of a pointer.\nSet whether the window is resizable.\nSet the scale of the window.\nSet the size of the window.\nSet the title of the window.\nSet whether the window is visible.\nA window.\nA unique identifier for a window.\nThe sizing of a window.\nThe state of a window.\nAn update to a window.\nSet the color of the window.\nThe color of the window.\nThe color of the window.\nSet whether the window is decorated.\nWhether the window is decorated.\nWhether the window is decorated.\nGet the difference between a window and a previous state.\nSet the sizing to WindowSizing::Content.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nGet the pointer with pointer_id.\nGet the pointer with pointer_id mutably.\nGet the height of the window.\nThe view the pointer is over.\nSet the icon of the window.\nThe icon of the window.\nThe icon of the window.\nGet the unique identifier of the pointer.\nGet the unique identifier of the window.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nGet whether a specific view is hovered.\nGet whether button is held down on pointer with pointer_id.\nGet whether a button is pressed.\nSet whether the window is maximized.\nWhether the window is maximized.\nWhether the window is maximized.\nMove a pointer, returning the movement.\nReturns the name of the cursor.\nCreate a new pointer.\nCreate a new WindowId.\nCreate a new Window.\nGet the size of the window in physical pixels.\nGet the pointers in the window.\nGet the pointers in the window mutably.\nThe position of the pointer.\nPress a button.\nPress a button on a pointer.\nRelease a button, returning whether the button was clicked.\nRelease a button on a pointer.\nRemove a pointer.\nSet whether the window is resizable.\nWhether the window is resizable.\nWhether the window is resizable.\nSet the scale of the window.\nThe scale of the window.\nThe scale of the window.\nSet the size of the window.\nThe size of the window.\nThe size of the window.\nSet the sizing of the window.\nThe sizing of the window.\nGet the WindowSnapshot of the window.\nSet the title of the window.\nThe title of the window.\nThe title of the window.\nUpdate the window.\nSet whether the window is visible.\nWhether the window is visible.\nWhether the window is visible.\nGet the width of the window.")
\ No newline at end of file
+searchState.loadedDescShard("ori_core", 0, "Core library for the Ori UI framework.\nCanvas module.\nClipboard.\nA channel for sending commands to the user interface.\nContexts for views.\nEvents and event handling.\nCreate a formatted Text.\nCreate a horizontal Stack.\nCreate a horizontal Wrap.\nImage data and processing.\nLayout of Views.\nRebuild trait and derive macro.\nStyleing and theming.\nCreate a collection of styles.\nText rendering and layouting.\nTransition utilities.\nView module.\nThe builtin views in Ori.\nCreate a vertical Stack.\nCreate a vertical Wrap.\nWindowing system abstraction layer.\nCreate a new ZStack view.\nWays to anti-alias a shape.\nThe strokes are joined with a beveled corner.\nWays to blend two colors.\nRadi of the corners on a rounded rectangle.\nThe border width of a rounded rectangle.\nThe end of the stoke is squared off.\nA canvas that can be drawn on.\nReplaces the destination with zero.\nA close verb.\nClose the curve.\nA color with red, green, blue and alpha components.\nA cubic verb.\nCubic bezier curve to a point.\nA bezier curve.\nAn iterator over the segments of a curve.\nA segment of a curve.\nA verb that describes the type of curve.\nPreserves the destination.\nDestination over source.\nA type for displaying a color as a hex string.\nA point is inside the shape if a ray from the point …\nFast anti-aliasing.\nA filled curve.\nRule determining if a point is inside a shape.\nAnti-aliasing.\nA layer that can be transformed and masked.\nA line verb.\nLine to a point.\nA mask that can be used to clip a layer.\nThe strokes are joined with a sharp corner.\nA move verb.\nMove to a point.\nA point is inside the shape if a ray from the point …\nNo anti-aliasing.\nA paint that can be used to fill or stroke a shape.\nA pattern that can be used to fill a shape.\nA pattern.\nA primitive that can be drawn on a canvas.\nA quad verb.\nQuadratic bezier curve to a point.\nThe end of the stroke is rounded.\nThe strokes are joined with a rounded corner.\nWays to fill a shape.\nA solid color.\nReplaces the destination with the source.\nSource over destination.\nThe end of the stroke is squared off and extends past the …\nProperties of a stroke.\nA stroked curve.\nWays to draw the end of a stroke.\nWays to join two segments of a stroke.\nA BorderRadius with zero radius on all corners.\nA BorderWidth with zero width on all borders.\nThe alpha component of the color.\nGet the alpha component as an 8 bit integer.\nCreate a new BorderRadius with the same radius on all …\nCreate a new BorderWidth with the same width on all …\nWhether the paint should be anti-aliased.\nConvert the hex color display to a &str.\nConvert the hex color display to a &str.\nThe blue component of the color.\nGet the blue component as an 8 bit integer.\nThe blend mode of the paint.\nThe bottom border width.\nThe bottom left corner radius.\nThe bottom right corner radius.\nGet the bounds of the curve.\nThe cap of the stroke.\nCreate a curve from a cicrle.\nClear the canvas.\nClear the curve, retaining the allocated memory for reuse.\nClose the contour.\nThe color of the pattern.\nDraw a conic curve to a point, with a control point control…\nCheck if the curve contains a point using the given rule.\nCount the number of primitives.\nDraw a cubic bezier curve to a point, with control points a…\nThe curve of the mask.\nDarken the color by the given amount.\nDesaturates the color by given amount.\nDraw a canvas.\nCreate a curve from an oval.\nFade the color by the given amount.\nFill a curve.\nThe fill rule of the mask.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nThe green component of the color.\nGet the green component as an 8 bit integer.\nCreate a new color with the given gray component.\nCreate a new color, with the given hex string.\nParse a color from a hex string.\nDraw a layer with a view.\nCreate a new color, with the given hue, saturation and …\nReturns a new color with the given hue, saturation, …\nCreate a new color, with the given hue, saturation, …\nReturns a new color with the given hue, saturation, …\nCreate a new color, with the given hue, saturation and …\nReturns a new color with the given hue, saturation and …\nCreate a new color, with the given hue, saturation, value …\nReturns a new color with the given hue, saturation, value …\nThe image of the pattern.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck if the curve is closed.\nCheck if the curve is empty.\nReturns true if the color is translucent.\nReturns true if the color is transparent.\nCheck if the curve is valid.\nGet an iterator over the curve segments.\nThe join of the stroke.\nGet the last point in the curve.\nDraw a layer.\nThe left border width.\nGet the number of verbs in the curve.\nBrighten the color by the given amount.\nDraw a line to a point.\nGet the luminocity.\nDraw a layer with a mask.\nGet the maximum radius of the corners.\nGet the minimum radius of the corners.\nThe miter limit of the stroke.\nLinearly interpolate between two colors.\nLinearly interpolate between two colors.\nMove to a point.\nCreate a new BorderRadius.\nCreate a new BorderWidth.\nCreate a new mask.\nCreate a new canvas.\nCreate a new hex color display with the given red, green, …\nCreate a new curve.\nCreate a new color, with the given hue, saturation and …\nConvert a color from okhsl to sRGB.\nCreate a new color, with the given hue, saturation, …\nConvert a color from okhsl to sRGB.\nCreate a new color, with the given hue, saturation and …\nConvert a color from okhsv to sRGB.\nCreate a new color, with the given hue, saturation, value …\nConvert a color from okhsv to sRGB.\nCreate a new color, with the given lightness, a and b …\nConvert a color from oklab to sRGB.\nCreate a new color, with the given lightness, a, b and …\nConvert a color from oklab to sRGB.\nCreate a new color, with the given lightness, chroma and …\nConvert a color from oklch to sRGB.\nCreate a new color, with the given lightness, chroma, hue …\nConvert a color from oklch to sRGB.\nDraw an overlay.\nGet the number of points for the verb.\nGet the points in the curve.\nGet the primitives of the canvas.\nPush an oval to the curve.\nPush a rectangle to the curve.\nPush the border of a rectangle with rounded corners to the …\nPush a rectangle with rounded corners to the curve.\nDraw a quadratic bezier curve to a point, with a control …\nThe red component of the color.\nGet the red component as an 8 bit integer.\nDraw a rectangle.\nCreate a curve from a rectangle.\nCreate a new color, with the given red, green and blue …\nCreate a new color with the given red, green and blue …\nCreate a new color, with the given red, green, blue and …\nCreate a new color with the given red, green, blue and …\nCreate a new color with the given red, green, blue and …\nThe right border width.\nDraw a layer with a rotation.\nSaturates the color by given amount.\nDraw a layer with a scale.\nThe shader of the paint.\nStroke a curve.\nStroke the curve with the given stroke.\nConvert the color to hex.\nConvert the color to a hue, saturation, lightness tuple.\nConvert the color to a hue, saturation, lightness and …\nConvert the color to a hue, saturation, value tuple.\nConvert the color to a hue, saturation, value and alpha …\nConvert a color from sRGB to okhsl.\nConvert a color from sRGB to okhsl.\nConvert a color from sRGB to okhsv.\nConvert a color from sRGB to okhsv.\nConvert a color from sRGB to oklab.\nConvert a color from sRGB to oklab.\nConvert a color from sRGB to oklch.\nConvert a color from sRGB to oklch.\nConvert the color to linear sRGB.\nConvert the color to linear sRGB.\nThe top border width.\nThe top left corner radius.\nThe top right corner radius.\nTransform the curve by the given affine transform.\nThe transformation of the pattern.\nDraw a layer with a transformation.\nDraw a layer with a translation.\nDraw a trigger rectangle.\nTry to parse a color from a hex string.\nGet the verbs in the curve.\nGet the view at a point.\nThe width of the stroke.\nThe curve to draw.\nThe curve to draw.\nThe fill rule of the curve.\nThe mask of the layer.\nThe paint to fill the curve with.\nThe paint to stroke the curve with.\nThe primitives of the layer.\nThe stroke properties of the curve.\nThe transformation of the layer.\nThe view of the layer.\nA clipboard.\nA clipboard backend.\nReturns the argument unchanged.\nGet the clipboard text.\nGet the clipboard text.\nCalls U::from(self).\nCreate a new clipboard from a backend.\nSet the clipboard text.\nSet the clipboard text.\nA command containing arbitrary data.\nA clonable channel for sending Commands.\nA receiver for Commands.\nA waker for the event loop, triggered when a command is …\nSend a command.\nSpawn a future sending a command when it completes.\nSend a command without waking the event loop.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nTry to downcast the command to T.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck whether the command is of type T.\nGet the name of the command.\nCreate a new command.\nCreate a new CommandWaker.\nCreate a new CommandProxy channel.\nSpawn a future that is polled when commands are handled.\nConvert the command into a boxed Any value.\nTry receive a command.\nWake the event loop.\nWake the event loop.\nA base context that is shared between all other contexts.\nA context for building the view tree.\nA context for a view.\nA context for drawing the view tree.\nA context for handling events.\nA context for laying out the view tree.\nA context for rebuilding the view tree.\nGet whether the view’s active state changed.\nRequest an animation frame.\nRequest an animation frame.\nRequest an animation frame.\nGet a build context.\nGet a build context.\nGet a layout context.\nGet a rebuild context.\nGet the canvas.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nCreate a child context.\nGet the Clipboard.\nEmit a command.\nSpawn a future sending a command when it completes.\nCheck if the context is present.\nCheck if a context is contained.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nCheck if the view has the property T.\nGet a context.\nGet a mutable context.\nGet a context or insert a default.\nGet a reference to the Contexts.\nGet a mutable reference to the Contexts.\nRequest a draw of the view tree.\nRequest a draw of the view tree.\nRequest a draw of the view tree.\nDraw a canvas.\nFill a curve.\nDraw a rectangle.\nGet whether the view’s focused state changed.\nGet the Fonts.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nGet a context.\nGet a context.\nGet a mutable context.\nGet a mutable context.\nGet a context or insert a default.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet the property T of the view mutably.\nGet whether a child view was active last call.\nGet whether a child view was focused last call.\nGet whether a child view was hot last call.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view is active.\nGet whether a child view’s active state changed.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view is focused.\nGet whether a child view’s focused state changed.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view is hot.\nGet whether a child view’s hot state changed.\nGet whether the view’s hot state changed.\nDraw a hoverable layer.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nGet the id of the view.\nPush a context.\nInsert a context.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nInsert a property into the view.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nGet whether the view is active.\nCheck if there are no contexts.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is focused.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nGet whether the view is hot.\nCheck if a rect is visible.\nRequest a layout of the view tree.\nRequest a layout of the view tree.\nRequest a layout of the view tree.\nGet the number of contexts.\nTransform a point from global space to local space.\nDraw a layer with a mask.\nCreate a new base context.\nCreate a new build context.\nCreate a new draw context.\nCreate a new event context.\nCreate a new layout context.\nCreate a new rebuild context.\nCreate a new context.\nDraw an overlay, at index.\nPrepare text for drawing.\nPrepare text for drawing.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a value.\nGet the CommandProxy.\nDraw a rectangle with rounded corners and a border.\nRequest a rebuild of the view tree.\nGet the rect of the view in local space.\nGet the rect of the view in local space.\nGet the rect of the view in local space.\nPop a context.\nRemove a context.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nRemove a property from the view.\nDraw a layer with a rotation.\nDraw a layer with a scale.\nSet whether the view is active.\nSet whether the view is active.\nSet whether the view is active.\nSet the cursor of the view.\nSet the cursor of the view.\nSet the cursor of the view.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is focused.\nSet whether the view is hot.\nSet whether the view is hot.\nSet whether the view is hot.\nSet the ime of the view.\nGet the size of the view.\nGet the size of the view.\nGet the size of the view.\nSpawn a future.\nStroke a curve.\nGet the styles.\nGet the styles.\nGet the styles.\nGet the styles.\nGet the styles.\nDraw a text buffer.\nDraw a raw text buffer.\nGet the transform of the view.\nGet the transform of the view.\nDraw a layer with a transform.\nDraw a layer with a translation.\nDraw a trigger rectangle.\nGet whether the view was active last call.\nGet whether the view was focused last call.\nGet whether the view was hot last call.\nGet the window.\nGet the window.\nGet the window.\nGet the window.\nGet the window.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nGet the window mutably.\nAn animation frame has passed.\nThe back button.\nEvent emitted when a window wants to close.\nThe window requested to be close.\nA keyboard key-code.\nA command was sent.\nAn event that can be sent to a view.\nThe forward button.\nInput Method Editor (IME) state.\nA trait for checking if something is a certain key.\nA keyboard key.\nAn event fired when a key is pressed.\nA keyboard key was pressed.\nAn event fired when a key is released.\nA keyboard key was released.\nModifiers for keyboard and pointer events.\nOther buttons.\nA pointer button.\nA unique pointer id.\nA pointer left the window.\nA pointer left the window.\nA pointer was moved.\nA pointer moved.\nA pointer button was pressed.\nA pointer button was pressed.\nA pointer button was released.\nA pointer button was released.\nA pointer wheel was scrolled.\nA pointer was scrolled.\nThe primary button, usually the left mouse button or the …\nThe secondary button, usually the right mouse button.\nThe tertiary button, usually the middle mouse button.\nView state needs to be updated.\nEvent emitted when a window is maximized.\nThe window was maximized.\nEvent emitted when a window is resized.\nThe window was resized.\nEvent emitted when a window is scaled.\nThe window was scaled.\nWhether the alt key is held down.\nCheck if any modifiers are held down.\nGet a character from the key.\nGet the unique id as a u64.\nThe button of the pointer.\nThe button of the pointer.\nWhether the button was clicked.\nTry to get the command as a specific type.\nThe code of the key that was pressed.\nThe code of the key that was released.\nThe current composition range.\nWhether the control key is held down.\nThe delta of the pointer.\nThe delta of the pointer.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new pointer id from a hashable value.\nConvert a Linux scancode to a key code.\nCreate a new pointer button from a u16.\nCreate a new pointer id from a u64.\nThe new height of the window.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nThe unique id of the pointer.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCheck if the key is the given key.\nCheck if the event is a command of a specific type.\nCheck if the key is pressed.\nCheck if the key is released.\nCheck if the event represents a key press of a specific …\nCheck if the event represents a key release of a specific …\nThe key that was pressed, ignoring modifiers.\nThe key that was released, ignoring modifiers.\nWhether the window is maximized or not.\nWhether the meta key is held down.\nThe modifiers that were active.\nThe modifiers that were active.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe modifiers of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe position of the pointer.\nThe new scale factor of the window.\nThe current selection range.\nWhether the shift key is held down.\nGet the new size of the window.\nThe current text being edited.\nThe text that was entered.\nThe new width of the window.\nThe window that wants to close.\nThe window that was resized.\nThe window that was scaled.\nThe window that was maximized.\nA texture managed by the rendering backend.\nAn clonable image.\nAn Image texture.\nImage data.\nA unique identifier for an Image.\nA texture.\nAn opaque backend texture identifier.\nA weak reference to an Image.\nMultiply the image with a color.\nCompute the id for this image data.\nGet the pixels.\nGet the pixels mutably.\nDowngrade the image to a weak reference.\nGet the filter mode.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new TextureId from an index.\nGet a pixel.\nGet the height of the image in pixels.\nGet the ImageId.\nGet the ImageId.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nModify the image data.\nPremultiply the image alpha.\nCreate a new image data.\nCreate a new image.\nCreate a new TextureId.\nPremultiply the image alpha, returning a new image.\nSet the filter mode.\nSet a pixel.\nGet the size of the image in pixels.\nGet the number of strong references to the image.\nConvert the TextureId to an index.\nGet the number of weak references to the image.\nGet the width of the image in pixels.\nAn affine transformation in 2 dimensional space.\nThe alignment of items along the cross axis.\nAlignment of content inside a container.\nAn axis is a direction in which a layout is applied.\nAlign the content at the bottom of the container.\nAlign the content at the bottom left of the container.\nAlign the content at the bottom right of the container.\nAlign the content at the center of the container.\nItems are packed toward the center of the stack.\nItems are packed toward the center of the stack.\nItems are packed toward the end of the stack.\nItems are packed toward the end of the stack.\nA constant used to indicate that a dimension should fill …\nAlias for Self::INFINITY.\nThe infinite space.\nItems are stretched to fill the available space.\nThe horizontal axis.\nThe identity transformation.\nThe identity matrix.\nThe infinite size.\nThe justify content of a stack container.\nAn iterator over the positions of items in a stack …\nAlign the content at the left of the container.\nA 2x2 matrix.\nThe negative unit x point.\nThe negative unit x vector.\nThe negative unit y point.\nThe negative unit y vector.\nThe one point.\nThe one vector.\nA padding of a rectangle.\nA point in 2D space.\nAlign the content at the right of the container.\nA rectangle defined by its minimum and maximum points.\nA 2 dimensional size.\nSpace available to lay out a view.\nItems are evenly distributed in the stack, with half-size …\nItems are evenly distributed in the stack, with equal-size …\nItems are evenly distributed in the stack.\nItems are packed toward the start of the stack.\nItems are packed toward the start of the stack.\nItems are stretched to all have the same size.\nAlign the content at the top of the container.\nAlign the content at the top left of the container.\nAlign the content at the top right of the container.\nThe unbounded size.\nThe unbounded space.\nA 2D vector.\nThe vertical axis.\nThe unit x point.\nThe unit x vector.\nThe unit y point.\nThe unit y vector.\nThe zero point.\nA rectangle with zero area.\nThe zero size.\nThe zero space.\nThe zero vector.\nAlign the content inside the container.\nAligns an item within the given space.\nCreate a new Padding with the same value for all sides.\nCreate a new point with the same x and y.\nCreate a new size with the same width and height.\nCreate a new vector with the same x and y.\nGet the angle of the vector.\nGet the angle between self and other.\nGet the area of the rectangle.\nGet the bottom edge of the rectangle.\nThe bottom padding.\nGet the bottom center point of the rectangle.\nGet the bottom left point of the rectangle.\nGet the bottom right point of the rectangle.\nCeil the point by element.\nCeil self by element.\nCeil the vector by element.\nGet the center point of the rectangle.\nGet the left center point of the rectangle.\nGet the right center point of the rectangle.\nCreate a new rectangle with the given center point and …\nClamp self to the range [min, max] by element.\nClamp the rectangle to the given rectangle.\nClamp self to the range [min, max] by element.\nClamp self to the range [min, max] by element.\nGet the most constraning space between self and `other\nCompute the closest point in the rectangle to the given …\nCompute whether the rectangle contains the given point.\nGet the length of the cross product of self and other.\nCompute the determinant of the matrix.\nCompute the dot distance between two points.\nGet the dot product of self and other.\nExpand the space by size.\nIf self is finite, return self, otherwise return zero. …\nClamp a size to the space.\nFloor the point by element.\nFloor self by element.\nFloor the vector by element.\nGet the fractional component by element.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new matrix from an angle.\nCreate a new vector from an angle.\nCreate a new matrix from a scale.\nCreate a new space with the same minimum and maximum size.\nHat the vector.\nGet the height of the rectangle.\nThe height.\nExpand the rectangle to contain the given point.\nExpand the rectangle by the given amount.\nCompute the intersection of the rectangle with the given …\nCheck if the rectangle intersects the given rectangle.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCompute the inverse transformation.\nCompute the inverse of the matrix.\nCheck if the point is finite.\nGet whether the size is finite.\nGet whether the space is finite.\nCheck if the point is infinite.\nGet whether the size is infinite.\nGet whether the space is infinite.\nCheck if the point is NaN.\nLayout the items in a stack container.\nGet the left edge of the rectangle.\nThe left padding.\nGet the length of the vector.\nGet the length of the vector squared.\nLinearly interpolate between two points.\nLoosen the space, setting the minimum size to zero.\nLoosen the height, setting the minimum height to zero.\nLoosen the width, setting the minimum width to zero.\nGet the major component of a pair.\nThe matrix of the affine transformation.\nGet the max of self and other by element.\nGet the max of self and other by element.\nGet the max of self and other by element.\nThe maximum point of the rectangle.\nMaximum size the view can be.\nGet the largest element of self.\nCreate a new rectangle with the given maximum point and …\nGet the min of self and other by element.\nGet the min of self and other by element.\nGet the min of self and other by element.\nThe minimum point of the rectangle.\nMinimum size the view can be.\nGet the smallest element of self.\nCreate a new rectangle with the given minimum point and …\nGet the minor component of a pair.\nCreate a new alignment.\nCreate a new matrix.\nCreate a new Padding.\nCreate a new point.\nCreate a new rectangle with the given minimum and maximum …\nCreate a new size.\nCreate a new space.\nCreate a new vector.\nNormalize the vector.\nGet the offset of the padding.\nGet the offset of the rectangle.\nPack a major and minor component into a pair.\nConvert a from points to pixels.\nGet the right edge of the rectangle.\nThe right padding.\nCreate a rotation.\nRound the translation.\nRound the point by element.\nRound the rectangle’s minimum point down and its maximum …\nRound self by element.\nRound the vector by element.\nCreate a scale.\nShrink the rectangle by the given amount.\nShrink the space by size.\nGet the absolute value of the vector.\nGet the size of the padding.\nGet the size of the rectangle.\nConvert the size to a vector.\nConvert the vector to a vector.\nConvert the point to a size.\nConvert the vector to a size.\nConvert the point to a vector.\nConvert the size to a vector.\nGet the top edge of the rectangle.\nThe top padding.\nGet the top center point of the rectangle.\nGet the top left point of the rectangle.\nGet the top right point of the rectangle.\nTransform the rectangle by the given affine transform.\nCrate a translation.\nThe translation of the affine transformation.\nCompute the intersection of the rectangle with the given …\nCompute the union of the rectangle with the given …\nUnpack a pair into it’s (major, minor) components.\nGet the width of the rectangle.\nThe width.\nThe horizontal alignment.\nThe x axis of the matrix.\nThe x coordinate.\nThe x coordinate.\nThe vertical alignment.\nThe y axis of the matrix.\nThe y coordinate.\nThe y coordinate.\nA convenience trait for rebuilding a View.\nDerive the Rebuild trait.\nRebuild the view.\nA derived style.\nA style.\nA style key.\nA styled value.\nA collection of styles.\nA theme.\nA value.\nThe accent color.\nThe background color.\nCreate a computed style.\nThe contrast color.\nThe danger color.\nCreate the default dark theme.\nExtend the styles with another collection of styles.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nGet a style.\nGet the value, or a style from the styles.\nGet a style, or a default value.\nGet the value, or a style from the styles.\nGet a style, or a default value.\nGet the value, or a style from the styles.\nThe info color.\nInsert a styled value.\nInsert a style key.\nInsert a style key.\nInsert a style.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCreate a style key.\nCreate the default light theme.\nCreate a new style.\nCreate a new Styles.\nThe outline color.\nThe primary color.\nThe secondary color.\nCreate a collection of styles.\nThe success color.\nThe surface color.\nCreate a style value.\nThe warning color.\nA glyph in the font atlas.\nBlack font weight (900), the boldest possible.\nBold font weight (700).\nA collection of fonts.\nAlign text in the center.\nCondensed font stretch.\nA cursive font family.\nA font loaded from data.\nExtra-bold font weight (800).\nExtra-light font weight (200).\nAlign text at the end.\nExpanded font stretch.\nExtra-condensed font stretch.\nExtra-expanded font stretch.\nA fantasy font family.\nA font atlas.\nA font family, by default FontFamily::SansSerif.\nA source for a font.\nA font stretch.\nA font style.\nA font weight.\nA context for loading and rasterizing fonts.\nItalic font style.\nLight font weight (300).\nMedium font weight (500).\nA monospace font family.\nNormal font weight (400), the default.\nA font family by name, e.g. “Arial”.\nDo not wrap text.\nNormal font stretch, the default.\nNormal font style, the default.\nOblique font style.\nA font loaded from a file.\nSemi-bold font weight (600).\nA sans-serif font family.\nSemi-condensed font stretch.\nSemi-expanded font stretch.\nA serif font family.\nAlign text at the start.\nThin font weight (100), the thinnest possible.\nAlignment of a section of text.\nAttributes of a section of text.\nA convenient wrapper around a cosmic_text::Buffer.\nWrapping of a section of text.\nUltra-condensed font stretch.\nUltra-expanded font stretch.\nWrap text at the word boundary.\nConvert the font family to a fontdb::Family.\nGet the bounds of the text buffer.\nCalculates the size of a text buffer.\nThe glyph cache.\nRasterize a buffer.\nThe font family of the text.\nThe font atlas.\nThe font system.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nCreate a new text buffer from a raw buffer.\nGet the image of the atlas.\nLoad a font from a file or directory.\nInsert a physical glyph into the atlas.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nThe layout rect of the glyph.\nLoads a font from a FontSource.\nCreate a new font atlas with the given size.\nCreate a new text buffer.\nCreates a new font context.\nPrepare a buffer for rendering.\nGet the raw buffer.\nGet the raw buffer mutably.\nGet the rect of the text buffer.\nSet the align of the text buffer.\nSet the bounds of the text buffer.\nSet the metrics of the text buffer.\nSet the text of the text buffer.\nSet the wrapping mode of the text buffer.\nGet the size of the text buffer.\nThe font size of the text.\nThe font style of the text.\nThe swash cache.\nConvert the text align to a cosmic_text::Align.\nConvert the text wrap to a cosmic_text::Wrap.\nConvert the text attributes to a cosmic_text::Attrs.\nConvert the font weight to a fontdb::Weight.\nConvert the font stretch to a fontdb::Stretch.\nConvert the font style to a fontdb::Style.\nThe uv coordinates of the glyph in the atlas.\nThe font weight of the text.\nAn ease transition curve.\nA transition easing curve.\nA linear transition curve.\nA transition.\nCheck if the transition is complete.\nThe duration of the transition.\nCreate an ease transition with the given duration.\nCreate an ease transition with the given duration.\nThe easing curve.\nEvaluate the easing at t where 0 <= t <= 1.\nReturns the argument unchanged.\nReturns the argument unchanged.\nEvaluate the transition curve at t.\nCalls U::from(self).\nCalls U::from(self).\nCreate a linear transition with the given duration.\nCreate a linear transition with the given duration.\nStep the transition.\nThe view is active.\nThe view needs an animation frame.\nThe state of a BoxedView.\nA view that supports dynamic dispatch.\nA boxed dynamic view.\nThe view needs to be drawn.\nThe view is focusable.\nThe view is focused.\nEquivalent to …\nThe view has an active child.\nThe view has a focused child.\nThe view has a hot child.\nThe view is hot.\nEquivalent to Self::HOT | Self::FOCUSED | Self::ACTIVE.\nThe view needs to be laid out.\nA view that has separate ViewState from its content.\nContents of a view, in a sequence.\nThe state of a PodSeq.\nThe state of a Pod.\nThe state of the sequence.\nThe state of the view, see top-level documentation for …\nFlags that indicate what needs to be updated.\nA single UI component.\nFlags that indicate state of a view.\nAn opaque unique identifier for a view.\nA sequence of views.\nState associated with a View.\nGet a flags value with all known bits set.\nGet a flags value with all known bits set.\nCreate a new BoxedView.\nGet a reference to the underlying Any object.\nGet the underlying id as a u64.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nGet the underlying bits value.\nGet the underlying bits value.\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nBuild the sequence state.\nBuild the view state, see top-level documentation for more …\nBuild the sequence state.\nThe bitwise negation (!) of the bits in a flags value, …\nThe bitwise negation (!) of the bits in a flags value, …\nWhether all set bits in a source flags value are also set …\nWhether all set bits in a source flags value are also set …\nCheck if the view has the property T.\nGet the cursor of the view.\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nDraw the view, see top-level documentation for more …\nDraw the nth view.\nDraw the nth view.\nBuild the view.\nDraw the view.\nHandle an event.\nCalculate the layout.\nRebuild the view.\nGet a flags value with all bits unset.\nGet a flags value with all bits unset.\nHandle an event, see top-level documentation for more …\nHandle an event for the nth view.\nHandle an event for the nth view.\nThe bitwise or (|) of the bits in each flags value.\nThe bitwise or (|) of the bits in each flags value.\nGet the flags of the view.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nConvert from a bits value.\nConvert from a bits value.\nConvert from a bits value exactly.\nConvert from a bits value exactly.\nConvert from a bits value, unsetting any unknown bits.\nConvert from a bits value, unsetting any unknown bits.\nThe bitwise or (|) of the bits in each flags value.\nThe bitwise or (|) of the bits in each flags value.\nGet a flags value with the bits of a flag with the given …\nGet a flags value with the bits of a flag with the given …\nGet the property T of the view.\nGet the property T of the view mutably.\nWhether any of the views in the sequence are active.\nGet whether the view has an active child.\nGet whether the view has a focused child.\nGet whether the view has a hot child.\nGet the id of the view.\nGet the IME of the view.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nInsert a property into the view.\nThe bitwise and (&) of the bits in two flags values.\nThe bitwise and (&) of the bits in two flags values.\nWhether any set bits in a source flags value are also set …\nWhether any set bits in a source flags value are also set …\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nGet whether the view is active.\nWhether all known bits in this flags value are set.\nWhether all known bits in this flags value are set.\nWhether the sequence is empty.\nWhether all bits in this flags value are unset.\nWhether all bits in this flags value are unset.\nGet whether the view is focusable.\nGet whether the view is focused.\nGet whether the view is hot.\nYield a set of contained flags values.\nYield a set of contained flags values.\nYield a set of contained named flags values.\nYield a set of contained named flags values.\nLayout the view, see top-level documentation for more …\nLayout the nth view.\nLayout the nth view.\nThe length of the sequence.\nThe length of the sequence.\nMark the view as animated.\nMark the view as drawn.\nMark the view as laid out.\nGet whether the view needs an animation frame.\nGet whether the view needs to be drawn.\nGet whether the view needs to be laid out.\nCreate a new pod view.\nCreate a new PodSeq.\nCreate a new ViewId.\nCreate a new ViewState with the given ViewId.\nThe bitwise negation (!) of the bits in a flags value, …\nThe bitwise negation (!) of the bits in a flags value, …\nCreate a new Pod view.\nPrepare the view.\nPropagate the state of a child view.\nGet the property T of the view or insert it with a value.\nGet the property T of the view or insert it with a default …\nGet the property T of the view or insert it with a value.\nRebuild the sequence state.\nRebuild the view state, see top-level documentation for …\nRebuild the sequence state.\nRebuild the nth view.\nRebuild the nth view.\nGet the rect of the view in local coordinates.\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nRemove a property from the view.\nRequest an animation frame of the view tree.\nRequest a draw of the view tree.\nRequest a layout of the view tree.\nCall insert when value is true or remove when value is …\nCall insert when value is true or remove when value is …\nSet whether the view is active.\nSet the cursor of the view.\nSet whether the view is focusable.\nSet whether the view is focused.\nSet whether the view is hot.\nSet the IME of the view.\nSet the size of the view.\nSet the transform of the view.\nGet the size of the view.\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe intersection of a source flags value with the …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nThe bitwise exclusive-or (^) of the bits in two flags …\nGet the transform of the view.\nTranslate the transform of the view.\nThe bitwise or (|) of the bits in two flags values.\nThe bitwise or (|) of the bits in two flags values.\nGet the Update of the view.\nThe style key of [Text.align::ALIGN].\nThe style key of [TextInput.align::ALIGN].\nThe style key of [Tooltip.align::ALIGN].\nThe style key of [ColorPicker.alpha_color::ALPHA_COLOR].\nA view that aligns its content.\nA view that animates.\nA view that lays out its content with a fixed aspect ratio.\nThe style key of [Checkbox.background::BACKGROUND].\nThe style key of [Collapsing.background::BACKGROUND].\nThe style key of [Container.background::BACKGROUND].\nThe style key of [Slider.background::BACKGROUND].\nThe style key of [Tooltip.background::BACKGROUND].\nThe style key of [Button.border_color::BORDER_COLOR].\nThe style key of [Checkbox.border_color::BORDER_COLOR].\nThe style key of [Collapsing.border_color::BORDER_COLOR].\nThe style key of [ColorPicker.border_color::BORDER_COLOR].\nThe style key of [Container.border_color::BORDER_COLOR].\nThe style key of [Slider.border_color::BORDER_COLOR].\nThe style key of [Tooltip.border_color::BORDER_COLOR].\nThe style key of [Button.border_radius::BORDER_RADIUS].\nThe style key of [Checkbox.border_radius::BORDER_RADIUS].\nThe style key of [Collapsing.border_radius::BORDER_RADIUS].\nThe style key of [Container.border_radius::BORDER_RADIUS].\nThe style key of [Scroll.border_radius::BORDER_RADIUS].\nThe style key of [Slider.border_radius::BORDER_RADIUS].\nThe style key of [Tooltip.border_radius::BORDER_RADIUS].\nThe style key of [Button.border_width::BORDER_WIDTH].\nThe style key of [Checkbox.border_width::BORDER_WIDTH].\nThe style key of [Collapsing.border_width::BORDER_WIDTH].\nThe style key of [ColorPicker.border_width::BORDER_WIDTH].\nThe style key of [Container.border_width::BORDER_WIDTH].\nThe style key of [Slider.border_width::BORDER_WIDTH].\nThe style key of [Tooltip.border_width::BORDER_WIDTH].\nA view that hooks into the build cycle.\nA button.\nThe derived style for Button.\nThe style key of [Button.color::COLOR].\nThe style key of [Checkbox.color::COLOR].\nThe style key of [Scroll.color::COLOR].\nThe style key of [Slider.color::COLOR].\nThe style key of [Text.color::COLOR].\nThe style key of [TextInput.color::COLOR].\nThe style key of [Tooltip.color::COLOR].\nA checkbox.\nThe derived style for Checkbox.\nThe click event.\nA click event.\nA click handler.\nA collapsing view.\nThe derived style for Collapsing.\nA color picker.\nThe derived style for ColorPicker.\nA view that constrains its content to a given space.\nA container view.\nThe derived style for Container.\nThe style key of [Tooltip.delay::DELAY].\nA view that hooks into the draw cycle.\nA view that handles events.\nThe style key of [Button.fancy::FANCY].\nThe style key of [Text.font_family::FONT_FAMILY].\nThe style key of [TextInput.font_family::FONT_FAMILY].\nThe style key of [Tooltip.font_family::FONT_FAMILY].\nThe style key of [Text.font_size::FONT_SIZE].\nThe style key of [TextInput.font_size::FONT_SIZE].\nThe style key of [Tooltip.font_size::FONT_SIZE].\nThe style key of [Text.font_stretch::FONT_STRETCH].\nThe style key of [TextInput.font_stretch::FONT_STRETCH].\nThe style key of [Tooltip.font_stretch::FONT_STRETCH].\nThe style key of [Text.font_style::FONT_STYLE].\nThe style key of [TextInput.font_style::FONT_STYLE].\nThe style key of [Tooltip.font_style::FONT_STYLE].\nThe style key of [Text.font_weight::FONT_WEIGHT].\nThe style key of [TextInput.font_weight::FONT_WEIGHT].\nThe style key of [Tooltip.font_weight::FONT_WEIGHT].\nThe flex value of a view.\nA flexible view.\nA view that focuses on a part of the data.\nThe style key of [Collapsing.icon_color::ICON_COLOR].\nThe style key of [Collapsing.icon_size::ICON_SIZE].\nThe style key of [Scroll.inset::INSET].\nThe style key of [Scroll.knob_color::KNOB_COLOR].\nThe style key of [Slider.length::LENGTH].\nThe style key of […\nThe style key of [Text.line_height::LINE_HEIGHT].\nThe style key of [TextInput.line_height::LINE_HEIGHT].\nThe style key of [Tooltip.line_height::LINE_HEIGHT].\nA lens used by Focus.\nThe style key of [Container.mask::MASK].\nA view that only builds the inner view when certain data …\nA view that bridges the gap between impl View and …\nThe style key of [Button.padding::PADDING].\nThe style key of [Tooltip.padding::PADDING].\nThe style key of […\nA view that adds padding to its content.\nA view that draws something.\nThe press event.\nA view that handles rebuilds.\nThe release event.\nThe style key of [Checkbox.size::SIZE].\nThe style key of [ColorPicker.size::SIZE].\nThe style key of [ColorPicker.slider_width::SLIDER_WIDTH].\nThe style key of [Checkbox.stroke::STROKE].\nA scrollable view.\nThe derived style for Scroll.\nA slider.\nThe derived style for Slider.\nA view that stacks it’s content in a line.\nA view that suspends rendering while a future is pending.\nThe style key of [Button.transition::TRANSITION].\nThe style key of [Checkbox.transition::TRANSITION].\nThe style key of [Collapsing.transition::TRANSITION].\nThe style key of [Scroll.transition::TRANSITION].\nA view that displays text.\nA text input.\nThe derived style for TextInput.\nThe derived style for Text.\nA view that displays some text when the content is hovered.\nThe derived style for Tooltip.\nA view that transforms its content.\nA view that creates a trigger around the content.\nThe style key of [Scroll.width::WIDTH].\nThe style key of [Slider.width::WIDTH].\nThe style key of [Text.wrap::WRAP].\nThe style key of [TextInput.wrap::WRAP].\nThe style key of [Tooltip.wrap::WRAP].\nA view that stores some additional data.\nA view that applies a style to its content.\nA view that lays out it’s content in a line wrapping if …\nA view that overlays its content on top of each other.\nSet the build callback for after the content is built.\nSet the callback for when an event is emitted.\nThe build callback.\nThe callback after an event is propagated.\nCreate a new Aligned view.\nSet self.align.\nSet self.align.\nSet self.align.\nSet self.align.\nHow to align the content along the cross axis, within each …\nThe horizontal alignment of the text.\nThe style of Text::align.\nThe vertical alignment of the text.\nThe style of TextInput::align.\nThe horizontal alignment of the text.\nThe style of Tooltip::align.\nHow to align the content along the cross axis.\nThe alignment.\nSet self.alpha_color.\nThe color of the alpha slider.\nThe style of ColorPicker::alpha_color.\nSet the flex value of the view.\nThe flex value.\nCreate a new Animate.\nThe animation callback.\nCreate a new Stack, with dynamic content.\nCreate a new Wrap, with dynamic content.\nCreate a new horizontal Stack, with dynamic content.\nCreate a new vertical Stack, with dynamic content.\nThe aspect ratio of the content.\nSet self.axis.\nSet self.axis.\nSet self.axis.\nSet self.axis.\nThe axis of the scroll.\nThe axis of the slider.\nThe axis of the stack.\nThe axis.\nCreate a new Container with background.\nSet self.background.\nSet self.background.\nSet self.background.\nSet self.background.\nThe background color.\nThe style of Checkbox::background.\nThe background color of the header.\nThe style of Collapsing::background.\nThe background color.\nThe style of Container::background.\nThe background color of the slider.\nThe style of Slider::background.\nThe background color of the text.\nThe style of Tooltip::background.\nSet the callback for before an event is emitted.\nThe callback before an event is propagated.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nSet self.border_color.\nThe border color.\nThe style of Button::border_color.\nThe border color.\nThe style of Checkbox::border_color.\nThe color of the border of the header.\nThe style of Collapsing::border_color.\nThe border color of the color picker.\nThe style of ColorPicker::border_color.\nThe border color.\nThe style of Container::border_color.\nThe border color of the slider.\nThe style of Slider::border_color.\nThe border color of the text.\nThe style of Tooltip::border_color.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nSet self.border_radius.\nThe border radius.\nThe style of Button::border_radius.\nThe border radius.\nThe style of Checkbox::border_radius.\nThe border radius of the header.\nThe style of Collapsing::border_radius.\nThe border radius.\nThe style of Container::border_radius.\nThe radius of the scrollbar.\nThe style of Scroll::border_radius.\nThe border radius of the slider.\nThe style of Slider::border_radius.\nThe border radius of the text.\nThe style of Tooltip::border_radius.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nSet self.border_width.\nThe border width.\nThe style of Button::border_width.\nThe border width.\nThe style of Checkbox::border_width.\nThe border width of the header.\nThe style of Collapsing::border_width.\nThe border width of the color picker.\nThe style of ColorPicker::border_width.\nThe border width.\nThe style of Container::border_width.\nThe border width of the slider.\nThe style of Slider::border_width.\nThe border width of the text.\nThe style of Tooltip::border_width.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Button.\nSet self.button.\nThe button to listen for.\nThe callback.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Checkbox.\nSet self.checked.\nWhether the checkbox is checked.\nCreate a new Painter view that draws a circle.\nCreate a new Collapsing.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nSet self.color.\nThe color of the button.\nThe style of Button::color.\nThe color of the checkbox.\nThe style of Checkbox::color.\nThe color of the color picker.\nThe color of the scrollbar.\nThe style of Scroll::color.\nThe foreground color of the slider.\nThe style of Slider::color.\nThe color of the text.\nThe style of Text::color.\nThe color of the text.\nThe style of TextInput::color.\nThe color of text.\nThe style of Tooltip::color.\nCreate a new ColorPicker.\nSet self.column_gap.\nThe gap between each column.\nCreate a new Constrained view, constraining its content to …\nCreate a new Container.\nSet self.content.\nThe content.\nThe content.\nThe content.\nThe content view.\nThe content.\nThe content.\nThe content view.\nThe content to align.\nThe content.\nThe content.\nThe content.\nThe content.\nThe content to constrain.\nThe content.\nThe content of the view.\nThe content.\nThe content.\nThe content of the stack.\nThe content to display.\nThe content.\nThe content.\nThe content to overlay.\nSet self.default_open.\nWhether the view is open by default.\nThe delay before the tooltip is displayed.\nThe style of Tooltip::delay.\nSet self.descendants.\nWhether the item should be clickable when it’s …\nSet self.draw.\nThe draw function.\nCreate a new Painter view that draws an ellipse.\nSet self.event.\nThe event to listen for.\nCreate a new expanded Flexible view.\nSet the fallback view to display while the future is …\nSet self.fancy.\nThe distance of the fancy effect.\nThe style of Button::fancy.\nCreate a new Flexible view.\nThe flex value of the view.\nCreate a new Focus.\nSet self.font_family.\nSet self.font_family.\nThe font family of the text.\nThe style of Text::font_family.\nThe font family of the text.\nThe style of TextInput::font_family.\nThe font family of the text.\nThe style of Tooltip::font_family.\nSet self.font_size.\nSet self.font_size.\nThe font size of the text.\nThe style of Text::font_size.\nThe font size of the text.\nThe style of TextInput::font_size.\nThe font size of the text.\nThe style of Tooltip::font_size.\nSet self.font_stretch.\nSet self.font_stretch.\nThe font stretch of the text.\nThe style of Text::font_stretch.\nThe font stretch of the text.\nThe style of TextInput::font_stretch.\nThe font stretch of the text.\nThe style of Tooltip::font_stretch.\nSet self.font_style.\nSet self.font_style.\nThe font.into of the text.\nThe style of Text::font_style.\nThe font.into of the text.\nThe style of TextInput::font_style.\nThe font style of the text.\nThe style of Tooltip::font_style.\nSet self.font_weight.\nSet self.font_weight.\nThe font weight of the text.\nThe style of Text::font_weight.\nThe font weight of the text.\nThe style of TextInput::font_weight.\nThe font weight of the text.\nThe style of Tooltip::font_weight.\nCreate a formatted Text.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nSet self.gap.\nSet the gap for both the rows and columns.\nThe gap between children.\nThe header.\nCreate a new Constrained view, constraining its content to …\nSet the minimum height.\nCreate a new horizontal Stack.\nCreate a new horizontal Wrap.\nCreate a new horizontal Wrap, with dynamic content.\nCreate a new horizontal Wrap, with a vector of content.\nCreate a new horizontal Scroll.\nCreate a horizontal Stack.\nCreate a horizontal Stack.\nCreate a horizontal Stack.\nCreate a horizontal Stack, with dynamic content.\nCreate a horizontal Stack, with vector content.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap.\nCreate a horizontal Wrap, with dynamic content.\nCreate a horizontal Wrap, with a vector of content.\nSet self.icon_color.\nThe color of the icon.\nThe style of Collapsing::icon_color.\nSet self.icon_size.\nThe size of the icon.\nThe style of Collapsing::icon_size.\nSet self.inset.\nThe inset of the scrollbar.\nThe style of Scroll::inset.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nGet whether the stack is empty.\nGet whether the wrap is empty.\nWhether the view is tight.\nSet self.justify.\nSet self.justify.\nHow to justify the content along the main axis.\nHow to justify the content along the main axis.\nSet self.justify_cross.\nHow to justify the content along the cross axis.\nSet self.knob_color.\nThe color of the scrollbar knob.\nThe style of Scroll::knob_color.\nCreate a new Aligned view that aligns its content to the …\nGet the number of views in the stack.\nGet the number of views in the wrap.\nSet self.length.\nThe length of the slider.\nThe style of Slider::length.\nSet self.lightness_color.\nThe color of the lightness slider.\nThe style of ColorPicker::lightness_color.\nSet self.line_height.\nSet self.line_height.\nThe line height of the text.\nThe style of Text::line_height.\nThe line height of the text.\nThe style of TextInput::line_height.\nThe line height of the text.\nThe style of Tooltip::line_height.\nSet self.marker.\nSet self.mask.\nWhether to mask the content.\nThe style of Container::mask.\nCreate a new Constrained view, constraining its content to …\nSet the maximum height.\nCreate a new Constrained view, constraining its content to …\nSet the maximum size.\nCreate a new Constrained view, constraining its content to …\nSet the maximum width.\nCreate a new Memo.\nCreate a new Constrained view, constraining its content to …\nSet the minimum height.\nCreate a new Constrained view, constraining its content to …\nSet the minimum size.\nCreate a new Constrained view, constraining its content to …\nSet the minimum width.\nSet self.multiline.\nWhether the input is multi-line.\nCreate a new Animate.\nCreate a new BuildHandler.\nCreate a new DrawHandler.\nCreate a new EventHandler.\nCreate a new Focus.\nCreate a new Memo.\nCreate a new opaque view.\nCreate a new RebuildHandler.\nCreate a new Suspense view.\nCreate a new Trigger.\nCreate a new WithState.\nCreate a new WithStyle view.\nCreate a new aligned view.\nCreates a new Aspect view.\nCreate a new Button.\nCreate a new Checkbox.\nCreate a new Clickable.\nCreate a new Collapsing view.\nCreate a new ColorPicker.\nCreate a new constrained view.\nCreate a new Container.\nCreate a new flexible view.\nCreate a new Pad view.\nCreate a new Painter view.\nCreate a new scrollable view.\nCreate a new Slider.\nCreate a new Stack.\nCreate a new text.\nCreate a new text input view.\nCreate a new tooltip view.\nCreate a new Transform view.\nCreate a new Wrap.\nCreate a new overlay view.\nCreate a new BuildHandler.\nCreate a new Clickable, that calls on_click when clicked.\nCreate a new DrawHandler.\nSet the draw callback.\nThe draw callback.\nCreate a new EventHandler, with an after callback.\nCreate a new EventHandler, with a before callback.\nSet the on_input callback.\nSet the callback for when the value changes.\nSet the callback that is called when an input is received.\nThe on_input callback.\nThe callback for when the value changes.\nA callback that is called when an input is received.\nSet a callback for when the view is opened or closed.\nA callback for when the view is opened or closed.\nCreate a new Clickable, that calls on_press when pressed.\nCreate a new RebuildHandler.\nCreate a new Clickable, that calls on_release when …\nSet the callback that is called when the input is …\nA callback that is called when the input is submitted.\nA view that bridges the gap between impl View and …\nSet self.open.\nWhether the view is open.\nCreate a new Pad view.\nCreate a new Pad view adding padding to the bottom.\nCreate a new Pad view adding padding to the left.\nCreate a new Pad view adding padding to the right.\nCreate a new Pad view adding padding to the top.\nSet self.padding.\nThe padding.\nThe style of Button::padding.\nThe padding.\nThe padding of the text.\nThe style of Tooltip::padding.\nCreate a new Painter view.\nSet self.placeholder.\nPlaceholder text to display when the input is empty.\nSet self.placeholder_color.\nThe color of the placeholder text.\nThe style of TextInput::placeholder_color.\nPush a view to the stack.\nPush a view to the wrap.\nSet self.range.\nThe range of the slider.\nRebuild the style of Button.\nRebuild the style of Checkbox.\nRebuild the style of Collapsing.\nRebuild the style of ColorPicker.\nRebuild the style of Container.\nRebuild the style of Scroll.\nRebuild the style of Slider.\nRebuild the style of Text.\nRebuild the style of TextInput.\nRebuild the style of Tooltip.\nThe callback for when a rebuild is requested.\nCreate a new Painter view that draws a rectangle.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Transform view that rotates its content.\nCreate a new Transform view that rotates its content in …\nSet self.row_gap.\nThe gap between each row.\nCreate a new Transform view that scales its content.\nCreate a new Constrained view, cosntraining its content to …\nSet self.size.\nSet self.size.\nSet self.size.\nThe size of the checkbox.\nThe style of Checkbox::size.\nThe size of the color picker.\nThe style of ColorPicker::size.\nThe size of the view.\nCreate a new Slider.\nSet self.slider_width.\nThe width of the sliders.\nThe style of ColorPicker::slider_width.\nThe space to constrain the content to.\nSet self.stroke.\nThe stroke width of the checkbox.\nThe style of Checkbox::stroke.\nThe style to apply.\nThe style of Button.\nThe style of Checkbox.\nThe style of Collapsing.\nThe style of ColorPicker.\nThe style of Container.\nThe style of Scroll.\nThe style of Slider.\nThe style of Text.\nThe style of TextInput.\nThe style of Tooltip.\nCreate a new Suspense view.\nCreate a new Text.\nSet self.text.\nSet the text of the input.\nThe text.\nThe text.\nThe text to display.\nCreate a formatted Text.\nCreate a new TextInput.\nWhether the view is tight.\nCreate a new Tooltip view.\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Aligned view that aligns its content to the …\nCreate a new Transform view.\nThe transform.\nAnimate a transition.\nSet self.transition.\nSet self.transition.\nSet self.transition.\nSet self.transition.\nThe transition of the button.\nThe style of Button::transition.\nThe transition of the checkbox.\nThe style of Checkbox::transition.\nThe transition of the view.\nThe style of Collapsing::transition.\nThe transition of the scrollbar.\nThe style of Scroll::transition.\nAnimate a view when active changes.\nAnimate a view when focused changes.\nAnimate a view when hot changes.\nCreate a new Transform view that translates its content.\nCreate a new Trigger view.\nCreate a new constrained view, with no bounds.\nSet self.value.\nThe value of the slider.\nCreate a new Stack, with vector content.\nCreate a new Wrap, with a vector of content.\nCreate a new horizontal Stack, with vector content.\nCreate a new vertical Stack, with vector content.\nCreate a new vertical Stack.\nCreate a new vertical Wrap.\nCreate a new vertical Wrap, with dynamic content.\nCreate a new vertical Wrap, with a vector of content.\nCreate a new vertical Scroll.\nCreate a vertical Stack.\nCreate a vertical Stack.\nCreate a vertical Stack.\nCreate a vertical Stack, with dynamic content.\nCreate a vertical Stack, with vector content.\nCreate a vertical Wrap.\nCreate a vertical Wrap.\nCreate a vertical Wrap.\nCreate a vertical Wrap, with dynamic content.\nCreate a vertical Wrap, with a vector of content.\nCreate a new Constrained view, constraining its content to …\nSet the minimum width.\nSet self.width.\nSet self.width.\nThe width of the scrollbar.\nThe style of Scroll::width.\nThe width of the slider.\nThe style of Slider::width.\nPush a view to the stack.\nPush a view to the wrap.\nCreate a new WithState that replaces the data with the …\nCreate a new WithState that replaces the data with the …\nCreate a new WithState.\nCreate a new WithState using S::default().\nCreate a view that applies a style to its content.\nCreate a new view unwrapping some data from the state.\nCreate a new view unwrapping some state from the data.\nSet self.wrap.\nSet self.wrap.\nThe text wrap of the text.\nThe style of Text::wrap.\nThe text wrap of the text.\nThe style of TextInput::wrap.\nThe text wrap of the text.\nThe style of Tooltip::wrap.\nCreate a new ZStack view.\nCreate a new ZStack view.\nCreate a new ZStack view.\nSet the color of the window.\nThe root View will have Space::UNBOUNDED, and the window …\nA mouse cursor icon.\nSet the cursor of the window.\nSet whether the window is decorated.\nThe window will have a fixed size equal to Window::size.\nSet the icon of the window.\nSet the ime state of the window.\nSet whether the window is maximized.\nThe state of a pointer.\nSet whether the window is resizable.\nSet the scale of the window.\nSet the size of the window.\nSet the title of the window.\nSet whether the window is visible.\nA window.\nA unique identifier for a window.\nThe sizing of a window.\nThe state of a window.\nAn update to a window.\nSet the color of the window.\nThe color of the window.\nThe color of the window.\nSet whether the window is decorated.\nWhether the window is decorated.\nWhether the window is decorated.\nGet the difference between a window and a previous state.\nSet the sizing to WindowSizing::Content.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nReturns the argument unchanged.\nGet the pointer with pointer_id.\nGet the pointer with pointer_id mutably.\nGet the height of the window.\nThe view the pointer is over.\nSet the icon of the window.\nThe icon of the window.\nThe icon of the window.\nGet the unique identifier of the pointer.\nGet the unique identifier of the window.\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nCalls U::from(self).\nGet whether a specific view is hovered.\nGet whether button is held down on pointer with pointer_id.\nGet whether a button is pressed.\nSet whether the window is maximized.\nWhether the window is maximized.\nWhether the window is maximized.\nMove a pointer, returning the movement.\nReturns the name of the cursor.\nCreate a new pointer.\nCreate a new WindowId.\nCreate a new Window.\nGet the size of the window in physical pixels.\nGet the pointers in the window.\nGet the pointers in the window mutably.\nThe position of the pointer.\nPress a button.\nPress a button on a pointer.\nRelease a button, returning whether the button was clicked.\nRelease a button on a pointer.\nRemove a pointer.\nSet whether the window is resizable.\nWhether the window is resizable.\nWhether the window is resizable.\nSet the scale of the window.\nThe scale of the window.\nThe scale of the window.\nSet the size of the window.\nThe size of the window.\nThe size of the window.\nSet the sizing of the window.\nThe sizing of the window.\nGet the WindowSnapshot of the window.\nSet the title of the window.\nThe title of the window.\nThe title of the window.\nUpdate the window.\nSet whether the window is visible.\nWhether the window is visible.\nWhether the window is visible.\nGet the width of the window.")
\ No newline at end of file
diff --git a/src/ori_core/views/scroll.rs.html b/src/ori_core/views/scroll.rs.html
index 273d86532..0be9e9f36 100644
--- a/src/ori_core/views/scroll.rs.html
+++ b/src/ori_core/views/scroll.rs.html
@@ -287,7 +287,22 @@
287
288
289
-use ori_macro::{example, Styled};
+290
+291
+292
+293
+294
+295
+296
+297
+298
+299
+300
+301
+302
+303
+304
+
use ori_macro::{example, is_mobile, Build, Styled};
use crate::{
canvas::{BorderRadius, Color},
@@ -312,9 +327,10 @@
/// A scrollable view.
#[example(name = "scroll", width = 400, height = 300)]
-#[derive(Styled, Rebuild)]
+#[derive(Styled, Build, Rebuild)]
pub struct Scroll<V> {
/// The content.
+ #[build(ignore)]
pub content: Pod<V>,
/// The axis of the scroll.
@@ -413,6 +429,7 @@
#[doc(hidden)]
pub struct ScrollState {
style: ScrollStyle,
+ dragging: bool,
scrollbar_hot: bool,
scroll: f32,
t: f32,
@@ -424,6 +441,7 @@
fn build(&mut self, cx: &mut BuildCx, data: &mut T) -> Self::State {
let state = ScrollState {
style: ScrollStyle::styled(self, cx.styles()),
+ dragging: false,
scrollbar_hot: false,
scroll: 0.0,
t: 0.0,
@@ -472,10 +490,22 @@
content.translate(self.axis.pack(-state.scroll, 0.0));
+ cx.draw();
+ } else if state.dragging {
+ state.scroll -= self.axis.major(e.delta);
+ state.scroll = state.scroll.clamp(0.0, overflow);
cx.draw();
}
}
+ if matches!(event, Event::PointerPressed(_)) && cx.has_hot() && is_mobile!() {
+ state.dragging = true;
+ }
+
+ if matches!(event, Event::PointerReleased(_)) {
+ state.dragging = false;
+ }
+
if matches!(event, Event::PointerPressed(_)) && state.scrollbar_hot {
cx.set_active(true);
cx.draw();