diff --git a/go.mod b/go.mod index ef312d46309fa..ff05acdc2929c 100644 --- a/go.mod +++ b/go.mod @@ -7,7 +7,7 @@ toolchain go1.23.1 require ( cloud.google.com/go/bigtable v1.34.0 cloud.google.com/go/pubsub v1.45.3 - cloud.google.com/go/storage v1.49.0 + cloud.google.com/go/storage v1.50.0 dario.cat/mergo v1.0.1 github.com/Azure/azure-pipeline-go v0.2.3 github.com/Azure/azure-storage-blob-go v0.15.0 @@ -37,7 +37,7 @@ require ( github.com/fatih/color v1.18.0 github.com/felixge/fgprof v0.9.5 github.com/fluent/fluent-bit-go v0.0.0-20230731091245-a7a013e2473c - github.com/fsouza/fake-gcs-server v1.50.2 + github.com/fsouza/fake-gcs-server v1.52.1 github.com/go-kit/log v0.2.1 github.com/go-logfmt/logfmt v0.6.0 github.com/gocql/gocql v1.7.0 @@ -68,7 +68,7 @@ require ( github.com/klauspost/pgzip v1.2.6 github.com/leodido/go-syslog/v4 v4.2.0 github.com/mattn/go-ieproxy v0.0.12 - github.com/minio/minio-go/v7 v7.0.82 + github.com/minio/minio-go/v7 v7.0.83 github.com/mitchellh/go-wordwrap v1.0.1 github.com/mitchellh/mapstructure v1.5.1-0.20220423185008-bf980b35cac4 github.com/modern-go/reflect2 v1.0.2 @@ -103,7 +103,7 @@ require ( golang.org/x/sync v0.10.0 golang.org/x/sys v0.29.0 golang.org/x/time v0.9.0 - google.golang.org/api v0.214.0 + google.golang.org/api v0.215.0 google.golang.org/grpc v1.68.1 gopkg.in/yaml.v2 v2.4.0 gopkg.in/yaml.v3 v3.0.1 @@ -154,13 +154,13 @@ require ( ) require ( - cel.dev/expr v0.16.1 // indirect + cel.dev/expr v0.19.1 // indirect cloud.google.com/go/auth v0.13.0 // indirect cloud.google.com/go/auth/oauth2adapt v0.2.6 // indirect - cloud.google.com/go/monitoring v1.21.2 // indirect + cloud.google.com/go/monitoring v1.22.1 // indirect github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp v1.25.0 // indirect - github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.48.1 // indirect - github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.48.1 // indirect + github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.49.0 // indirect + github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.49.0 // indirect github.com/andybalholm/brotli v1.1.0 // indirect github.com/aws/aws-sdk-go-v2/service/internal/accept-encoding v1.12.0 // indirect github.com/aws/aws-sdk-go-v2/service/ssooidc v1.28.4 // indirect @@ -171,7 +171,7 @@ require ( github.com/go-ini/ini v1.67.0 // indirect github.com/go-ole/go-ole v1.3.0 // indirect github.com/go-redsync/redsync/v4 v4.13.0 // indirect - github.com/goccy/go-json v0.10.3 // indirect + github.com/goccy/go-json v0.10.4 // indirect github.com/gorilla/handlers v1.5.2 // indirect github.com/hashicorp/golang-lru v1.0.2 // indirect github.com/imdario/mergo v0.3.16 // indirect @@ -195,11 +195,11 @@ require ( github.com/xhit/go-str2duration/v2 v2.1.0 // indirect github.com/yusufpapurcu/wmi v1.2.4 // indirect go.opentelemetry.io/auto/sdk v1.1.0 // indirect - go.opentelemetry.io/contrib/detectors/gcp v1.29.0 // indirect - go.opentelemetry.io/otel/sdk v1.29.0 // indirect - go.opentelemetry.io/otel/sdk/metric v1.29.0 // indirect + go.opentelemetry.io/contrib/detectors/gcp v1.33.0 // indirect + go.opentelemetry.io/otel/sdk v1.33.0 // indirect + go.opentelemetry.io/otel/sdk/metric v1.33.0 // indirect golang.org/x/exp v0.0.0-20240909161429-701f63a606c0 // indirect - google.golang.org/grpc/stats/opentelemetry v0.0.0-20240907200651-3ffb98b2c93a // indirect + google.golang.org/grpc/stats/opentelemetry v0.0.0-20241028142157-ada6787961b3 // indirect ) require ( @@ -243,7 +243,7 @@ require ( github.com/bboreham/go-loser v0.0.0-20230920113527-fcc2c21820a3 // indirect github.com/beorn7/perks v1.0.1 // indirect github.com/census-instrumentation/opencensus-proto v0.4.1 // indirect - github.com/cncf/xds/go v0.0.0-20240905190251-b4127c9b8d78 // indirect + github.com/cncf/xds/go v0.0.0-20241223141626-cff3c89139a3 // indirect github.com/containerd/log v0.1.0 // indirect github.com/coreos/go-semver v0.3.1 // indirect github.com/coreos/go-systemd/v22 v22.5.0 // indirect @@ -291,7 +291,7 @@ require ( github.com/google/pprof v0.0.0-20241029153458-d1b30febd7db // indirect github.com/google/s2a-go v0.1.8 // indirect github.com/googleapis/enterprise-certificate-proxy v0.3.4 // indirect - github.com/googleapis/gax-go/v2 v2.14.0 // indirect + github.com/googleapis/gax-go/v2 v2.14.1 // indirect github.com/gophercloud/gophercloud v1.14.0 // indirect github.com/grafana/pyroscope-go/godeltaprof v0.1.8 // indirect github.com/hailocab/go-hostpool v0.0.0-20160125115350-e80d13ce29ed // indirect @@ -316,7 +316,7 @@ require ( github.com/josharian/intern v1.0.0 // indirect github.com/jpillora/backoff v1.0.0 // indirect github.com/julienschmidt/httprouter v1.3.0 // indirect - github.com/klauspost/cpuid/v2 v2.2.8 // indirect + github.com/klauspost/cpuid/v2 v2.2.9 // indirect github.com/kylelemons/godebug v1.1.0 // indirect github.com/leodido/go-urn v1.4.0 // indirect github.com/leodido/ragel-machinery v0.0.0-20190525184631-5f46317e436b // indirect @@ -361,8 +361,8 @@ require ( go.mongodb.org/mongo-driver v1.17.0 // indirect go.opencensus.io v0.24.0 // indirect go.opentelemetry.io/collector/semconv v0.108.1 // indirect - go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.54.0 // indirect - go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.54.0 // indirect + go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.58.0 // indirect + go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.58.0 // indirect go.opentelemetry.io/otel v1.33.0 go.opentelemetry.io/otel/metric v1.33.0 // indirect go.opentelemetry.io/otel/trace v1.33.0 @@ -372,8 +372,8 @@ require ( golang.org/x/term v0.28.0 // indirect golang.org/x/tools v0.26.0 // indirect google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 // indirect - google.golang.org/genproto/googleapis/api v0.0.0-20241118233622-e639e219e697 // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20241209162323-e6fa225c2576 + google.golang.org/genproto/googleapis/api v0.0.0-20250102185135-69823020774d // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20250102185135-69823020774d gopkg.in/fsnotify/fsnotify.v1 v1.4.7 // indirect gopkg.in/inf.v0 v0.9.1 // indirect gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect diff --git a/go.sum b/go.sum index 0452a1696821f..25c57552857ad 100644 --- a/go.sum +++ b/go.sum @@ -1,5 +1,5 @@ -cel.dev/expr v0.16.1 h1:NR0+oFYzR1CqLFhTAqg3ql59G9VfN8fKq1TCHJ6gq1g= -cel.dev/expr v0.16.1/go.mod h1:AsGA5zb3WruAEQeQng1RZdGEXmBj0jvMWh6l5SnNuC8= +cel.dev/expr v0.19.1 h1:NciYrtDRIR0lNCnH1LFJegdjspNx9fI59O7TWcua/W4= +cel.dev/expr v0.19.1/go.mod h1:MrpN08Q+lEBs+bGYdLxxHkZoUSsCp0nSKTs0nTymJgw= cloud.google.com/go v0.26.0/go.mod h1:aQUYkXzVsufM+DwF1aE+0xfcU+56JwCaLick0ClmMTw= cloud.google.com/go v0.34.0/go.mod h1:aQUYkXzVsufM+DwF1aE+0xfcU+56JwCaLick0ClmMTw= cloud.google.com/go v0.38.0/go.mod h1:990N+gfupTy94rShfmMCWGDn0LpTmnzTp2qbd1dvSRU= @@ -41,8 +41,8 @@ cloud.google.com/go/logging v1.12.0 h1:ex1igYcGFd4S/RZWOCU51StlIEuey5bjqwH9ZYjHi cloud.google.com/go/logging v1.12.0/go.mod h1:wwYBt5HlYP1InnrtYI0wtwttpVU1rifnMT7RejksUAM= cloud.google.com/go/longrunning v0.6.2 h1:xjDfh1pQcWPEvnfjZmwjKQEcHnpz6lHjfy7Fo0MK+hc= cloud.google.com/go/longrunning v0.6.2/go.mod h1:k/vIs83RN4bE3YCswdXC5PFfWVILjm3hpEUlSko4PiI= -cloud.google.com/go/monitoring v1.21.2 h1:FChwVtClH19E7pJ+e0xUhJPGksctZNVOk2UhMmblmdU= -cloud.google.com/go/monitoring v1.21.2/go.mod h1:hS3pXvaG8KgWTSz+dAdyzPrGUYmi2Q+WFX8g2hqVEZU= +cloud.google.com/go/monitoring v1.22.1 h1:KQbnAC4IAH+5x3iWuPZT5iN9VXqKMzzOgqcYB6fqPDE= +cloud.google.com/go/monitoring v1.22.1/go.mod h1:AuZZXAoN0WWWfsSvET1Cpc4/1D8LXq8KRDU87fMS6XY= cloud.google.com/go/pubsub v1.0.1/go.mod h1:R0Gpsv3s54REJCy4fxDixWD93lHJMoZTyQ2kNxGRt3I= cloud.google.com/go/pubsub v1.1.0/go.mod h1:EwwdRX2sKPjnvnqCa270oGRyludottCI76h+R3AArQw= cloud.google.com/go/pubsub v1.2.0/go.mod h1:jhfEVHT8odbXTkndysNHCcx0awwzvfOlguIAii9o8iA= @@ -54,8 +54,8 @@ cloud.google.com/go/storage v1.5.0/go.mod h1:tpKbwo567HUNpVclU5sGELwQWBDZ8gh0Zeo cloud.google.com/go/storage v1.6.0/go.mod h1:N7U0C8pVQ/+NIKOBQyamJIeKQKkZ+mxpohlUTyfDhBk= cloud.google.com/go/storage v1.8.0/go.mod h1:Wv1Oy7z6Yz3DshWRJFhqM/UCfaWIRTdp0RXyy7KQOVs= cloud.google.com/go/storage v1.10.0/go.mod h1:FLPqc6j+Ki4BU591ie1oL6qBQGu2Bl/tZ9ullr3+Kg0= -cloud.google.com/go/storage v1.49.0 h1:zenOPBOWHCnojRd9aJZAyQXBYqkJkdQS42dxL55CIMw= -cloud.google.com/go/storage v1.49.0/go.mod h1:k1eHhhpLvrPjVGfo0mOUPEJ4Y2+a/Hv5PiwehZI9qGU= +cloud.google.com/go/storage v1.50.0 h1:3TbVkzTooBvnZsk7WaAQfOsNrdoM8QHusXA1cpk6QJs= +cloud.google.com/go/storage v1.50.0/go.mod h1:l7XeiD//vx5lfqE3RavfmU9yvk5Pp0Zhcv482poyafY= cloud.google.com/go/trace v1.11.2 h1:4ZmaBdL8Ng/ajrgKqY5jfvzqMXbrDcBsUGXOT9aqTtI= cloud.google.com/go/trace v1.11.2/go.mod h1:bn7OwXd4pd5rFuAnTrzBuoZ4ax2XQeG3qNgYmfCy0Io= dario.cat/mergo v1.0.1 h1:Ra4+bf83h2ztPIQYNP99R6m+Y7KfnARDfID+a+vLl4s= @@ -122,12 +122,12 @@ github.com/DmitriyVTitov/size v1.5.0 h1:/PzqxYrOyOUX1BXj6J9OuVRVGe+66VL4D9FlUaW5 github.com/DmitriyVTitov/size v1.5.0/go.mod h1:le6rNI4CoLQV1b9gzp1+3d7hMAD/uu2QcJ+aYbNgiU0= github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp v1.25.0 h1:3c8yed4lgqTt+oTQ+JNMDo+F4xprBf+O/il4ZC0nRLw= github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp v1.25.0/go.mod h1:obipzmGjfSjam60XLwGfqUkJsfiheAl+TUjG+4yzyPM= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.48.1 h1:UQ0AhxogsIRZDkElkblfnwjc3IaltCm2HUMvezQaL7s= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.48.1/go.mod h1:jyqM3eLpJ3IbIFDTKVz2rF9T/xWGW0rIriGwnz8l9Tk= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/cloudmock v0.48.1 h1:oTX4vsorBZo/Zdum6OKPA4o7544hm6smoRv1QjpTwGo= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/cloudmock v0.48.1/go.mod h1:0wEl7vrAD8mehJyohS9HZy+WyEOaQO2mJx86Cvh93kM= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.48.1 h1:8nn+rsCvTq9axyEh382S0PFLBeaFwNsT43IrPWzctRU= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.48.1/go.mod h1:viRWSEhtMZqz1rhwmOVKkWl6SwmVowfL9O2YR5gI2PE= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.49.0 h1:o90wcURuxekmXrtxmYWTyNla0+ZEHhud6DI1ZTxd1vI= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.49.0/go.mod h1:6fTWu4m3jocfUZLYF5KsZC1TUfRvEjs7lM4crme/irw= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/cloudmock v0.49.0 h1:jJKWl98inONJAr/IZrdFQUWcwUO95DLY1XMD1ZIut+g= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/cloudmock v0.49.0/go.mod h1:l2fIqmwB+FKSfvn3bAD/0i+AXAxhIZjTK2svT/mgUXs= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.49.0 h1:GYUJLfvd++4DMuMhCFLgLXvFwofIxh/qOwoGuS/LTew= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.49.0/go.mod h1:wRbFgBQUVm1YXrvWKofAEmq9HNJTDphbAaJSSX01KUI= github.com/HdrHistogram/hdrhistogram-go v1.1.2 h1:5IcZpTvzydCQeHzK4Ef/D5rrSqwxob0t8PQPMybUNFM= github.com/HdrHistogram/hdrhistogram-go v1.1.2/go.mod h1:yDgFjdqOqDEKOvasDdhWNXYg9BVp4O+o5f6V/ehm6Oo= github.com/IBM/go-sdk-core/v5 v5.18.3 h1:q6IDU3N2bHGwijK9pMnzKC5gqdaRII56NzB4ZNdSFvY= @@ -280,8 +280,8 @@ github.com/clbanning/x2j v0.0.0-20191024224557-825249438eec/go.mod h1:jMjuTZXRI4 github.com/client9/misspell v0.3.4/go.mod h1:qj6jICC3Q7zFZvVWo7KLAzC3yx5G7kyvSDkc90ppPyw= github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc= github.com/cncf/udpa/go v0.0.0-20201120205902-5459f2c99403/go.mod h1:WmhPx2Nbnhtbo57+VJT5O0JRkEi1Wbu0z5j0R8u5Hbk= -github.com/cncf/xds/go v0.0.0-20240905190251-b4127c9b8d78 h1:QVw89YDxXxEe+l8gU8ETbOasdwEV+avkR75ZzsVV9WI= -github.com/cncf/xds/go v0.0.0-20240905190251-b4127c9b8d78/go.mod h1:W+zGtBO5Y1IgJhy4+A9GOqVhqLpfZi+vwmdNXUehLA8= +github.com/cncf/xds/go v0.0.0-20241223141626-cff3c89139a3 h1:boJj011Hh+874zpIySeApCX4GeOjPl9qhRF3QuIZq+Q= +github.com/cncf/xds/go v0.0.0-20241223141626-cff3c89139a3/go.mod h1:W+zGtBO5Y1IgJhy4+A9GOqVhqLpfZi+vwmdNXUehLA8= github.com/cockroachdb/datadriven v0.0.0-20190809214429-80d97fb3cbaa/go.mod h1:zn76sxSg3SzpJ0PPJaLDCu+Bu0Lg3sKTORVIj19EIF8= github.com/codahale/hdrhistogram v0.0.0-20161010025455-3a0bb77429bd/go.mod h1:sE/e/2PUdi/liOCUjSTXgM1o87ZssimdTWN964YiIeI= github.com/containerd/fifo v1.1.0 h1:4I2mbh5stb1u6ycIABlBw9zgtlK8viPI9QkQNRQEEmY= @@ -399,8 +399,8 @@ github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMo github.com/fsnotify/fsnotify v1.6.0/go.mod h1:sl3t1tCWJFWoRz9R8WJCbQihKKwmorjAbSClcnxKAGw= github.com/fsnotify/fsnotify v1.8.0 h1:dAwr6QBTBZIkG8roQaJjGof0pp0EeF+tNV7YBP3F/8M= github.com/fsnotify/fsnotify v1.8.0/go.mod h1:8jBTzvmWwFyi3Pb8djgCCO5IBqzKJ/Jwo8TRcHyHii0= -github.com/fsouza/fake-gcs-server v1.50.2 h1:ulrS1pavCOCbMZfN5ZPgBRMFWclON9xDsuLBniXtQoE= -github.com/fsouza/fake-gcs-server v1.50.2/go.mod h1:VU6Zgei4647KuT4XER8WHv5Hcj2NIySndyG8gfvwckA= +github.com/fsouza/fake-gcs-server v1.52.1 h1:Hx3G2ZpyBzHGmW7cHURWWoTm6jM3M5fcWMIAHBYlJyc= +github.com/fsouza/fake-gcs-server v1.52.1/go.mod h1:Paxf25VmSNMN52L+2/cVulF5fkLUA0YJIYjTGJiwf3c= github.com/fullstorydev/emulators/storage v0.0.0-20240401123056-edc69752f474 h1:TufioMBjkJ6/Oqmlye/ReuxHFS35HyLmypj/BNy/8GY= github.com/fullstorydev/emulators/storage v0.0.0-20240401123056-edc69752f474/go.mod h1:PQwxF4UU8wuL+srGxr3BOhIW5zXqgucwVlO/nPZLsxw= github.com/fxamacker/cbor/v2 v2.7.0 h1:iM5WgngdRBanHcxugY4JySA0nk1wZorNOpTgCMedv5E= @@ -479,8 +479,8 @@ github.com/go-zookeeper/zk v1.0.3/go.mod h1:nOB03cncLtlp4t+UAkGSV+9beXP/akpekBwL github.com/gobwas/httphead v0.1.0/go.mod h1:O/RXo79gxV8G+RqlR/otEwx4Q36zl9rqC5u12GKvMCM= github.com/gobwas/pool v0.2.1/go.mod h1:q8bcK0KcYlCgd9e7WYLm9LpyS+YeLd8JVDW6WezmKEw= github.com/gobwas/ws v1.2.1/go.mod h1:hRKAFb8wOxFROYNsT1bqfWnhX+b5MFeJM9r2ZSwg/KY= -github.com/goccy/go-json v0.10.3 h1:KZ5WoDbxAIgm2HNbYckL0se1fHD6rz5j4ywS6ebzDqA= -github.com/goccy/go-json v0.10.3/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= +github.com/goccy/go-json v0.10.4 h1:JSwxQzIqKfmFX1swYPpUThQZp/Ka4wzJdK0LWVytLPM= +github.com/goccy/go-json v0.10.4/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= github.com/godbus/dbus/v5 v5.0.4/go.mod h1:xhWf0FNVPg57R7Z0UbKHbJfkEywrmjJnf7w5xrFpKfA= github.com/gofrs/flock v0.7.1/go.mod h1:F1TvTiK9OcQqauNUHlbJvyl9Qa1QvF/gOUDKA14jxHU= github.com/gofrs/flock v0.8.1 h1:+gYjHKf32LDeiEEFhQaotPbLuUXjY5ZqxKgXy7n59aw= @@ -595,8 +595,8 @@ github.com/googleapis/enterprise-certificate-proxy v0.3.4 h1:XYIDZApgAnrN1c855gT github.com/googleapis/enterprise-certificate-proxy v0.3.4/go.mod h1:YKe7cfqYXjKGpGvmSg28/fFvhNzinZQm8DGnaburhGA= github.com/googleapis/gax-go/v2 v2.0.4/go.mod h1:0Wqv26UfaUD9n4G6kQubkQ+KchISgw+vpHVxEJEs9eg= github.com/googleapis/gax-go/v2 v2.0.5/go.mod h1:DWXyrwAJ9X0FpwwEdw+IPEYBICEFu5mhpdKc/us6bOk= -github.com/googleapis/gax-go/v2 v2.14.0 h1:f+jMrjBPl+DL9nI4IQzLUxMq7XrAqFYB7hBPqMNIe8o= -github.com/googleapis/gax-go/v2 v2.14.0/go.mod h1:lhBCnjdLrWRaPvLWhmc8IS24m9mr07qSYnHncrgo+zk= +github.com/googleapis/gax-go/v2 v2.14.1 h1:hb0FFeiPaQskmvakKu5EbCbpntQn48jyHuvrkurSS/Q= +github.com/googleapis/gax-go/v2 v2.14.1/go.mod h1:Hb/NubMaVM88SrNkvl8X/o8XWwDJEPqouaLeN2IUxoA= github.com/gophercloud/gophercloud v1.14.0 h1:Bt9zQDhPrbd4qX7EILGmy+i7GP35cc+AAL2+wIJpUE8= github.com/gophercloud/gophercloud v1.14.0/go.mod h1:aAVqcocTSXh2vYFZ1JTvx4EQmfgzxRcNupUfxZbBNDM= github.com/gopherjs/gopherjs v0.0.0-20181017120253-0766667cb4d1/go.mod h1:wJfORRmW1u3UXTncJ5qlYoELFm8eSnnEO6hX4iZ3EWY= @@ -775,8 +775,8 @@ github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+o github.com/klauspost/compress v1.17.11 h1:In6xLpyWOi1+C7tXUUWv2ot1QvBjxevKAaI6IXrJmUc= github.com/klauspost/compress v1.17.11/go.mod h1:pMDklpSncoRMuLFrf1W9Ss9KT+0rH90U12bZKk7uwG0= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.8 h1:+StwCXwm9PdpiEkPyzBXIy+M9KUb4ODm0Zarf1kS5BM= -github.com/klauspost/cpuid/v2 v2.2.8/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY= +github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8= github.com/klauspost/pgzip v1.2.6 h1:8RXeL5crjEUFnR2/Sn6GJNWtSQ3Dk8pq4CL3jvdDyjU= github.com/klauspost/pgzip v1.2.6/go.mod h1:Ch1tH69qFZu15pkjo5kYi6mth2Zzwzt50oCQKQE9RUs= github.com/kolo/xmlrpc v0.0.0-20220921171641-a4b6fa1dd06b h1:udzkj9S/zlT5X367kqJis0QP7YMxobob6zhzq6Yre00= @@ -846,8 +846,8 @@ github.com/miekg/dns v1.1.62 h1:cN8OuEF1/x5Rq6Np+h1epln8OiyPWV+lROx9LxcGgIQ= github.com/miekg/dns v1.1.62/go.mod h1:mvDlcItzm+br7MToIKqkglaGhlFMHJ9DTNNWONWXbNQ= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= -github.com/minio/minio-go/v7 v7.0.82 h1:tWfICLhmp2aFPXL8Tli0XDTHj2VB/fNf0PC1f/i1gRo= -github.com/minio/minio-go/v7 v7.0.82/go.mod h1:84gmIilaX4zcvAWWzJ5Z1WI5axN+hAbM5w25xf8xvC0= +github.com/minio/minio-go/v7 v7.0.83 h1:W4Kokksvlz3OKf3OqIlzDNKd4MERlC2oN8YptwJ0+GA= +github.com/minio/minio-go/v7 v7.0.83/go.mod h1:57YXpvc5l3rjPdhqNrDsvVlY0qPI6UTk1bflAe+9doY= github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc= github.com/mitchellh/cli v1.1.0/go.mod h1:xcISNoH86gajksDmfB23e/pu+B+GeFRMYmoHXxx3xhI= github.com/mitchellh/colorstring v0.0.0-20190213212951-d06e56a500db h1:62I3jR2EmQ4l5rM/4FEfDWcRD+abF5XlKShorW5LRoQ= @@ -1209,12 +1209,12 @@ go.opentelemetry.io/collector/pdata v1.22.0 h1:3yhjL46NLdTMoP8rkkcE9B0pzjf2973cr go.opentelemetry.io/collector/pdata v1.22.0/go.mod h1:nLLf6uDg8Kn5g3WNZwGyu8+kf77SwOqQvMTb5AXEbEY= go.opentelemetry.io/collector/semconv v0.108.1 h1:Txk9tauUnamZaxS5vlf1O0uZ4VD6nioRBR0nX8L/fU4= go.opentelemetry.io/collector/semconv v0.108.1/go.mod h1:zCJ5njhWpejR+A40kiEoeFm1xq1uzyZwMnRNX6/D82A= -go.opentelemetry.io/contrib/detectors/gcp v1.29.0 h1:TiaiXB4DpGD3sdzNlYQxruQngn5Apwzi1X0DRhuGvDQ= -go.opentelemetry.io/contrib/detectors/gcp v1.29.0/go.mod h1:GW2aWZNwR2ZxDLdv8OyC2G8zkRoQBuURgV7RPQgcPoU= -go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.54.0 h1:r6I7RJCN86bpD/FQwedZ0vSixDpwuWREjW9oRMsmqDc= -go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.54.0/go.mod h1:B9yO6b04uB80CzjedvewuqDhxJxi11s7/GtiGa8bAjI= -go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.54.0 h1:TT4fX+nBOA/+LUkobKGW1ydGcn+G3vRw9+g5HwCphpk= -go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.54.0/go.mod h1:L7UH0GbB0p47T4Rri3uHjbpCFYrVrwc1I25QhNPiGK8= +go.opentelemetry.io/contrib/detectors/gcp v1.33.0 h1:FVPoXEoILwgbZUu4X7YSgsESsAmGRgoYcnXkzgQPhP4= +go.opentelemetry.io/contrib/detectors/gcp v1.33.0/go.mod h1:ZHrLmr4ikK2AwRj9QL+c9s2SOlgoSRyMpNVzUj2fZqI= +go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.58.0 h1:PS8wXpbyaDJQ2VDHHncMe9Vct0Zn1fEjpsjrLxGJoSc= +go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.58.0/go.mod h1:HDBUsEjOuRC0EzKZ1bSaRGZWUBAzo+MhAcUUORSr4D0= +go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.58.0 h1:yd02MEjBdJkG3uabWP9apV+OuWRIXGDuJEUJbOHmCFU= +go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.58.0/go.mod h1:umTcuxiv1n/s/S6/c2AT/g2CQ7u5C59sHDNmfSwgz7Q= go.opentelemetry.io/otel v1.33.0 h1:/FerN9bax5LoK51X/sI0SVYrjSE0/yUL7DpxW4K3FWw= go.opentelemetry.io/otel v1.33.0/go.mod h1:SUUkR6csvUQl+yjReHu5uM3EtVV7MBm5FHKRlNx4I8I= go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.29.0 h1:dIIDULZJpgdiHz5tXrTgKIMLkus6jEFa7x5SOKcyR7E= @@ -1225,10 +1225,10 @@ go.opentelemetry.io/otel/exporters/stdout/stdoutmetric v1.29.0 h1:WDdP9acbMYjbKI go.opentelemetry.io/otel/exporters/stdout/stdoutmetric v1.29.0/go.mod h1:BLbf7zbNIONBLPwvFnwNHGj4zge8uTCM/UPIVW1Mq2I= go.opentelemetry.io/otel/metric v1.33.0 h1:r+JOocAyeRVXD8lZpjdQjzMadVZp2M4WmQ+5WtEnklQ= go.opentelemetry.io/otel/metric v1.33.0/go.mod h1:L9+Fyctbp6HFTddIxClbQkjtubW6O9QS3Ann/M82u6M= -go.opentelemetry.io/otel/sdk v1.29.0 h1:vkqKjk7gwhS8VaWb0POZKmIEDimRCMsopNYnriHyryo= -go.opentelemetry.io/otel/sdk v1.29.0/go.mod h1:pM8Dx5WKnvxLCb+8lG1PRNIDxu9g9b9g59Qr7hfAAok= -go.opentelemetry.io/otel/sdk/metric v1.29.0 h1:K2CfmJohnRgvZ9UAj2/FhIf/okdWcNdBwe1m8xFXiSY= -go.opentelemetry.io/otel/sdk/metric v1.29.0/go.mod h1:6zZLdCl2fkauYoZIOn/soQIDSWFmNSRcICarHfuhNJQ= +go.opentelemetry.io/otel/sdk v1.33.0 h1:iax7M131HuAm9QkZotNHEfstof92xM+N8sr3uHXc2IM= +go.opentelemetry.io/otel/sdk v1.33.0/go.mod h1:A1Q5oi7/9XaMlIWzPSxLRWOI8nG3FnzHJNbiENQuihM= +go.opentelemetry.io/otel/sdk/metric v1.33.0 h1:Gs5VK9/WUJhNXZgn8MR6ITatvAmKeIuCtNbsP3JkNqU= +go.opentelemetry.io/otel/sdk/metric v1.33.0/go.mod h1:dL5ykHZmm1B1nVRk9dDjChwDmt81MjVp3gLkQRwKf/Q= go.opentelemetry.io/otel/trace v1.33.0 h1:cCJuF7LRjUFso9LPnEAHJDB2pqzp+hbO8eu1qqW2d/s= go.opentelemetry.io/otel/trace v1.33.0/go.mod h1:uIcdVUZMpTAmz0tI1z04GoVSezK37CbGV4fr1f2nBck= go.opentelemetry.io/proto/otlp v1.3.1 h1:TrMUixzpM0yuc/znrFTP9MMRh8trP93mkCiDVeXrui0= @@ -1567,8 +1567,8 @@ google.golang.org/api v0.24.0/go.mod h1:lIXQywCXRcnZPGlsd8NbLnOjtAoL6em04bJ9+z0M google.golang.org/api v0.28.0/go.mod h1:lIXQywCXRcnZPGlsd8NbLnOjtAoL6em04bJ9+z0MncE= google.golang.org/api v0.29.0/go.mod h1:Lcubydp8VUV7KeIHD9z2Bys/sm/vGKnG1UHuDBSrHWM= google.golang.org/api v0.30.0/go.mod h1:QGmEvQ87FHZNiUVJkT14jQNYJ4ZJjdRF23ZXz5138Fc= -google.golang.org/api v0.214.0 h1:h2Gkq07OYi6kusGOaT/9rnNljuXmqPnaig7WGPmKbwA= -google.golang.org/api v0.214.0/go.mod h1:bYPpLG8AyeMWwDU6NXoB00xC0DFkikVvd5MfwoxjLqE= +google.golang.org/api v0.215.0 h1:jdYF4qnyczlEz2ReWIsosNLDuzXyvFHJtI5gcr0J7t0= +google.golang.org/api v0.215.0/go.mod h1:fta3CVtuJYOEdugLNWm6WodzOS8KdFckABwN4I40hzY= google.golang.org/appengine v1.1.0/go.mod h1:EbEs0AVv82hx2wNQdGPgUI5lhzA/G0D9YwlJXL52JkM= google.golang.org/appengine v1.2.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= google.golang.org/appengine v1.4.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= @@ -1611,10 +1611,10 @@ google.golang.org/genproto v0.0.0-20200825200019-8632dd797987/go.mod h1:FWY/as6D google.golang.org/genproto v0.0.0-20210602131652-f16073e35f0c/go.mod h1:UODoCrxHCcBojKKwX1terBiRUaqAsFqJiF615XL43r0= google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 h1:ToEetK57OidYuqD4Q5w+vfEnPvPpuTwedCNVohYJfNk= google.golang.org/genproto v0.0.0-20241118233622-e639e219e697/go.mod h1:JJrvXBWRZaFMxBufik1a4RpFw4HhgVtBBWQeQgUj2cc= -google.golang.org/genproto/googleapis/api v0.0.0-20241118233622-e639e219e697 h1:pgr/4QbFyktUv9CtQ/Fq4gzEE6/Xs7iCXbktaGzLHbQ= -google.golang.org/genproto/googleapis/api v0.0.0-20241118233622-e639e219e697/go.mod h1:+D9ySVjN8nY8YCVjc5O7PZDIdZporIDY3KaGfJunh88= -google.golang.org/genproto/googleapis/rpc v0.0.0-20241209162323-e6fa225c2576 h1:8ZmaLZE4XWrtU3MyClkYqqtl6Oegr3235h7jxsDyqCY= -google.golang.org/genproto/googleapis/rpc v0.0.0-20241209162323-e6fa225c2576/go.mod h1:5uTbfoYQed2U9p3KIj2/Zzm02PYhndfdmML0qC3q3FU= +google.golang.org/genproto/googleapis/api v0.0.0-20250102185135-69823020774d h1:H8tOf8XM88HvKqLTxe755haY6r1fqqzLbEnfrmLXlSA= +google.golang.org/genproto/googleapis/api v0.0.0-20250102185135-69823020774d/go.mod h1:2v7Z7gP2ZUOGsaFyxATQSRoBnKygqVq2Cwnvom7QiqY= +google.golang.org/genproto/googleapis/rpc v0.0.0-20250102185135-69823020774d h1:xJJRGY7TJcvIlpSrN3K6LAWgNFUILlO+OMAqtg9aqnw= +google.golang.org/genproto/googleapis/rpc v0.0.0-20250102185135-69823020774d/go.mod h1:3ENsm/5D1mzDyhpzeRi1NR784I0BcofWBoSc5QqqMK4= google.golang.org/grpc v1.12.0/go.mod h1:yo6s7OP7yaDglbqo1J04qKzAhqBH6lvTonzMVmEdcZw= google.golang.org/grpc v1.17.0/go.mod h1:6QZJwpn2B+Zp71q/5VxRsJ6NXXVCE5NRUHRo+f3cWCs= google.golang.org/grpc v1.19.0/go.mod h1:mqu4LbDTu4XGKhr4mRzUsmM4RtVoemTSY81AxZiDr8c= @@ -1638,8 +1638,8 @@ google.golang.org/grpc v1.33.2/go.mod h1:JMHMWHQWaTccqQQlmk3MJZS+GWXOdAesneDmEnv google.golang.org/grpc v1.38.0/go.mod h1:NREThFqKR1f3iQ6oBuvc5LadQuXVGo9rkm5ZGrQdJfM= google.golang.org/grpc v1.68.1 h1:oI5oTa11+ng8r8XMMN7jAOmWfPZWbYpCFaMUTACxkM0= google.golang.org/grpc v1.68.1/go.mod h1:+q1XYFJjShcqn0QZHvCyeR4CXPA+llXIeUIfIe00waw= -google.golang.org/grpc/stats/opentelemetry v0.0.0-20240907200651-3ffb98b2c93a h1:UIpYSuWdWHSzjwcAFRLjKcPXFZVVLXGEM23W+NWqipw= -google.golang.org/grpc/stats/opentelemetry v0.0.0-20240907200651-3ffb98b2c93a/go.mod h1:9i1T9n4ZinTUZGgzENMi8MDDgbGC5mqTS75JAv6xN3A= +google.golang.org/grpc/stats/opentelemetry v0.0.0-20241028142157-ada6787961b3 h1:hUfOButuEtpc0UvYiaYRbNwxVYr0mQQOWq6X8beJ9Gc= +google.golang.org/grpc/stats/opentelemetry v0.0.0-20241028142157-ada6787961b3/go.mod h1:jzYlkSMbKypzuu6xoAEijsNVo9ZeDF1u/zCfFgsx7jg= google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8= google.golang.org/protobuf v0.0.0-20200221191635-4d8936d0db64/go.mod h1:kwYJMbMJ01Woi6D6+Kah6886xMZcty6N08ah7+eCXa0= google.golang.org/protobuf v0.0.0-20200228230310-ab0ca4ff8a60/go.mod h1:cfTl7dwQJ+fmap5saPgwCLgHXTUD7jkjRqWcaiX5VyM= diff --git a/vendor/cel.dev/expr/.bazelversion b/vendor/cel.dev/expr/.bazelversion index 579c9d21e7d79..26bc914a3b009 100644 --- a/vendor/cel.dev/expr/.bazelversion +++ b/vendor/cel.dev/expr/.bazelversion @@ -1,2 +1,2 @@ -6.4.0 +7.0.1 # Keep this pinned version in parity with cel-go diff --git a/vendor/cel.dev/expr/.gitignore b/vendor/cel.dev/expr/.gitignore index ac51a054d2da1..0d4fed27c9f02 100644 --- a/vendor/cel.dev/expr/.gitignore +++ b/vendor/cel.dev/expr/.gitignore @@ -1 +1,2 @@ bazel-* +MODULE.bazel.lock diff --git a/vendor/cel.dev/expr/BUILD.bazel b/vendor/cel.dev/expr/BUILD.bazel index 0bbe9ed7736c4..37d8adc950302 100644 --- a/vendor/cel.dev/expr/BUILD.bazel +++ b/vendor/cel.dev/expr/BUILD.bazel @@ -16,7 +16,7 @@ go_library( importpath = "cel.dev/expr", visibility = ["//visibility:public"], deps = [ - "//proto/cel/expr:google_rpc_status_go_proto", + "@org_golang_google_genproto_googleapis_rpc//status:go_default_library", "@org_golang_google_protobuf//reflect/protoreflect", "@org_golang_google_protobuf//runtime/protoimpl", "@org_golang_google_protobuf//types/known/anypb", diff --git a/vendor/cel.dev/expr/MODULE.bazel b/vendor/cel.dev/expr/MODULE.bazel new file mode 100644 index 0000000000000..9794266f56476 --- /dev/null +++ b/vendor/cel.dev/expr/MODULE.bazel @@ -0,0 +1,70 @@ +module( + name = "cel-spec", +) + +bazel_dep( + name = "bazel_skylib", + version = "1.7.1", +) +bazel_dep( + name = "gazelle", + version = "0.36.0", + repo_name = "bazel_gazelle", +) +bazel_dep( + name = "googleapis", + version = "0.0.0-20240819-fe8ba054a", + repo_name = "com_google_googleapis", +) +bazel_dep( + name = "protobuf", + version = "26.0", + repo_name = "com_google_protobuf", +) +bazel_dep( + name = "rules_cc", + version = "0.0.9", +) +bazel_dep( + name = "rules_go", + version = "0.49.0", + repo_name = "io_bazel_rules_go", +) +bazel_dep( + name = "rules_java", + version = "7.6.5", +) +bazel_dep( + name = "rules_proto", + version = "6.0.0", +) +bazel_dep( + name = "rules_python", + version = "0.35.0", +) + +### PYTHON ### +python = use_extension("@rules_python//python/extensions:python.bzl", "python") +python.toolchain( + ignore_root_user_error = True, + python_version = "3.11", +) + +switched_rules = use_extension("@com_google_googleapis//:extensions.bzl", "switched_rules") +switched_rules.use_languages( + cc = True, + go = True, + java = True, +) +use_repo(switched_rules, "com_google_googleapis_imports") + +go_sdk = use_extension("@io_bazel_rules_go//go:extensions.bzl", "go_sdk") +go_sdk.download(version = "1.21.1") + +go_deps = use_extension("@bazel_gazelle//:extensions.bzl", "go_deps") +go_deps.from_file(go_mod = "//:go.mod") +use_repo( + go_deps, + "org_golang_google_genproto_googleapis_rpc", + "org_golang_google_protobuf", +) diff --git a/vendor/cel.dev/expr/README.md b/vendor/cel.dev/expr/README.md index 2da1e7f2fa24a..7930c0b755cf7 100644 --- a/vendor/cel.dev/expr/README.md +++ b/vendor/cel.dev/expr/README.md @@ -33,8 +33,7 @@ The required components of a system that supports CEL are: * The textual representation of an expression as written by a developer. It is of similar syntax to expressions in C/C++/Java/JavaScript -* A binary representation of an expression. It is an abstract syntax tree - (AST). +* A representation of the program's abstract syntax tree (AST). * A compiler library that converts the textual representation to the binary representation. This can be done ahead of time (in the control plane) or just before evaluation (in the data plane). @@ -43,6 +42,15 @@ The required components of a system that supports CEL are: * An evaluator library that takes the binary format in the context and produces a result, usually a Boolean. +For use cases which require persistence or cross-process communcation, it is +highly recommended to serialize the type-checked expression as a protocol +buffer. The CEL team will maintains canonical protocol buffers for ASTs and +will keep these versions identical and wire-compatible in perpetuity: + +* [CEL canonical](https://github.com/google/cel-spec/tree/master/proto/cel/expr) +* [CEL v1alpha1](https://github.com/googleapis/googleapis/tree/master/google/api/expr/v1alpha1) + + Example of boolean conditions and object construction: ``` c diff --git a/vendor/cel.dev/expr/WORKSPACE b/vendor/cel.dev/expr/WORKSPACE index bb4c469adbbaf..b6dc9ed673042 100644 --- a/vendor/cel.dev/expr/WORKSPACE +++ b/vendor/cel.dev/expr/WORKSPACE @@ -27,13 +27,13 @@ http_archive( ], ) -# googleapis as of 05/26/2023 +# googleapis as of 09/16/2024 http_archive( name = "com_google_googleapis", - strip_prefix = "googleapis-07c27163ac591955d736f3057b1619ece66f5b99", - sha256 = "bd8e735d881fb829751ecb1a77038dda4a8d274c45490cb9fcf004583ee10571", + strip_prefix = "googleapis-4082d5e51e8481f6ccc384cacd896f4e78f19dee", + sha256 = "57319889d47578b3c89bf1b3f34888d796a8913d63b32d750a4cd12ed303c4e8", urls = [ - "https://github.com/googleapis/googleapis/archive/07c27163ac591955d736f3057b1619ece66f5b99.tar.gz", + "https://github.com/googleapis/googleapis/archive/4082d5e51e8481f6ccc384cacd896f4e78f19dee.tar.gz", ], ) @@ -95,22 +95,22 @@ switched_rules_by_language( # Do *not* call *_dependencies(), etc, yet. See comment at the end. # Generated Google APIs protos for Golang -# Generated Google APIs protos for Golang 05/25/2023 +# Generated Google APIs protos for Golang 08/26/2024 go_repository( name = "org_golang_google_genproto_googleapis_api", build_file_proto_mode = "disable_global", importpath = "google.golang.org/genproto/googleapis/api", - sum = "h1:m8v1xLLLzMe1m5P+gCTF8nJB9epwZQUBERm20Oy1poQ=", - version = "v0.0.0-20230525234035-dd9d682886f9", + sum = "h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw=", + version = "v0.0.0-20240826202546-f6391c0de4c7", ) -# Generated Google APIs protos for Golang 05/25/2023 +# Generated Google APIs protos for Golang 08/26/2024 go_repository( name = "org_golang_google_genproto_googleapis_rpc", build_file_proto_mode = "disable_global", importpath = "google.golang.org/genproto/googleapis/rpc", - sum = "h1:0nDDozoAU19Qb2HwhXadU8OcsiO/09cnTqhUtq2MEOM=", - version = "v0.0.0-20230525234030-28d5490b6b19", + sum = "h1:2035KHhUv+EpyB+hWgJnaWKJOdX1E95w2S8Rr4uWKTs=", + version = "v0.0.0-20240826202546-f6391c0de4c7", ) # gRPC deps diff --git a/vendor/cel.dev/expr/WORKSPACE.bzlmod b/vendor/cel.dev/expr/WORKSPACE.bzlmod new file mode 100644 index 0000000000000..e69de29bb2d1d diff --git a/vendor/cel.dev/expr/cloudbuild.yaml b/vendor/cel.dev/expr/cloudbuild.yaml index 8a8ea3763f6da..c40881f122779 100644 --- a/vendor/cel.dev/expr/cloudbuild.yaml +++ b/vendor/cel.dev/expr/cloudbuild.yaml @@ -1,8 +1,8 @@ steps: -- name: 'gcr.io/cloud-builders/bazel:6.4.0' +- name: 'gcr.io/cloud-builders/bazel:7.0.1' entrypoint: bazel - args: ['test', '--test_output=errors', '...'] - id: bazel-test + args: ['build', '...'] + id: bazel-build waitFor: ['-'] timeout: 15m options: diff --git a/vendor/cel.dev/expr/regen_go_proto.sh b/vendor/cel.dev/expr/regen_go_proto.sh index abf2f9788ea88..fdcbb3ce25675 100644 --- a/vendor/cel.dev/expr/regen_go_proto.sh +++ b/vendor/cel.dev/expr/regen_go_proto.sh @@ -1,9 +1,9 @@ #!/bin/sh -bazel build //proto/test/... -files=($(bazel aquery 'kind(proto, //proto/...)' | grep Outputs | grep "[.]pb[.]go" | sed 's/Outputs: \[//' | sed 's/\]//' | tr "," "\n")) +bazel build //proto/cel/expr/conformance/... +files=($(bazel aquery 'kind(proto, //proto/cel/expr/conformance/...)' | grep Outputs | grep "[.]pb[.]go" | sed 's/Outputs: \[//' | sed 's/\]//' | tr "," "\n")) for src in ${files[@]}; do - dst=$(echo $src | sed 's/\(.*\%\/github.com\/google\/cel-spec\/\(.*\)\)/\2/') + dst=$(echo $src | sed 's/\(.*\/cel.dev\/expr\/\(.*\)\)/\2/') echo "copying $dst" $(cp $src $dst) done diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/alert_policy_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/alert_policy_client.go index ae1dd6b9a2331..c099e6fa9b749 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/alert_policy_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/alert_policy_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -217,6 +218,8 @@ type alertPolicyGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewAlertPolicyClient creates a new alert policy service client based on gRPC. @@ -251,6 +254,7 @@ func NewAlertPolicyClient(ctx context.Context, opts ...option.ClientOption) (*Al connPool: connPool, alertPolicyClient: monitoringpb.NewAlertPolicyServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -304,7 +308,7 @@ func (c *alertPolicyGRPCClient) ListAlertPolicies(ctx context.Context, req *moni } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.alertPolicyClient.ListAlertPolicies(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.alertPolicyClient.ListAlertPolicies, req, settings.GRPC, c.logger, "ListAlertPolicies") return err }, opts...) if err != nil { @@ -339,7 +343,7 @@ func (c *alertPolicyGRPCClient) GetAlertPolicy(ctx context.Context, req *monitor var resp *monitoringpb.AlertPolicy err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.alertPolicyClient.GetAlertPolicy(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.alertPolicyClient.GetAlertPolicy, req, settings.GRPC, c.logger, "GetAlertPolicy") return err }, opts...) if err != nil { @@ -357,7 +361,7 @@ func (c *alertPolicyGRPCClient) CreateAlertPolicy(ctx context.Context, req *moni var resp *monitoringpb.AlertPolicy err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.alertPolicyClient.CreateAlertPolicy(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.alertPolicyClient.CreateAlertPolicy, req, settings.GRPC, c.logger, "CreateAlertPolicy") return err }, opts...) if err != nil { @@ -374,7 +378,7 @@ func (c *alertPolicyGRPCClient) DeleteAlertPolicy(ctx context.Context, req *moni opts = append((*c.CallOptions).DeleteAlertPolicy[0:len((*c.CallOptions).DeleteAlertPolicy):len((*c.CallOptions).DeleteAlertPolicy)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.alertPolicyClient.DeleteAlertPolicy(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.alertPolicyClient.DeleteAlertPolicy, req, settings.GRPC, c.logger, "DeleteAlertPolicy") return err }, opts...) return err @@ -389,7 +393,7 @@ func (c *alertPolicyGRPCClient) UpdateAlertPolicy(ctx context.Context, req *moni var resp *monitoringpb.AlertPolicy err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.alertPolicyClient.UpdateAlertPolicy(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.alertPolicyClient.UpdateAlertPolicy, req, settings.GRPC, c.logger, "UpdateAlertPolicy") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/auxiliary.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/auxiliary.go index 4de74e773e1e3..52c29f957e9c1 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/auxiliary.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/auxiliary.go @@ -43,7 +43,7 @@ type AlertPolicyIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.AlertPolicy, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *AlertPolicyIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -90,7 +90,7 @@ type GroupIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.Group, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *GroupIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -137,7 +137,7 @@ type MetricDescriptorIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*metricpb.MetricDescriptor, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *MetricDescriptorIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -184,7 +184,7 @@ type MonitoredResourceDescriptorIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoredrespb.MonitoredResourceDescriptor, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *MonitoredResourceDescriptorIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -231,7 +231,7 @@ type MonitoredResourceIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoredrespb.MonitoredResource, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *MonitoredResourceIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -278,7 +278,7 @@ type NotificationChannelDescriptorIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.NotificationChannelDescriptor, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *NotificationChannelDescriptorIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -325,7 +325,7 @@ type NotificationChannelIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.NotificationChannel, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *NotificationChannelIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -372,7 +372,7 @@ type ServiceIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.Service, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *ServiceIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -419,7 +419,7 @@ type ServiceLevelObjectiveIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.ServiceLevelObjective, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *ServiceLevelObjectiveIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -466,7 +466,7 @@ type SnoozeIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.Snooze, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *SnoozeIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -513,7 +513,7 @@ type TimeSeriesDataIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.TimeSeriesData, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *TimeSeriesDataIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -560,7 +560,7 @@ type TimeSeriesIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.TimeSeries, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *TimeSeriesIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -607,7 +607,7 @@ type UptimeCheckConfigIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.UptimeCheckConfig, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *UptimeCheckConfigIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -654,7 +654,7 @@ type UptimeCheckIpIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.UptimeCheckIp, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *UptimeCheckIpIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/doc.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/doc.go index e8c4036475352..633cd6d97753a 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/doc.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/doc.go @@ -19,6 +19,8 @@ // // Manages your Cloud Monitoring data and configurations. // +// NOTE: This package is in beta. It is not stable, and may be subject to changes. +// // # General documentation // // For information that is relevant for all client libraries please reference @@ -35,6 +37,7 @@ // // To get started with this package, create a client. // +// // go get cloud.google.com/go/monitoring/apiv3/v2@latest // ctx := context.Background() // // This snippet has been automatically generated and should be regarded as a code template only. // // It will require modifications to work: @@ -53,19 +56,7 @@ // // # Using the Client // -// The following is an example of making an API call with the newly created client. -// -// ctx := context.Background() -// // This snippet has been automatically generated and should be regarded as a code template only. -// // It will require modifications to work: -// // - It may require correct/in-range values for request initialization. -// // - It may require specifying regional endpoints when creating the service client as shown in: -// // https://pkg.go.dev/cloud.google.com/go#hdr-Client_Options -// c, err := monitoring.NewAlertPolicyClient(ctx) -// if err != nil { -// // TODO: Handle error. -// } -// defer c.Close() +// The following is an example of making an API call with the newly created client, mentioned above. // // req := &monitoringpb.CreateAlertPolicyRequest{ // // TODO: Fill request struct fields. @@ -92,33 +83,3 @@ // [Debugging Client Libraries]: https://pkg.go.dev/cloud.google.com/go#hdr-Debugging // [Inspecting errors]: https://pkg.go.dev/cloud.google.com/go#hdr-Inspecting_errors package monitoring // import "cloud.google.com/go/monitoring/apiv3/v2" - -import ( - "context" - - "google.golang.org/api/option" -) - -// For more information on implementing a client constructor hook, see -// https://github.com/googleapis/google-cloud-go/wiki/Customizing-constructors. -type clientHookParams struct{} -type clientHook func(context.Context, clientHookParams) ([]option.ClientOption, error) - -var versionClient string - -func getVersionClient() string { - if versionClient == "" { - return "UNKNOWN" - } - return versionClient -} - -// DefaultAuthScopes reports the default set of authentication scopes to use with this package. -func DefaultAuthScopes() []string { - return []string{ - "https://www.googleapis.com/auth/cloud-platform", - "https://www.googleapis.com/auth/monitoring", - "https://www.googleapis.com/auth/monitoring.read", - "https://www.googleapis.com/auth/monitoring.write", - } -} diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/group_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/group_client.go index da216081d5a32..e7e51bf789cab 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/group_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/group_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -235,6 +236,8 @@ type groupGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewGroupClient creates a new group service client based on gRPC. @@ -272,6 +275,7 @@ func NewGroupClient(ctx context.Context, opts ...option.ClientOption) (*GroupCli connPool: connPool, groupClient: monitoringpb.NewGroupServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -325,7 +329,7 @@ func (c *groupGRPCClient) ListGroups(ctx context.Context, req *monitoringpb.List } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.ListGroups(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.ListGroups, req, settings.GRPC, c.logger, "ListGroups") return err }, opts...) if err != nil { @@ -360,7 +364,7 @@ func (c *groupGRPCClient) GetGroup(ctx context.Context, req *monitoringpb.GetGro var resp *monitoringpb.Group err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.GetGroup(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.GetGroup, req, settings.GRPC, c.logger, "GetGroup") return err }, opts...) if err != nil { @@ -378,7 +382,7 @@ func (c *groupGRPCClient) CreateGroup(ctx context.Context, req *monitoringpb.Cre var resp *monitoringpb.Group err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.CreateGroup(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.CreateGroup, req, settings.GRPC, c.logger, "CreateGroup") return err }, opts...) if err != nil { @@ -396,7 +400,7 @@ func (c *groupGRPCClient) UpdateGroup(ctx context.Context, req *monitoringpb.Upd var resp *monitoringpb.Group err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.UpdateGroup(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.UpdateGroup, req, settings.GRPC, c.logger, "UpdateGroup") return err }, opts...) if err != nil { @@ -413,7 +417,7 @@ func (c *groupGRPCClient) DeleteGroup(ctx context.Context, req *monitoringpb.Del opts = append((*c.CallOptions).DeleteGroup[0:len((*c.CallOptions).DeleteGroup):len((*c.CallOptions).DeleteGroup)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.groupClient.DeleteGroup(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.groupClient.DeleteGroup, req, settings.GRPC, c.logger, "DeleteGroup") return err }, opts...) return err @@ -439,7 +443,7 @@ func (c *groupGRPCClient) ListGroupMembers(ctx context.Context, req *monitoringp } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.ListGroupMembers(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.ListGroupMembers, req, settings.GRPC, c.logger, "ListGroupMembers") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/helpers.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/helpers.go new file mode 100644 index 0000000000000..7eb0121796c07 --- /dev/null +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/helpers.go @@ -0,0 +1,64 @@ +// Copyright 2024 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// https://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// Code generated by protoc-gen-go_gapic. DO NOT EDIT. + +package monitoring + +import ( + "context" + "log/slog" + + "github.com/googleapis/gax-go/v2/internallog/grpclog" + "google.golang.org/api/option" + "google.golang.org/grpc" + "google.golang.org/protobuf/proto" +) + +const serviceName = "monitoring.googleapis.com" + +// For more information on implementing a client constructor hook, see +// https://github.com/googleapis/google-cloud-go/wiki/Customizing-constructors. +type clientHookParams struct{} +type clientHook func(context.Context, clientHookParams) ([]option.ClientOption, error) + +var versionClient string + +func getVersionClient() string { + if versionClient == "" { + return "UNKNOWN" + } + return versionClient +} + +// DefaultAuthScopes reports the default set of authentication scopes to use with this package. +func DefaultAuthScopes() []string { + return []string{ + "https://www.googleapis.com/auth/cloud-platform", + "https://www.googleapis.com/auth/monitoring", + "https://www.googleapis.com/auth/monitoring.read", + "https://www.googleapis.com/auth/monitoring.write", + } +} + +func executeRPC[I proto.Message, O proto.Message](ctx context.Context, fn func(context.Context, I, ...grpc.CallOption) (O, error), req I, opts []grpc.CallOption, logger *slog.Logger, rpc string) (O, error) { + var zero O + logger.DebugContext(ctx, "api request", "serviceName", serviceName, "rpcName", rpc, "request", grpclog.ProtoMessageRequest(ctx, req)) + resp, err := fn(ctx, req, opts...) + if err != nil { + return zero, err + } + logger.DebugContext(ctx, "api response", "serviceName", serviceName, "rpcName", rpc, "response", grpclog.ProtoMessageResponse(resp)) + return resp, err +} diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/metric_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/metric_client.go index d43d261d185ae..f5d405050c538 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/metric_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/metric_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -283,6 +284,8 @@ type metricGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewMetricClient creates a new metric service client based on gRPC. @@ -310,6 +313,7 @@ func NewMetricClient(ctx context.Context, opts ...option.ClientOption) (*MetricC connPool: connPool, metricClient: monitoringpb.NewMetricServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -363,7 +367,7 @@ func (c *metricGRPCClient) ListMonitoredResourceDescriptors(ctx context.Context, } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.ListMonitoredResourceDescriptors(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.ListMonitoredResourceDescriptors, req, settings.GRPC, c.logger, "ListMonitoredResourceDescriptors") return err }, opts...) if err != nil { @@ -398,7 +402,7 @@ func (c *metricGRPCClient) GetMonitoredResourceDescriptor(ctx context.Context, r var resp *monitoredrespb.MonitoredResourceDescriptor err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.GetMonitoredResourceDescriptor(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.GetMonitoredResourceDescriptor, req, settings.GRPC, c.logger, "GetMonitoredResourceDescriptor") return err }, opts...) if err != nil { @@ -427,7 +431,7 @@ func (c *metricGRPCClient) ListMetricDescriptors(ctx context.Context, req *monit } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.ListMetricDescriptors(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.ListMetricDescriptors, req, settings.GRPC, c.logger, "ListMetricDescriptors") return err }, opts...) if err != nil { @@ -462,7 +466,7 @@ func (c *metricGRPCClient) GetMetricDescriptor(ctx context.Context, req *monitor var resp *metricpb.MetricDescriptor err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.GetMetricDescriptor(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.GetMetricDescriptor, req, settings.GRPC, c.logger, "GetMetricDescriptor") return err }, opts...) if err != nil { @@ -480,7 +484,7 @@ func (c *metricGRPCClient) CreateMetricDescriptor(ctx context.Context, req *moni var resp *metricpb.MetricDescriptor err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.CreateMetricDescriptor(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.CreateMetricDescriptor, req, settings.GRPC, c.logger, "CreateMetricDescriptor") return err }, opts...) if err != nil { @@ -497,7 +501,7 @@ func (c *metricGRPCClient) DeleteMetricDescriptor(ctx context.Context, req *moni opts = append((*c.CallOptions).DeleteMetricDescriptor[0:len((*c.CallOptions).DeleteMetricDescriptor):len((*c.CallOptions).DeleteMetricDescriptor)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.metricClient.DeleteMetricDescriptor(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.metricClient.DeleteMetricDescriptor, req, settings.GRPC, c.logger, "DeleteMetricDescriptor") return err }, opts...) return err @@ -523,7 +527,7 @@ func (c *metricGRPCClient) ListTimeSeries(ctx context.Context, req *monitoringpb } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.ListTimeSeries(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.ListTimeSeries, req, settings.GRPC, c.logger, "ListTimeSeries") return err }, opts...) if err != nil { @@ -557,7 +561,7 @@ func (c *metricGRPCClient) CreateTimeSeries(ctx context.Context, req *monitoring opts = append((*c.CallOptions).CreateTimeSeries[0:len((*c.CallOptions).CreateTimeSeries):len((*c.CallOptions).CreateTimeSeries)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.metricClient.CreateTimeSeries(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.metricClient.CreateTimeSeries, req, settings.GRPC, c.logger, "CreateTimeSeries") return err }, opts...) return err @@ -571,7 +575,7 @@ func (c *metricGRPCClient) CreateServiceTimeSeries(ctx context.Context, req *mon opts = append((*c.CallOptions).CreateServiceTimeSeries[0:len((*c.CallOptions).CreateServiceTimeSeries):len((*c.CallOptions).CreateServiceTimeSeries)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.metricClient.CreateServiceTimeSeries(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.metricClient.CreateServiceTimeSeries, req, settings.GRPC, c.logger, "CreateServiceTimeSeries") return err }, opts...) return err diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert.pb.go index e7b3595fa6414..222e1d170a1a9 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/alert.proto @@ -26,6 +26,7 @@ import ( _ "google.golang.org/genproto/googleapis/api/annotations" status "google.golang.org/genproto/googleapis/rpc/status" + timeofday "google.golang.org/genproto/googleapis/type/timeofday" protoreflect "google.golang.org/protobuf/reflect/protoreflect" protoimpl "google.golang.org/protobuf/runtime/protoimpl" durationpb "google.golang.org/protobuf/types/known/durationpb" @@ -102,7 +103,7 @@ func (AlertPolicy_ConditionCombinerType) EnumDescriptor() ([]byte, []int) { return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 0} } -// An enumeration of possible severity level for an Alert Policy. +// An enumeration of possible severity level for an alerting policy. type AlertPolicy_Severity int32 const ( @@ -225,17 +226,70 @@ func (AlertPolicy_Condition_EvaluationMissingData) EnumDescriptor() ([]byte, []i return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 0} } +// Control when notifications will be sent out. +type AlertPolicy_AlertStrategy_NotificationPrompt int32 + +const ( + // No strategy specified. Treated as error. + AlertPolicy_AlertStrategy_NOTIFICATION_PROMPT_UNSPECIFIED AlertPolicy_AlertStrategy_NotificationPrompt = 0 + // Notify when an incident is opened. + AlertPolicy_AlertStrategy_OPENED AlertPolicy_AlertStrategy_NotificationPrompt = 1 + // Notify when an incident is closed. + AlertPolicy_AlertStrategy_CLOSED AlertPolicy_AlertStrategy_NotificationPrompt = 3 +) + +// Enum value maps for AlertPolicy_AlertStrategy_NotificationPrompt. +var ( + AlertPolicy_AlertStrategy_NotificationPrompt_name = map[int32]string{ + 0: "NOTIFICATION_PROMPT_UNSPECIFIED", + 1: "OPENED", + 3: "CLOSED", + } + AlertPolicy_AlertStrategy_NotificationPrompt_value = map[string]int32{ + "NOTIFICATION_PROMPT_UNSPECIFIED": 0, + "OPENED": 1, + "CLOSED": 3, + } +) + +func (x AlertPolicy_AlertStrategy_NotificationPrompt) Enum() *AlertPolicy_AlertStrategy_NotificationPrompt { + p := new(AlertPolicy_AlertStrategy_NotificationPrompt) + *p = x + return p +} + +func (x AlertPolicy_AlertStrategy_NotificationPrompt) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (AlertPolicy_AlertStrategy_NotificationPrompt) Descriptor() protoreflect.EnumDescriptor { + return file_google_monitoring_v3_alert_proto_enumTypes[3].Descriptor() +} + +func (AlertPolicy_AlertStrategy_NotificationPrompt) Type() protoreflect.EnumType { + return &file_google_monitoring_v3_alert_proto_enumTypes[3] +} + +func (x AlertPolicy_AlertStrategy_NotificationPrompt) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Use AlertPolicy_AlertStrategy_NotificationPrompt.Descriptor instead. +func (AlertPolicy_AlertStrategy_NotificationPrompt) EnumDescriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 2, 0} +} + // A description of the conditions under which some aspect of your system is // considered to be "unhealthy" and the ways to notify people or services about -// this state. For an overview of alert policies, see +// this state. For an overview of alerting policies, see // [Introduction to Alerting](https://cloud.google.com/monitoring/alerts/). type AlertPolicy struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Required if the policy exists. The resource name for this policy. The - // format is: + // Identifier. Required if the policy exists. The resource name for this + // policy. The format is: // // projects/[PROJECT_ID_OR_NUMBER]/alertPolicies/[ALERT_POLICY_ID] // @@ -297,9 +351,9 @@ type AlertPolicy struct { // field should always be populated on List and Get operations, unless // a field projection has been specified that strips it out. Enabled *wrapperspb.BoolValue `protobuf:"bytes,17,opt,name=enabled,proto3" json:"enabled,omitempty"` - // Read-only description of how the alert policy is invalid. This field is - // only set when the alert policy is invalid. An invalid alert policy will not - // generate incidents. + // Read-only description of how the alerting policy is invalid. This field is + // only set when the alerting policy is invalid. An invalid alerting policy + // will not generate incidents. Validity *status.Status `protobuf:"bytes,18,opt,name=validity,proto3" json:"validity,omitempty"` // Identifies the notification channels to which notifications should be sent // when incidents are opened or closed or when new violations occur on @@ -318,21 +372,19 @@ type AlertPolicy struct { // A read-only record of the most recent change to the alerting policy. If // provided in a call to create or update, this field will be ignored. MutationRecord *MutationRecord `protobuf:"bytes,11,opt,name=mutation_record,json=mutationRecord,proto3" json:"mutation_record,omitempty"` - // Control over how this alert policy's notification channels are notified. + // Control over how this alerting policy's notification channels are notified. AlertStrategy *AlertPolicy_AlertStrategy `protobuf:"bytes,21,opt,name=alert_strategy,json=alertStrategy,proto3" json:"alert_strategy,omitempty"` - // Optional. The severity of an alert policy indicates how important incidents - // generated by that policy are. The severity level will be displayed on the - // Incident detail page and in notifications. + // Optional. The severity of an alerting policy indicates how important + // incidents generated by that policy are. The severity level will be + // displayed on the Incident detail page and in notifications. Severity AlertPolicy_Severity `protobuf:"varint,22,opt,name=severity,proto3,enum=google.monitoring.v3.AlertPolicy_Severity" json:"severity,omitempty"` } func (x *AlertPolicy) Reset() { *x = AlertPolicy{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy) String() string { @@ -343,7 +395,7 @@ func (*AlertPolicy) ProtoMessage() {} func (x *AlertPolicy) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -460,7 +512,7 @@ type AlertPolicy_Documentation struct { // The content may not exceed 8,192 Unicode characters and may not exceed // more than 10,240 bytes when encoded in UTF-8 format, whichever is // smaller. This text can be [templatized by using - // variables](https://cloud.google.com/monitoring/alerts/doc-variables). + // variables](https://cloud.google.com/monitoring/alerts/doc-variables#doc-vars). Content string `protobuf:"bytes,1,opt,name=content,proto3" json:"content,omitempty"` // The format of the `content` field. Presently, only the value // `"text/markdown"` is supported. See @@ -476,7 +528,7 @@ type AlertPolicy_Documentation struct { // it is common to define textual fields in databases as VARCHAR(255). // // The contents of the subject line can be [templatized by using - // variables](https://cloud.google.com/monitoring/alerts/doc-variables). + // variables](https://cloud.google.com/monitoring/alerts/doc-variables#doc-vars). // If this field is missing or empty, a default subject line will be // generated. Subject string `protobuf:"bytes,3,opt,name=subject,proto3" json:"subject,omitempty"` @@ -487,11 +539,9 @@ type AlertPolicy_Documentation struct { func (x *AlertPolicy_Documentation) Reset() { *x = AlertPolicy_Documentation{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Documentation) String() string { @@ -502,7 +552,7 @@ func (*AlertPolicy_Documentation) ProtoMessage() {} func (x *AlertPolicy_Documentation) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -592,16 +642,15 @@ type AlertPolicy_Condition struct { // *AlertPolicy_Condition_ConditionMatchedLog // *AlertPolicy_Condition_ConditionMonitoringQueryLanguage // *AlertPolicy_Condition_ConditionPrometheusQueryLanguage + // *AlertPolicy_Condition_ConditionSql Condition isAlertPolicy_Condition_Condition `protobuf_oneof:"condition"` } func (x *AlertPolicy_Condition) Reset() { *x = AlertPolicy_Condition{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition) String() string { @@ -612,7 +661,7 @@ func (*AlertPolicy_Condition) ProtoMessage() {} func (x *AlertPolicy_Condition) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -683,6 +732,13 @@ func (x *AlertPolicy_Condition) GetConditionPrometheusQueryLanguage() *AlertPoli return nil } +func (x *AlertPolicy_Condition) GetConditionSql() *AlertPolicy_Condition_SqlCondition { + if x, ok := x.GetCondition().(*AlertPolicy_Condition_ConditionSql); ok { + return x.ConditionSql + } + return nil +} + type isAlertPolicy_Condition_Condition interface { isAlertPolicy_Condition_Condition() } @@ -715,6 +771,11 @@ type AlertPolicy_Condition_ConditionPrometheusQueryLanguage struct { ConditionPrometheusQueryLanguage *AlertPolicy_Condition_PrometheusQueryLanguageCondition `protobuf:"bytes,21,opt,name=condition_prometheus_query_language,json=conditionPrometheusQueryLanguage,proto3,oneof"` } +type AlertPolicy_Condition_ConditionSql struct { + // A condition that periodically evaluates a SQL query result. + ConditionSql *AlertPolicy_Condition_SqlCondition `protobuf:"bytes,22,opt,name=condition_sql,json=conditionSql,proto3,oneof"` +} + func (*AlertPolicy_Condition_ConditionThreshold) isAlertPolicy_Condition_Condition() {} func (*AlertPolicy_Condition_ConditionAbsent) isAlertPolicy_Condition_Condition() {} @@ -725,6 +786,8 @@ func (*AlertPolicy_Condition_ConditionMonitoringQueryLanguage) isAlertPolicy_Con func (*AlertPolicy_Condition_ConditionPrometheusQueryLanguage) isAlertPolicy_Condition_Condition() {} +func (*AlertPolicy_Condition_ConditionSql) isAlertPolicy_Condition_Condition() {} + // Control over how the notification channels in `notification_channels` // are notified when this alert fires. type AlertPolicy_AlertStrategy struct { @@ -732,11 +795,17 @@ type AlertPolicy_AlertStrategy struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Required for alert policies with a `LogMatch` condition. + // Required for log-based alerting policies, i.e. policies with a `LogMatch` + // condition. // - // This limit is not implemented for alert policies that are not log-based. + // This limit is not implemented for alerting policies that do not have + // a LogMatch condition. NotificationRateLimit *AlertPolicy_AlertStrategy_NotificationRateLimit `protobuf:"bytes,1,opt,name=notification_rate_limit,json=notificationRateLimit,proto3" json:"notification_rate_limit,omitempty"` - // If an alert policy that was active has no data for this long, any open + // For log-based alert policies, the notification prompts is always + // [OPENED]. For non log-based alert policies, the notification prompts can + // be [OPENED] or [OPENED, CLOSED]. + NotificationPrompts []AlertPolicy_AlertStrategy_NotificationPrompt `protobuf:"varint,2,rep,packed,name=notification_prompts,json=notificationPrompts,proto3,enum=google.monitoring.v3.AlertPolicy_AlertStrategy_NotificationPrompt" json:"notification_prompts,omitempty"` + // If an alerting policy that was active has no data for this long, any open // incidents will close AutoClose *durationpb.Duration `protobuf:"bytes,3,opt,name=auto_close,json=autoClose,proto3" json:"auto_close,omitempty"` // Control how notifications will be sent out, on a per-channel basis. @@ -745,11 +814,9 @@ type AlertPolicy_AlertStrategy struct { func (x *AlertPolicy_AlertStrategy) Reset() { *x = AlertPolicy_AlertStrategy{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_AlertStrategy) String() string { @@ -760,7 +827,7 @@ func (*AlertPolicy_AlertStrategy) ProtoMessage() {} func (x *AlertPolicy_AlertStrategy) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -782,6 +849,13 @@ func (x *AlertPolicy_AlertStrategy) GetNotificationRateLimit() *AlertPolicy_Aler return nil } +func (x *AlertPolicy_AlertStrategy) GetNotificationPrompts() []AlertPolicy_AlertStrategy_NotificationPrompt { + if x != nil { + return x.NotificationPrompts + } + return nil +} + func (x *AlertPolicy_AlertStrategy) GetAutoClose() *durationpb.Duration { if x != nil { return x.AutoClose @@ -815,11 +889,9 @@ type AlertPolicy_Documentation_Link struct { func (x *AlertPolicy_Documentation_Link) Reset() { *x = AlertPolicy_Documentation_Link{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Documentation_Link) String() string { @@ -830,7 +902,7 @@ func (*AlertPolicy_Documentation_Link) ProtoMessage() {} func (x *AlertPolicy_Documentation_Link) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -877,11 +949,9 @@ type AlertPolicy_Condition_Trigger struct { func (x *AlertPolicy_Condition_Trigger) Reset() { *x = AlertPolicy_Condition_Trigger{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_Trigger) String() string { @@ -892,7 +962,7 @@ func (*AlertPolicy_Condition_Trigger) ProtoMessage() {} func (x *AlertPolicy_Condition_Trigger) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1041,11 +1111,9 @@ type AlertPolicy_Condition_MetricThreshold struct { func (x *AlertPolicy_Condition_MetricThreshold) Reset() { *x = AlertPolicy_Condition_MetricThreshold{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_MetricThreshold) String() string { @@ -1056,7 +1124,7 @@ func (*AlertPolicy_Condition_MetricThreshold) ProtoMessage() {} func (x *AlertPolicy_Condition_MetricThreshold) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1192,11 +1260,9 @@ type AlertPolicy_Condition_MetricAbsence struct { func (x *AlertPolicy_Condition_MetricAbsence) Reset() { *x = AlertPolicy_Condition_MetricAbsence{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_MetricAbsence) String() string { @@ -1207,7 +1273,7 @@ func (*AlertPolicy_Condition_MetricAbsence) ProtoMessage() {} func (x *AlertPolicy_Condition_MetricAbsence) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1279,11 +1345,9 @@ type AlertPolicy_Condition_LogMatch struct { func (x *AlertPolicy_Condition_LogMatch) Reset() { *x = AlertPolicy_Condition_LogMatch{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_LogMatch) String() string { @@ -1294,7 +1358,7 @@ func (*AlertPolicy_Condition_LogMatch) ProtoMessage() {} func (x *AlertPolicy_Condition_LogMatch) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1323,7 +1387,7 @@ func (x *AlertPolicy_Condition_LogMatch) GetLabelExtractors() map[string]string return nil } -// A condition type that allows alert policies to be defined using +// A condition type that allows alerting policies to be defined using // [Monitoring Query Language](https://cloud.google.com/monitoring/mql). type AlertPolicy_Condition_MonitoringQueryLanguageCondition struct { state protoimpl.MessageState @@ -1358,11 +1422,9 @@ type AlertPolicy_Condition_MonitoringQueryLanguageCondition struct { func (x *AlertPolicy_Condition_MonitoringQueryLanguageCondition) Reset() { *x = AlertPolicy_Condition_MonitoringQueryLanguageCondition{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_MonitoringQueryLanguageCondition) String() string { @@ -1373,7 +1435,7 @@ func (*AlertPolicy_Condition_MonitoringQueryLanguageCondition) ProtoMessage() {} func (x *AlertPolicy_Condition_MonitoringQueryLanguageCondition) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1416,7 +1478,7 @@ func (x *AlertPolicy_Condition_MonitoringQueryLanguageCondition) GetEvaluationMi return AlertPolicy_Condition_EVALUATION_MISSING_DATA_UNSPECIFIED } -// A condition type that allows alert policies to be defined using +// A condition type that allows alerting policies to be defined using // [Prometheus Query Language // (PromQL)](https://prometheus.io/docs/prometheus/latest/querying/basics/). // @@ -1474,7 +1536,7 @@ type AlertPolicy_Condition_PrometheusQueryLanguageCondition struct { // Label names [must be // valid](https://prometheus.io/docs/concepts/data_model/#metric-names-and-labels). // Label values can be [templatized by using - // variables](https://cloud.google.com/monitoring/alerts/doc-variables). + // variables](https://cloud.google.com/monitoring/alerts/doc-variables#doc-vars). // The only available variable names are the names of the labels in the // PromQL result, including "__name__" and "value". "labels" may be empty. Labels map[string]string `protobuf:"bytes,4,rep,name=labels,proto3" json:"labels,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` @@ -1505,15 +1567,23 @@ type AlertPolicy_Condition_PrometheusQueryLanguageCondition struct { // name](https://prometheus.io/docs/concepts/data_model/#metric-names-and-labels). // This field may not exceed 2048 Unicode characters in length. AlertRule string `protobuf:"bytes,6,opt,name=alert_rule,json=alertRule,proto3" json:"alert_rule,omitempty"` + // Optional. Whether to disable metric existence validation for this + // condition. + // + // This allows alerting policies to be defined on metrics that do not yet + // exist, improving advanced customer workflows such as configuring + // alerting policies using Terraform. + // + // Users with the `monitoring.alertPolicyViewer` role are able to see the + // name of the non-existent metric in the alerting policy condition. + DisableMetricValidation bool `protobuf:"varint,7,opt,name=disable_metric_validation,json=disableMetricValidation,proto3" json:"disable_metric_validation,omitempty"` } func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) Reset() { *x = AlertPolicy_Condition_PrometheusQueryLanguageCondition{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) String() string { @@ -1524,7 +1594,7 @@ func (*AlertPolicy_Condition_PrometheusQueryLanguageCondition) ProtoMessage() {} func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1581,6 +1651,185 @@ func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) GetAlertRule() return "" } +func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) GetDisableMetricValidation() bool { + if x != nil { + return x.DisableMetricValidation + } + return false +} + +// A condition that allows alerting policies to be defined using GoogleSQL. +// SQL conditions examine a sliding window of logs using GoogleSQL. +// Alert policies with SQL conditions may incur additional billing. +type AlertPolicy_Condition_SqlCondition struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The Log Analytics SQL query to run, as a string. The query + // must conform to the required shape. Specifically, the query must not + // try to filter the input by time. A filter will automatically be + // applied to filter the input so that the query receives all rows + // received since the last time the query was run. + // + // For example, the following query extracts all log entries containing an + // HTTP request: + // + // SELECT + // timestamp, log_name, severity, http_request, resource, labels + // FROM + // my-project.global._Default._AllLogs + // WHERE + // http_request IS NOT NULL + Query string `protobuf:"bytes,1,opt,name=query,proto3" json:"query,omitempty"` + // The schedule indicates how often the query should be run. + // + // Types that are assignable to Schedule: + // + // *AlertPolicy_Condition_SqlCondition_Minutes_ + // *AlertPolicy_Condition_SqlCondition_Hourly_ + // *AlertPolicy_Condition_SqlCondition_Daily_ + Schedule isAlertPolicy_Condition_SqlCondition_Schedule `protobuf_oneof:"schedule"` + // The test to be run against the SQL result set. + // + // Types that are assignable to Evaluate: + // + // *AlertPolicy_Condition_SqlCondition_RowCountTest_ + // *AlertPolicy_Condition_SqlCondition_BooleanTest_ + Evaluate isAlertPolicy_Condition_SqlCondition_Evaluate `protobuf_oneof:"evaluate"` +} + +func (x *AlertPolicy_Condition_SqlCondition) Reset() { + *x = AlertPolicy_Condition_SqlCondition{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[12] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6} +} + +func (x *AlertPolicy_Condition_SqlCondition) GetQuery() string { + if x != nil { + return x.Query + } + return "" +} + +func (m *AlertPolicy_Condition_SqlCondition) GetSchedule() isAlertPolicy_Condition_SqlCondition_Schedule { + if m != nil { + return m.Schedule + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetMinutes() *AlertPolicy_Condition_SqlCondition_Minutes { + if x, ok := x.GetSchedule().(*AlertPolicy_Condition_SqlCondition_Minutes_); ok { + return x.Minutes + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetHourly() *AlertPolicy_Condition_SqlCondition_Hourly { + if x, ok := x.GetSchedule().(*AlertPolicy_Condition_SqlCondition_Hourly_); ok { + return x.Hourly + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetDaily() *AlertPolicy_Condition_SqlCondition_Daily { + if x, ok := x.GetSchedule().(*AlertPolicy_Condition_SqlCondition_Daily_); ok { + return x.Daily + } + return nil +} + +func (m *AlertPolicy_Condition_SqlCondition) GetEvaluate() isAlertPolicy_Condition_SqlCondition_Evaluate { + if m != nil { + return m.Evaluate + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetRowCountTest() *AlertPolicy_Condition_SqlCondition_RowCountTest { + if x, ok := x.GetEvaluate().(*AlertPolicy_Condition_SqlCondition_RowCountTest_); ok { + return x.RowCountTest + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetBooleanTest() *AlertPolicy_Condition_SqlCondition_BooleanTest { + if x, ok := x.GetEvaluate().(*AlertPolicy_Condition_SqlCondition_BooleanTest_); ok { + return x.BooleanTest + } + return nil +} + +type isAlertPolicy_Condition_SqlCondition_Schedule interface { + isAlertPolicy_Condition_SqlCondition_Schedule() +} + +type AlertPolicy_Condition_SqlCondition_Minutes_ struct { + // Schedule the query to execute every so many minutes. + Minutes *AlertPolicy_Condition_SqlCondition_Minutes `protobuf:"bytes,2,opt,name=minutes,proto3,oneof"` +} + +type AlertPolicy_Condition_SqlCondition_Hourly_ struct { + // Schedule the query to execute every so many hours. + Hourly *AlertPolicy_Condition_SqlCondition_Hourly `protobuf:"bytes,3,opt,name=hourly,proto3,oneof"` +} + +type AlertPolicy_Condition_SqlCondition_Daily_ struct { + // Schedule the query to execute every so many days. + Daily *AlertPolicy_Condition_SqlCondition_Daily `protobuf:"bytes,4,opt,name=daily,proto3,oneof"` +} + +func (*AlertPolicy_Condition_SqlCondition_Minutes_) isAlertPolicy_Condition_SqlCondition_Schedule() {} + +func (*AlertPolicy_Condition_SqlCondition_Hourly_) isAlertPolicy_Condition_SqlCondition_Schedule() {} + +func (*AlertPolicy_Condition_SqlCondition_Daily_) isAlertPolicy_Condition_SqlCondition_Schedule() {} + +type isAlertPolicy_Condition_SqlCondition_Evaluate interface { + isAlertPolicy_Condition_SqlCondition_Evaluate() +} + +type AlertPolicy_Condition_SqlCondition_RowCountTest_ struct { + // Test the row count against a threshold. + RowCountTest *AlertPolicy_Condition_SqlCondition_RowCountTest `protobuf:"bytes,5,opt,name=row_count_test,json=rowCountTest,proto3,oneof"` +} + +type AlertPolicy_Condition_SqlCondition_BooleanTest_ struct { + // Test the boolean value in the indicated column. + BooleanTest *AlertPolicy_Condition_SqlCondition_BooleanTest `protobuf:"bytes,6,opt,name=boolean_test,json=booleanTest,proto3,oneof"` +} + +func (*AlertPolicy_Condition_SqlCondition_RowCountTest_) isAlertPolicy_Condition_SqlCondition_Evaluate() { +} + +func (*AlertPolicy_Condition_SqlCondition_BooleanTest_) isAlertPolicy_Condition_SqlCondition_Evaluate() { +} + // Options used when forecasting the time series and testing // the predicted value against the threshold. type AlertPolicy_Condition_MetricThreshold_ForecastOptions struct { @@ -1599,11 +1848,9 @@ type AlertPolicy_Condition_MetricThreshold_ForecastOptions struct { func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) Reset() { *x = AlertPolicy_Condition_MetricThreshold_ForecastOptions{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[13] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) String() string { @@ -1613,8 +1860,8 @@ func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) String() string func (*AlertPolicy_Condition_MetricThreshold_ForecastOptions) ProtoMessage() {} func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) ProtoReflect() protoreflect.Message { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[13] + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1636,7 +1883,282 @@ func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) GetForecastHoriz return nil } -// Control over the rate of notifications sent to this alert policy's +// Used to schedule the query to run every so many minutes. +type AlertPolicy_Condition_SqlCondition_Minutes struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. Number of minutes between runs. The interval must be + // greater than or equal to 5 minutes and less than or equal to 1440 + // minutes. + Periodicity int32 `protobuf:"varint,1,opt,name=periodicity,proto3" json:"periodicity,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_Minutes) Reset() { + *x = AlertPolicy_Condition_SqlCondition_Minutes{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[16] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_Minutes) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_Minutes) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_Minutes) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[16] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_Minutes.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_Minutes) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 0} +} + +func (x *AlertPolicy_Condition_SqlCondition_Minutes) GetPeriodicity() int32 { + if x != nil { + return x.Periodicity + } + return 0 +} + +// Used to schedule the query to run every so many hours. +type AlertPolicy_Condition_SqlCondition_Hourly struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The number of hours between runs. Must be greater than or + // equal to 1 hour and less than or equal to 48 hours. + Periodicity int32 `protobuf:"varint,1,opt,name=periodicity,proto3" json:"periodicity,omitempty"` + // Optional. The number of minutes after the hour (in UTC) to run the + // query. Must be greater than or equal to 0 minutes and less than or + // equal to 59 minutes. If left unspecified, then an arbitrary offset + // is used. + MinuteOffset *int32 `protobuf:"varint,2,opt,name=minute_offset,json=minuteOffset,proto3,oneof" json:"minute_offset,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) Reset() { + *x = AlertPolicy_Condition_SqlCondition_Hourly{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[17] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_Hourly) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[17] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_Hourly.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_Hourly) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 1} +} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) GetPeriodicity() int32 { + if x != nil { + return x.Periodicity + } + return 0 +} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) GetMinuteOffset() int32 { + if x != nil && x.MinuteOffset != nil { + return *x.MinuteOffset + } + return 0 +} + +// Used to schedule the query to run every so many days. +type AlertPolicy_Condition_SqlCondition_Daily struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The number of days between runs. Must be greater than or + // equal to 1 day and less than or equal to 31 days. + Periodicity int32 `protobuf:"varint,1,opt,name=periodicity,proto3" json:"periodicity,omitempty"` + // Optional. The time of day (in UTC) at which the query should run. If + // left unspecified, the server picks an arbitrary time of day and runs + // the query at the same time each day. + ExecutionTime *timeofday.TimeOfDay `protobuf:"bytes,2,opt,name=execution_time,json=executionTime,proto3" json:"execution_time,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) Reset() { + *x = AlertPolicy_Condition_SqlCondition_Daily{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[18] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_Daily) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[18] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_Daily.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_Daily) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 2} +} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) GetPeriodicity() int32 { + if x != nil { + return x.Periodicity + } + return 0 +} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) GetExecutionTime() *timeofday.TimeOfDay { + if x != nil { + return x.ExecutionTime + } + return nil +} + +// A test that checks if the number of rows in the result set +// violates some threshold. +type AlertPolicy_Condition_SqlCondition_RowCountTest struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The comparison to apply between the number of rows returned + // by the query and the threshold. + Comparison ComparisonType `protobuf:"varint,1,opt,name=comparison,proto3,enum=google.monitoring.v3.ComparisonType" json:"comparison,omitempty"` + // Required. The value against which to compare the row count. + Threshold int64 `protobuf:"varint,2,opt,name=threshold,proto3" json:"threshold,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) Reset() { + *x = AlertPolicy_Condition_SqlCondition_RowCountTest{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[19] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_RowCountTest) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[19] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_RowCountTest.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_RowCountTest) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 3} +} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) GetComparison() ComparisonType { + if x != nil { + return x.Comparison + } + return ComparisonType_COMPARISON_UNSPECIFIED +} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) GetThreshold() int64 { + if x != nil { + return x.Threshold + } + return 0 +} + +// A test that uses an alerting result in a boolean column produced by +// the SQL query. +type AlertPolicy_Condition_SqlCondition_BooleanTest struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The name of the column containing the boolean value. If the + // value in a row is NULL, that row is ignored. + Column string `protobuf:"bytes,1,opt,name=column,proto3" json:"column,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_BooleanTest) Reset() { + *x = AlertPolicy_Condition_SqlCondition_BooleanTest{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[20] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_BooleanTest) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_BooleanTest) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_BooleanTest) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[20] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_BooleanTest.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_BooleanTest) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 4} +} + +func (x *AlertPolicy_Condition_SqlCondition_BooleanTest) GetColumn() string { + if x != nil { + return x.Column + } + return "" +} + +// Control over the rate of notifications sent to this alerting policy's // notification channels. type AlertPolicy_AlertStrategy_NotificationRateLimit struct { state protoimpl.MessageState @@ -1649,11 +2171,9 @@ type AlertPolicy_AlertStrategy_NotificationRateLimit struct { func (x *AlertPolicy_AlertStrategy_NotificationRateLimit) Reset() { *x = AlertPolicy_AlertStrategy_NotificationRateLimit{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[21] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_AlertStrategy_NotificationRateLimit) String() string { @@ -1663,8 +2183,8 @@ func (x *AlertPolicy_AlertStrategy_NotificationRateLimit) String() string { func (*AlertPolicy_AlertStrategy_NotificationRateLimit) ProtoMessage() {} func (x *AlertPolicy_AlertStrategy_NotificationRateLimit) ProtoReflect() protoreflect.Message { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[21] + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1708,11 +2228,9 @@ type AlertPolicy_AlertStrategy_NotificationChannelStrategy struct { func (x *AlertPolicy_AlertStrategy_NotificationChannelStrategy) Reset() { *x = AlertPolicy_AlertStrategy_NotificationChannelStrategy{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[16] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[22] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_AlertStrategy_NotificationChannelStrategy) String() string { @@ -1722,8 +2240,8 @@ func (x *AlertPolicy_AlertStrategy_NotificationChannelStrategy) String() string func (*AlertPolicy_AlertStrategy_NotificationChannelStrategy) ProtoMessage() {} func (x *AlertPolicy_AlertStrategy_NotificationChannelStrategy) ProtoReflect() protoreflect.Message { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[16] - if protoimpl.UnsafeEnabled && x != nil { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[22] + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1772,365 +2290,453 @@ var file_google_monitoring_v3_alert_proto_rawDesc = []byte{ 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x17, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x72, 0x70, 0x63, 0x2f, - 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x83, 0x2b, 0x0a, - 0x0b, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x12, 0x0a, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, - 0x61, 0x6d, 0x65, 0x12, 0x55, 0x0a, 0x0d, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x44, 0x6f, - 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x64, 0x6f, 0x63, - 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x52, 0x0a, 0x0b, 0x75, 0x73, - 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x10, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1b, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x66, + 0x64, 0x61, 0x79, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xe5, 0x35, 0x0a, 0x0b, 0x41, 0x6c, + 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x08, 0x52, 0x04, 0x6e, 0x61, + 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, + 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, + 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x55, 0x0a, 0x0d, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, + 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, + 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x64, + 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x52, 0x0a, 0x0b, + 0x75, 0x73, 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x10, 0x20, 0x03, 0x28, + 0x0b, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, + 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, + 0x12, 0x4b, 0x0a, 0x0a, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0c, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, + 0x6e, 0x52, 0x0a, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x53, 0x0a, + 0x08, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, + 0x37, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x4b, - 0x0a, 0x0a, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0c, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6d, 0x62, + 0x69, 0x6e, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x52, 0x08, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, + 0x65, 0x72, 0x12, 0x34, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x11, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, + 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x2e, 0x0a, 0x08, 0x76, 0x61, 0x6c, 0x69, + 0x64, 0x69, 0x74, 0x79, 0x18, 0x12, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x08, + 0x76, 0x61, 0x6c, 0x69, 0x64, 0x69, 0x74, 0x79, 0x12, 0x33, 0x0a, 0x15, 0x6e, 0x6f, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x73, 0x18, 0x0e, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x4d, 0x0a, + 0x0f, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, + 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, + 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x63, 0x72, + 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x4d, 0x0a, 0x0f, + 0x6d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, + 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x6d, 0x75, 0x74, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x56, 0x0a, 0x0e, 0x61, + 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x18, 0x15, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, + 0x74, 0x65, 0x67, 0x79, 0x52, 0x0d, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, + 0x65, 0x67, 0x79, 0x12, 0x4b, 0x0a, 0x08, 0x73, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x18, + 0x16, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, + 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x53, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, + 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x73, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, + 0x1a, 0xf3, 0x01, 0x0a, 0x0d, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x12, 0x18, 0x0a, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x09, + 0x6d, 0x69, 0x6d, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x08, 0x6d, 0x69, 0x6d, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1d, 0x0a, 0x07, 0x73, 0x75, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, + 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x4f, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, + 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, + 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x44, 0x6f, 0x63, 0x75, 0x6d, + 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x42, 0x03, 0xe0, + 0x41, 0x01, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x1a, 0x3b, 0x0a, 0x04, 0x4c, 0x69, 0x6e, + 0x6b, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, + 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x10, 0x0a, 0x03, 0x75, 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, 0x1a, 0xa5, 0x23, 0x0a, 0x09, 0x43, 0x6f, 0x6e, 0x64, 0x69, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0c, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, + 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, + 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x6e, 0x0a, 0x13, 0x63, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, + 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, + 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x48, 0x00, 0x52, 0x12, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x66, 0x0a, 0x10, 0x63, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x74, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, + 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x41, 0x62, 0x73, 0x65, 0x6e, 0x63, 0x65, + 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x62, 0x73, + 0x65, 0x6e, 0x74, 0x12, 0x6a, 0x0a, 0x15, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x6c, 0x6f, 0x67, 0x18, 0x14, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x0a, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x53, 0x0a, 0x08, 0x63, - 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x37, 0x2e, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, + 0x4c, 0x6f, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x48, 0x00, 0x52, 0x13, 0x63, 0x6f, 0x6e, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x4c, 0x6f, 0x67, 0x12, + 0x9d, 0x01, 0x0a, 0x23, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x6c, + 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, - 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x52, 0x08, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, - 0x12, 0x34, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x11, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x07, 0x65, - 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x2e, 0x0a, 0x08, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x69, - 0x74, 0x79, 0x18, 0x12, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x08, 0x76, 0x61, - 0x6c, 0x69, 0x64, 0x69, 0x74, 0x79, 0x12, 0x33, 0x0a, 0x15, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x18, - 0x0e, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x4d, 0x0a, 0x0f, 0x63, - 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, 0x0a, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x63, 0x72, 0x65, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x4d, 0x0a, 0x0f, 0x6d, 0x75, - 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, 0x0b, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x6d, 0x75, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x56, 0x0a, 0x0e, 0x61, 0x6c, 0x65, - 0x72, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x18, 0x15, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, - 0x67, 0x79, 0x52, 0x0d, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, - 0x79, 0x12, 0x4b, 0x0a, 0x08, 0x73, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x18, 0x16, 0x20, - 0x01, 0x28, 0x0e, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x53, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x42, - 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x73, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x1a, 0xf3, - 0x01, 0x0a, 0x0d, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x12, 0x18, 0x0a, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x69, - 0x6d, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6d, - 0x69, 0x6d, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1d, 0x0a, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x07, 0x73, - 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x4f, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, - 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, - 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, - 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x01, - 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x1a, 0x3b, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, - 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, - 0x6d, 0x65, 0x12, 0x10, 0x0a, 0x03, 0x75, 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x03, 0x75, 0x72, 0x6c, 0x1a, 0x92, 0x1a, 0x0a, 0x09, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, - 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, - 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x6e, 0x0a, 0x13, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, + 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x20, 0x63, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x12, + 0x9d, 0x01, 0x0a, 0x23, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, + 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x5f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x6c, + 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x50, 0x72, 0x6f, 0x6d, 0x65, + 0x74, 0x68, 0x65, 0x75, 0x73, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, + 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x20, 0x63, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, + 0x75, 0x73, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x12, + 0x5f, 0x0a, 0x0d, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x73, 0x71, 0x6c, + 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x38, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, + 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, + 0x48, 0x00, 0x52, 0x0c, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x71, 0x6c, + 0x1a, 0x45, 0x0a, 0x07, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x12, 0x16, 0x0a, 0x05, 0x63, + 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x48, 0x00, 0x52, 0x05, 0x63, 0x6f, + 0x75, 0x6e, 0x74, 0x12, 0x1a, 0x0a, 0x07, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x01, 0x48, 0x00, 0x52, 0x07, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x42, + 0x06, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x1a, 0xc8, 0x06, 0x0a, 0x0f, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x1b, 0x0a, 0x06, 0x66, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, + 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x45, 0x0a, 0x0c, 0x61, 0x67, 0x67, 0x72, + 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x52, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, + 0x2d, 0x0a, 0x12, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x5f, 0x66, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x64, 0x65, 0x6e, + 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x5c, + 0x0a, 0x18, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x67, + 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0a, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x52, 0x17, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, + 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x76, 0x0a, 0x10, + 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, - 0x6f, 0x6c, 0x64, 0x48, 0x00, 0x52, 0x12, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x66, 0x0a, 0x10, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x74, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x41, 0x62, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x48, 0x00, - 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x62, 0x73, 0x65, 0x6e, - 0x74, 0x12, 0x6a, 0x0a, 0x15, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x6c, 0x6f, 0x67, 0x18, 0x14, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x6f, - 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x48, 0x00, 0x52, 0x13, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, - 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x4c, 0x6f, 0x67, 0x12, 0x9d, 0x01, - 0x0a, 0x23, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x6c, 0x61, 0x6e, - 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, + 0x6f, 0x6c, 0x64, 0x2e, 0x46, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x52, 0x0f, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x44, 0x0a, 0x0a, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, + 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x43, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0a, + 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x12, 0x27, 0x0a, 0x0f, 0x74, 0x68, + 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, + 0x01, 0x28, 0x01, 0x52, 0x0e, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, + 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x07, 0x74, 0x72, + 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, - 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, - 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x20, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x12, 0x9d, 0x01, - 0x0a, 0x23, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x6d, - 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x5f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x6c, 0x61, 0x6e, - 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, + 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x12, 0x79, 0x0a, 0x17, 0x65, 0x76, 0x61, + 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, + 0x64, 0x61, 0x74, 0x61, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x41, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, + 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x52, 0x15, 0x65, + 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, + 0x44, 0x61, 0x74, 0x61, 0x1a, 0x5c, 0x0a, 0x0f, 0x46, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x49, 0x0a, 0x10, 0x66, 0x6f, 0x72, 0x65, 0x63, + 0x61, 0x73, 0x74, 0x5f, 0x68, 0x6f, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, + 0x02, 0x52, 0x0f, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x48, 0x6f, 0x72, 0x69, 0x7a, + 0x6f, 0x6e, 0x1a, 0xf9, 0x01, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x41, 0x62, 0x73, + 0x65, 0x6e, 0x63, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, + 0x72, 0x12, 0x45, 0x0a, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, + 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x61, 0x67, 0x67, 0x72, + 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, + 0x4d, 0x0a, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x54, 0x72, + 0x69, 0x67, 0x67, 0x65, 0x72, 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x1a, 0xe1, + 0x01, 0x0a, 0x08, 0x4c, 0x6f, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x1b, 0x0a, 0x06, 0x66, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, + 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x74, 0x0a, 0x10, 0x6c, 0x61, 0x62, 0x65, + 0x6c, 0x5f, 0x65, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x49, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, + 0x4c, 0x6f, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, + 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x6c, + 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x1a, 0x42, + 0x0a, 0x14, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, + 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, + 0x38, 0x01, 0x1a, 0xb9, 0x02, 0x0a, 0x20, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x35, 0x0a, + 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, + 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, + 0x67, 0x65, 0x72, 0x12, 0x79, 0x0a, 0x17, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x04, + 0x20, 0x01, 0x28, 0x0e, 0x32, 0x41, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, + 0x6e, 0x2e, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, + 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x52, 0x15, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x1a, 0x85, + 0x04, 0x0a, 0x20, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x51, 0x75, 0x65, + 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x3a, + 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4f, 0x0a, 0x13, 0x65, 0x76, + 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, + 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x12, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x75, 0x0a, 0x06, 0x6c, + 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x58, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, - 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x20, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, - 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x1a, 0x45, 0x0a, - 0x07, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x12, 0x16, 0x0a, 0x05, 0x63, 0x6f, 0x75, 0x6e, - 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x48, 0x00, 0x52, 0x05, 0x63, 0x6f, 0x75, 0x6e, 0x74, - 0x12, 0x1a, 0x0a, 0x07, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x01, 0x48, 0x00, 0x52, 0x07, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x42, 0x06, 0x0a, 0x04, - 0x74, 0x79, 0x70, 0x65, 0x1a, 0xc8, 0x06, 0x0a, 0x0f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, - 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, - 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, - 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x45, 0x0a, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, - 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x2d, 0x0a, 0x12, - 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x5f, 0x66, 0x69, 0x6c, 0x74, - 0x65, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, - 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x5c, 0x0a, 0x18, 0x64, - 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x67, 0x67, 0x72, 0x65, - 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0a, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x17, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x41, 0x67, 0x67, - 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x76, 0x0a, 0x10, 0x66, 0x6f, 0x72, - 0x65, 0x63, 0x61, 0x73, 0x74, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0c, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, + 0x45, 0x6e, 0x74, 0x72, 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x06, 0x6c, 0x61, 0x62, 0x65, + 0x6c, 0x73, 0x12, 0x22, 0x0a, 0x0a, 0x72, 0x75, 0x6c, 0x65, 0x5f, 0x67, 0x72, 0x6f, 0x75, 0x70, + 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x72, 0x75, 0x6c, + 0x65, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x12, 0x22, 0x0a, 0x0a, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, + 0x72, 0x75, 0x6c, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, + 0x09, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x52, 0x75, 0x6c, 0x65, 0x12, 0x3f, 0x0a, 0x19, 0x64, 0x69, + 0x73, 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x76, 0x61, 0x6c, + 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x42, 0x03, 0xe0, + 0x41, 0x01, 0x52, 0x17, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, + 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, + 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x1a, 0xee, 0x07, 0x0a, 0x0c, 0x53, 0x71, 0x6c, 0x43, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, + 0x72, 0x79, 0x12, 0x5c, 0x0a, 0x07, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x40, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, - 0x2e, 0x46, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x52, 0x0f, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x12, 0x44, 0x0a, 0x0a, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, - 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0a, 0x63, 0x6f, 0x6d, - 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x12, 0x27, 0x0a, 0x0f, 0x74, 0x68, 0x72, 0x65, 0x73, - 0x68, 0x6f, 0x6c, 0x64, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x01, - 0x52, 0x0e, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x06, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, - 0x65, 0x72, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x69, + 0x6e, 0x75, 0x74, 0x65, 0x73, 0x48, 0x00, 0x52, 0x07, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, + 0x12, 0x59, 0x0a, 0x06, 0x68, 0x6f, 0x75, 0x72, 0x6c, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x3f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, + 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x48, 0x6f, 0x75, 0x72, 0x6c, + 0x79, 0x48, 0x00, 0x52, 0x06, 0x68, 0x6f, 0x75, 0x72, 0x6c, 0x79, 0x12, 0x56, 0x0a, 0x05, 0x64, + 0x61, 0x69, 0x6c, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3e, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, + 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, + 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x44, 0x61, 0x69, 0x6c, 0x79, 0x48, 0x00, 0x52, 0x05, 0x64, 0x61, + 0x69, 0x6c, 0x79, 0x12, 0x6d, 0x0a, 0x0e, 0x72, 0x6f, 0x77, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, + 0x5f, 0x74, 0x65, 0x73, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x45, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, 0x6f, 0x77, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x54, 0x65, + 0x73, 0x74, 0x48, 0x01, 0x52, 0x0c, 0x72, 0x6f, 0x77, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x54, 0x65, + 0x73, 0x74, 0x12, 0x69, 0x0a, 0x0c, 0x62, 0x6f, 0x6f, 0x6c, 0x65, 0x61, 0x6e, 0x5f, 0x74, 0x65, + 0x73, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x52, 0x07, 0x74, - 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x12, 0x79, 0x0a, 0x17, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, 0x74, - 0x61, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x41, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, - 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, - 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x52, 0x15, 0x65, 0x76, 0x61, 0x6c, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x65, 0x61, 0x6e, 0x54, 0x65, 0x73, 0x74, 0x48, 0x01, + 0x52, 0x0b, 0x62, 0x6f, 0x6f, 0x6c, 0x65, 0x61, 0x6e, 0x54, 0x65, 0x73, 0x74, 0x1a, 0x30, 0x0a, + 0x07, 0x4d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0b, 0x70, 0x65, 0x72, 0x69, + 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, + 0x41, 0x02, 0x52, 0x0b, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, 0x1a, + 0x70, 0x0a, 0x06, 0x48, 0x6f, 0x75, 0x72, 0x6c, 0x79, 0x12, 0x25, 0x0a, 0x0b, 0x70, 0x65, 0x72, + 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, + 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, + 0x12, 0x2d, 0x0a, 0x0d, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, + 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x00, 0x52, 0x0c, + 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x4f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x88, 0x01, 0x01, 0x42, + 0x10, 0x0a, 0x0e, 0x5f, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, + 0x74, 0x1a, 0x72, 0x0a, 0x05, 0x44, 0x61, 0x69, 0x6c, 0x79, 0x12, 0x25, 0x0a, 0x0b, 0x70, 0x65, + 0x72, 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, + 0x79, 0x12, 0x42, 0x0a, 0x0e, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x74, + 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x4f, 0x66, 0x44, 0x61, + 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0d, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, + 0x6e, 0x54, 0x69, 0x6d, 0x65, 0x1a, 0x7c, 0x0a, 0x0c, 0x52, 0x6f, 0x77, 0x43, 0x6f, 0x75, 0x6e, + 0x74, 0x54, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x0a, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, + 0x73, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, + 0x2e, 0x43, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, + 0x12, 0x21, 0x0a, 0x09, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x09, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, + 0x6f, 0x6c, 0x64, 0x1a, 0x2a, 0x0a, 0x0b, 0x42, 0x6f, 0x6f, 0x6c, 0x65, 0x61, 0x6e, 0x54, 0x65, + 0x73, 0x74, 0x12, 0x1b, 0x0a, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x42, + 0x0a, 0x0a, 0x08, 0x73, 0x63, 0x68, 0x65, 0x64, 0x75, 0x6c, 0x65, 0x42, 0x0a, 0x0a, 0x08, 0x65, + 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x65, 0x22, 0xad, 0x01, 0x0a, 0x15, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, - 0x61, 0x1a, 0x5c, 0x0a, 0x0f, 0x46, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x49, 0x0a, 0x10, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, - 0x5f, 0x68, 0x6f, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0f, - 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x48, 0x6f, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x1a, - 0xf9, 0x01, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x41, 0x62, 0x73, 0x65, 0x6e, 0x63, - 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x45, - 0x0a, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x05, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, - 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x07, - 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, + 0x61, 0x12, 0x27, 0x0a, 0x23, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, + 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x55, 0x4e, 0x53, + 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x24, 0x0a, 0x20, 0x45, 0x56, + 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, + 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x49, 0x4e, 0x41, 0x43, 0x54, 0x49, 0x56, 0x45, 0x10, 0x01, + 0x12, 0x22, 0x0a, 0x1e, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, + 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x41, 0x43, 0x54, 0x49, + 0x56, 0x45, 0x10, 0x02, 0x12, 0x21, 0x0a, 0x1d, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, + 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, + 0x4e, 0x4f, 0x5f, 0x4f, 0x50, 0x10, 0x03, 0x3a, 0x97, 0x02, 0xea, 0x41, 0x93, 0x02, 0x0a, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x46, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, + 0x74, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, + 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x2f, + 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, 0x6e, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x12, 0x50, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, + 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x7d, 0x2f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x12, 0x44, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, + 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, + 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x2f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x12, 0x01, + 0x2a, 0x42, 0x0b, 0x0a, 0x09, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x96, + 0x06, 0x0a, 0x0d, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, + 0x12, 0x7d, 0x0a, 0x17, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x72, 0x61, 0x74, 0x65, 0x5f, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x45, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, + 0x67, 0x79, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x52, 0x15, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, + 0x75, 0x0a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x70, 0x72, 0x6f, 0x6d, 0x70, 0x74, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x42, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, - 0x65, 0x72, 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x1a, 0xe1, 0x01, 0x0a, 0x08, - 0x4c, 0x6f, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, - 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, - 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x74, 0x0a, 0x10, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x65, - 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x49, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x6f, 0x67, - 0x4d, 0x61, 0x74, 0x63, 0x68, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, - 0x63, 0x74, 0x6f, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x6c, 0x61, 0x62, 0x65, - 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x1a, 0x42, 0x0a, 0x14, 0x4c, - 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x45, 0x6e, - 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x1a, - 0xb9, 0x02, 0x0a, 0x20, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x51, 0x75, - 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x4d, 0x0a, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, - 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, - 0x12, 0x79, 0x0a, 0x17, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, - 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x0e, 0x32, 0x41, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x45, - 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, - 0x44, 0x61, 0x74, 0x61, 0x52, 0x15, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x1a, 0xc4, 0x03, 0x0a, 0x20, - 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, - 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, - 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x3a, 0x0a, 0x08, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4f, 0x0a, 0x13, 0x65, 0x76, 0x61, 0x6c, 0x75, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, - 0x03, 0xe0, 0x41, 0x01, 0x52, 0x12, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x75, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x58, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x2e, 0x4e, + 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x6d, 0x70, + 0x74, 0x52, 0x13, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, + 0x72, 0x6f, 0x6d, 0x70, 0x74, 0x73, 0x12, 0x38, 0x0a, 0x0a, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x63, + 0x6c, 0x6f, 0x73, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x61, 0x75, 0x74, 0x6f, 0x43, 0x6c, 0x6f, 0x73, 0x65, + 0x12, 0x8f, 0x01, 0x0a, 0x1d, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, + 0x67, 0x79, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, - 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, - 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, - 0x22, 0x0a, 0x0a, 0x72, 0x75, 0x6c, 0x65, 0x5f, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x18, 0x05, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x72, 0x75, 0x6c, 0x65, 0x47, 0x72, - 0x6f, 0x75, 0x70, 0x12, 0x22, 0x0a, 0x0a, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x72, 0x75, 0x6c, - 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x61, 0x6c, - 0x65, 0x72, 0x74, 0x52, 0x75, 0x6c, 0x65, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, - 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, - 0x38, 0x01, 0x22, 0xad, 0x01, 0x0a, 0x15, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x12, 0x27, 0x0a, 0x23, - 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, - 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, - 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x24, 0x0a, 0x20, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, - 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, - 0x5f, 0x49, 0x4e, 0x41, 0x43, 0x54, 0x49, 0x56, 0x45, 0x10, 0x01, 0x12, 0x22, 0x0a, 0x1e, 0x45, - 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, - 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x41, 0x43, 0x54, 0x49, 0x56, 0x45, 0x10, 0x02, 0x12, - 0x21, 0x0a, 0x1d, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, - 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x4e, 0x4f, 0x5f, 0x4f, 0x50, - 0x10, 0x03, 0x3a, 0x97, 0x02, 0xea, 0x41, 0x93, 0x02, 0x0a, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x46, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x61, 0x6c, - 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, - 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x2f, 0x63, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x7d, 0x12, 0x50, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, - 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, - 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x2f, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x7d, 0x12, 0x44, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, - 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x7d, 0x2f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, - 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x12, 0x01, 0x2a, 0x42, 0x0b, 0x0a, 0x09, - 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xcc, 0x04, 0x0a, 0x0d, 0x41, 0x6c, - 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x12, 0x7d, 0x0a, 0x17, 0x6e, - 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x61, 0x74, 0x65, - 0x5f, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x45, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, - 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x2e, 0x4e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, - 0x6d, 0x69, 0x74, 0x52, 0x15, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, 0x38, 0x0a, 0x0a, 0x61, 0x75, - 0x74, 0x6f, 0x5f, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x61, 0x75, 0x74, 0x6f, 0x43, - 0x6c, 0x6f, 0x73, 0x65, 0x12, 0x8f, 0x01, 0x0a, 0x1d, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x73, 0x74, - 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x4b, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, - 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x2e, 0x4e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x52, 0x1b, 0x6e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x74, - 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x1a, 0x4a, 0x0a, 0x15, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, - 0x31, 0x0a, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x70, 0x65, 0x72, 0x69, - 0x6f, 0x64, 0x1a, 0xa3, 0x01, 0x0a, 0x1b, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x74, 0x72, + 0x61, 0x74, 0x65, 0x67, 0x79, 0x52, 0x1b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, - 0x67, 0x79, 0x12, 0x3c, 0x0a, 0x1a, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, - 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x18, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x73, - 0x12, 0x46, 0x0a, 0x11, 0x72, 0x65, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x79, 0x5f, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, + 0x67, 0x79, 0x1a, 0x4a, 0x0a, 0x15, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, 0x31, 0x0a, 0x06, 0x70, + 0x65, 0x72, 0x69, 0x6f, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x72, 0x65, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x79, - 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, 0x73, 0x65, 0x72, - 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, - 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x61, 0x0a, 0x15, 0x43, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, - 0x12, 0x17, 0x0a, 0x13, 0x43, 0x4f, 0x4d, 0x42, 0x49, 0x4e, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, - 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x4e, 0x44, - 0x10, 0x01, 0x12, 0x06, 0x0a, 0x02, 0x4f, 0x52, 0x10, 0x02, 0x12, 0x1e, 0x0a, 0x1a, 0x41, 0x4e, - 0x44, 0x5f, 0x57, 0x49, 0x54, 0x48, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x49, 0x4e, 0x47, 0x5f, - 0x52, 0x45, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x10, 0x03, 0x22, 0x4a, 0x0a, 0x08, 0x53, 0x65, - 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x12, 0x18, 0x0a, 0x14, 0x53, 0x45, 0x56, 0x45, 0x52, 0x49, - 0x54, 0x59, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, - 0x12, 0x0c, 0x0a, 0x08, 0x43, 0x52, 0x49, 0x54, 0x49, 0x43, 0x41, 0x4c, 0x10, 0x01, 0x12, 0x09, - 0x0a, 0x05, 0x45, 0x52, 0x52, 0x4f, 0x52, 0x10, 0x02, 0x12, 0x0b, 0x0a, 0x07, 0x57, 0x41, 0x52, - 0x4e, 0x49, 0x4e, 0x47, 0x10, 0x03, 0x3a, 0xc9, 0x01, 0xea, 0x41, 0xc5, 0x01, 0x0a, 0x25, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2f, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x12, 0x39, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, - 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, - 0x12, 0x2d, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, - 0x72, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x1a, 0xa3, + 0x01, 0x0a, 0x1b, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x12, 0x3c, + 0x0a, 0x1a, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, + 0x28, 0x09, 0x52, 0x18, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x46, 0x0a, 0x11, + 0x72, 0x65, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x79, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, + 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x52, 0x10, 0x72, 0x65, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x79, 0x49, 0x6e, 0x74, 0x65, + 0x72, 0x76, 0x61, 0x6c, 0x22, 0x51, 0x0a, 0x12, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x6d, 0x70, 0x74, 0x12, 0x23, 0x0a, 0x1f, 0x4e, 0x4f, + 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x4d, 0x50, + 0x54, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, + 0x0a, 0x0a, 0x06, 0x4f, 0x50, 0x45, 0x4e, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x43, + 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x10, 0x03, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, 0x73, 0x65, 0x72, 0x4c, + 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, + 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x61, 0x0a, 0x15, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, + 0x17, 0x0a, 0x13, 0x43, 0x4f, 0x4d, 0x42, 0x49, 0x4e, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, + 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x4e, 0x44, 0x10, + 0x01, 0x12, 0x06, 0x0a, 0x02, 0x4f, 0x52, 0x10, 0x02, 0x12, 0x1e, 0x0a, 0x1a, 0x41, 0x4e, 0x44, + 0x5f, 0x57, 0x49, 0x54, 0x48, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x49, 0x4e, 0x47, 0x5f, 0x52, + 0x45, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x10, 0x03, 0x22, 0x4a, 0x0a, 0x08, 0x53, 0x65, 0x76, + 0x65, 0x72, 0x69, 0x74, 0x79, 0x12, 0x18, 0x0a, 0x14, 0x53, 0x45, 0x56, 0x45, 0x52, 0x49, 0x54, + 0x59, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, + 0x0c, 0x0a, 0x08, 0x43, 0x52, 0x49, 0x54, 0x49, 0x43, 0x41, 0x4c, 0x10, 0x01, 0x12, 0x09, 0x0a, + 0x05, 0x45, 0x52, 0x52, 0x4f, 0x52, 0x10, 0x02, 0x12, 0x0b, 0x0a, 0x07, 0x57, 0x41, 0x52, 0x4e, + 0x49, 0x4e, 0x47, 0x10, 0x03, 0x3a, 0xc9, 0x01, 0xea, 0x41, 0xc5, 0x01, 0x0a, 0x25, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x12, 0x2f, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x7d, 0x12, 0x39, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x12, - 0x01, 0x2a, 0x42, 0xc5, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, - 0x0a, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, - 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, - 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, - 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, - 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, - 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, + 0x2d, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, + 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, + 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x12, 0x01, + 0x2a, 0x42, 0xc5, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x0a, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, + 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, + 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, + 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, + 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x33, } var ( @@ -2145,81 +2751,98 @@ func file_google_monitoring_v3_alert_proto_rawDescGZIP() []byte { return file_google_monitoring_v3_alert_proto_rawDescData } -var file_google_monitoring_v3_alert_proto_enumTypes = make([]protoimpl.EnumInfo, 3) -var file_google_monitoring_v3_alert_proto_msgTypes = make([]protoimpl.MessageInfo, 17) +var file_google_monitoring_v3_alert_proto_enumTypes = make([]protoimpl.EnumInfo, 4) +var file_google_monitoring_v3_alert_proto_msgTypes = make([]protoimpl.MessageInfo, 23) var file_google_monitoring_v3_alert_proto_goTypes = []any{ (AlertPolicy_ConditionCombinerType)(0), // 0: google.monitoring.v3.AlertPolicy.ConditionCombinerType (AlertPolicy_Severity)(0), // 1: google.monitoring.v3.AlertPolicy.Severity (AlertPolicy_Condition_EvaluationMissingData)(0), // 2: google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData - (*AlertPolicy)(nil), // 3: google.monitoring.v3.AlertPolicy - (*AlertPolicy_Documentation)(nil), // 4: google.monitoring.v3.AlertPolicy.Documentation - (*AlertPolicy_Condition)(nil), // 5: google.monitoring.v3.AlertPolicy.Condition - (*AlertPolicy_AlertStrategy)(nil), // 6: google.monitoring.v3.AlertPolicy.AlertStrategy - nil, // 7: google.monitoring.v3.AlertPolicy.UserLabelsEntry - (*AlertPolicy_Documentation_Link)(nil), // 8: google.monitoring.v3.AlertPolicy.Documentation.Link - (*AlertPolicy_Condition_Trigger)(nil), // 9: google.monitoring.v3.AlertPolicy.Condition.Trigger - (*AlertPolicy_Condition_MetricThreshold)(nil), // 10: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold - (*AlertPolicy_Condition_MetricAbsence)(nil), // 11: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence - (*AlertPolicy_Condition_LogMatch)(nil), // 12: google.monitoring.v3.AlertPolicy.Condition.LogMatch - (*AlertPolicy_Condition_MonitoringQueryLanguageCondition)(nil), // 13: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition - (*AlertPolicy_Condition_PrometheusQueryLanguageCondition)(nil), // 14: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition - (*AlertPolicy_Condition_MetricThreshold_ForecastOptions)(nil), // 15: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions - nil, // 16: google.monitoring.v3.AlertPolicy.Condition.LogMatch.LabelExtractorsEntry - nil, // 17: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.LabelsEntry - (*AlertPolicy_AlertStrategy_NotificationRateLimit)(nil), // 18: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit - (*AlertPolicy_AlertStrategy_NotificationChannelStrategy)(nil), // 19: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy - (*wrapperspb.BoolValue)(nil), // 20: google.protobuf.BoolValue - (*status.Status)(nil), // 21: google.rpc.Status - (*MutationRecord)(nil), // 22: google.monitoring.v3.MutationRecord - (*durationpb.Duration)(nil), // 23: google.protobuf.Duration - (*Aggregation)(nil), // 24: google.monitoring.v3.Aggregation - (ComparisonType)(0), // 25: google.monitoring.v3.ComparisonType + (AlertPolicy_AlertStrategy_NotificationPrompt)(0), // 3: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationPrompt + (*AlertPolicy)(nil), // 4: google.monitoring.v3.AlertPolicy + (*AlertPolicy_Documentation)(nil), // 5: google.monitoring.v3.AlertPolicy.Documentation + (*AlertPolicy_Condition)(nil), // 6: google.monitoring.v3.AlertPolicy.Condition + (*AlertPolicy_AlertStrategy)(nil), // 7: google.monitoring.v3.AlertPolicy.AlertStrategy + nil, // 8: google.monitoring.v3.AlertPolicy.UserLabelsEntry + (*AlertPolicy_Documentation_Link)(nil), // 9: google.monitoring.v3.AlertPolicy.Documentation.Link + (*AlertPolicy_Condition_Trigger)(nil), // 10: google.monitoring.v3.AlertPolicy.Condition.Trigger + (*AlertPolicy_Condition_MetricThreshold)(nil), // 11: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold + (*AlertPolicy_Condition_MetricAbsence)(nil), // 12: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence + (*AlertPolicy_Condition_LogMatch)(nil), // 13: google.monitoring.v3.AlertPolicy.Condition.LogMatch + (*AlertPolicy_Condition_MonitoringQueryLanguageCondition)(nil), // 14: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition + (*AlertPolicy_Condition_PrometheusQueryLanguageCondition)(nil), // 15: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition + (*AlertPolicy_Condition_SqlCondition)(nil), // 16: google.monitoring.v3.AlertPolicy.Condition.SqlCondition + (*AlertPolicy_Condition_MetricThreshold_ForecastOptions)(nil), // 17: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions + nil, // 18: google.monitoring.v3.AlertPolicy.Condition.LogMatch.LabelExtractorsEntry + nil, // 19: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.LabelsEntry + (*AlertPolicy_Condition_SqlCondition_Minutes)(nil), // 20: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Minutes + (*AlertPolicy_Condition_SqlCondition_Hourly)(nil), // 21: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Hourly + (*AlertPolicy_Condition_SqlCondition_Daily)(nil), // 22: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Daily + (*AlertPolicy_Condition_SqlCondition_RowCountTest)(nil), // 23: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.RowCountTest + (*AlertPolicy_Condition_SqlCondition_BooleanTest)(nil), // 24: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.BooleanTest + (*AlertPolicy_AlertStrategy_NotificationRateLimit)(nil), // 25: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit + (*AlertPolicy_AlertStrategy_NotificationChannelStrategy)(nil), // 26: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy + (*wrapperspb.BoolValue)(nil), // 27: google.protobuf.BoolValue + (*status.Status)(nil), // 28: google.rpc.Status + (*MutationRecord)(nil), // 29: google.monitoring.v3.MutationRecord + (*durationpb.Duration)(nil), // 30: google.protobuf.Duration + (*Aggregation)(nil), // 31: google.monitoring.v3.Aggregation + (ComparisonType)(0), // 32: google.monitoring.v3.ComparisonType + (*timeofday.TimeOfDay)(nil), // 33: google.type.TimeOfDay } var file_google_monitoring_v3_alert_proto_depIdxs = []int32{ - 4, // 0: google.monitoring.v3.AlertPolicy.documentation:type_name -> google.monitoring.v3.AlertPolicy.Documentation - 7, // 1: google.monitoring.v3.AlertPolicy.user_labels:type_name -> google.monitoring.v3.AlertPolicy.UserLabelsEntry - 5, // 2: google.monitoring.v3.AlertPolicy.conditions:type_name -> google.monitoring.v3.AlertPolicy.Condition + 5, // 0: google.monitoring.v3.AlertPolicy.documentation:type_name -> google.monitoring.v3.AlertPolicy.Documentation + 8, // 1: google.monitoring.v3.AlertPolicy.user_labels:type_name -> google.monitoring.v3.AlertPolicy.UserLabelsEntry + 6, // 2: google.monitoring.v3.AlertPolicy.conditions:type_name -> google.monitoring.v3.AlertPolicy.Condition 0, // 3: google.monitoring.v3.AlertPolicy.combiner:type_name -> google.monitoring.v3.AlertPolicy.ConditionCombinerType - 20, // 4: google.monitoring.v3.AlertPolicy.enabled:type_name -> google.protobuf.BoolValue - 21, // 5: google.monitoring.v3.AlertPolicy.validity:type_name -> google.rpc.Status - 22, // 6: google.monitoring.v3.AlertPolicy.creation_record:type_name -> google.monitoring.v3.MutationRecord - 22, // 7: google.monitoring.v3.AlertPolicy.mutation_record:type_name -> google.monitoring.v3.MutationRecord - 6, // 8: google.monitoring.v3.AlertPolicy.alert_strategy:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy + 27, // 4: google.monitoring.v3.AlertPolicy.enabled:type_name -> google.protobuf.BoolValue + 28, // 5: google.monitoring.v3.AlertPolicy.validity:type_name -> google.rpc.Status + 29, // 6: google.monitoring.v3.AlertPolicy.creation_record:type_name -> google.monitoring.v3.MutationRecord + 29, // 7: google.monitoring.v3.AlertPolicy.mutation_record:type_name -> google.monitoring.v3.MutationRecord + 7, // 8: google.monitoring.v3.AlertPolicy.alert_strategy:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy 1, // 9: google.monitoring.v3.AlertPolicy.severity:type_name -> google.monitoring.v3.AlertPolicy.Severity - 8, // 10: google.monitoring.v3.AlertPolicy.Documentation.links:type_name -> google.monitoring.v3.AlertPolicy.Documentation.Link - 10, // 11: google.monitoring.v3.AlertPolicy.Condition.condition_threshold:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricThreshold - 11, // 12: google.monitoring.v3.AlertPolicy.Condition.condition_absent:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricAbsence - 12, // 13: google.monitoring.v3.AlertPolicy.Condition.condition_matched_log:type_name -> google.monitoring.v3.AlertPolicy.Condition.LogMatch - 13, // 14: google.monitoring.v3.AlertPolicy.Condition.condition_monitoring_query_language:type_name -> google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition - 14, // 15: google.monitoring.v3.AlertPolicy.Condition.condition_prometheus_query_language:type_name -> google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition - 18, // 16: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_rate_limit:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit - 23, // 17: google.monitoring.v3.AlertPolicy.AlertStrategy.auto_close:type_name -> google.protobuf.Duration - 19, // 18: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_channel_strategy:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy - 24, // 19: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.aggregations:type_name -> google.monitoring.v3.Aggregation - 24, // 20: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.denominator_aggregations:type_name -> google.monitoring.v3.Aggregation - 15, // 21: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.forecast_options:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions - 25, // 22: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.comparison:type_name -> google.monitoring.v3.ComparisonType - 23, // 23: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.duration:type_name -> google.protobuf.Duration - 9, // 24: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger - 2, // 25: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.evaluation_missing_data:type_name -> google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData - 24, // 26: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.aggregations:type_name -> google.monitoring.v3.Aggregation - 23, // 27: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.duration:type_name -> google.protobuf.Duration - 9, // 28: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger - 16, // 29: google.monitoring.v3.AlertPolicy.Condition.LogMatch.label_extractors:type_name -> google.monitoring.v3.AlertPolicy.Condition.LogMatch.LabelExtractorsEntry - 23, // 30: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.duration:type_name -> google.protobuf.Duration - 9, // 31: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger - 2, // 32: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.evaluation_missing_data:type_name -> google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData - 23, // 33: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.duration:type_name -> google.protobuf.Duration - 23, // 34: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.evaluation_interval:type_name -> google.protobuf.Duration - 17, // 35: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.labels:type_name -> google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.LabelsEntry - 23, // 36: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions.forecast_horizon:type_name -> google.protobuf.Duration - 23, // 37: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit.period:type_name -> google.protobuf.Duration - 23, // 38: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy.renotify_interval:type_name -> google.protobuf.Duration - 39, // [39:39] is the sub-list for method output_type - 39, // [39:39] is the sub-list for method input_type - 39, // [39:39] is the sub-list for extension type_name - 39, // [39:39] is the sub-list for extension extendee - 0, // [0:39] is the sub-list for field type_name + 9, // 10: google.monitoring.v3.AlertPolicy.Documentation.links:type_name -> google.monitoring.v3.AlertPolicy.Documentation.Link + 11, // 11: google.monitoring.v3.AlertPolicy.Condition.condition_threshold:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricThreshold + 12, // 12: google.monitoring.v3.AlertPolicy.Condition.condition_absent:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricAbsence + 13, // 13: google.monitoring.v3.AlertPolicy.Condition.condition_matched_log:type_name -> google.monitoring.v3.AlertPolicy.Condition.LogMatch + 14, // 14: google.monitoring.v3.AlertPolicy.Condition.condition_monitoring_query_language:type_name -> google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition + 15, // 15: google.monitoring.v3.AlertPolicy.Condition.condition_prometheus_query_language:type_name -> google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition + 16, // 16: google.monitoring.v3.AlertPolicy.Condition.condition_sql:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition + 25, // 17: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_rate_limit:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit + 3, // 18: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_prompts:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationPrompt + 30, // 19: google.monitoring.v3.AlertPolicy.AlertStrategy.auto_close:type_name -> google.protobuf.Duration + 26, // 20: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_channel_strategy:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy + 31, // 21: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.aggregations:type_name -> google.monitoring.v3.Aggregation + 31, // 22: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.denominator_aggregations:type_name -> google.monitoring.v3.Aggregation + 17, // 23: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.forecast_options:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions + 32, // 24: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.comparison:type_name -> google.monitoring.v3.ComparisonType + 30, // 25: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.duration:type_name -> google.protobuf.Duration + 10, // 26: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger + 2, // 27: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.evaluation_missing_data:type_name -> google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData + 31, // 28: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.aggregations:type_name -> google.monitoring.v3.Aggregation + 30, // 29: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.duration:type_name -> google.protobuf.Duration + 10, // 30: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger + 18, // 31: google.monitoring.v3.AlertPolicy.Condition.LogMatch.label_extractors:type_name -> google.monitoring.v3.AlertPolicy.Condition.LogMatch.LabelExtractorsEntry + 30, // 32: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.duration:type_name -> google.protobuf.Duration + 10, // 33: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger + 2, // 34: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.evaluation_missing_data:type_name -> google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData + 30, // 35: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.duration:type_name -> google.protobuf.Duration + 30, // 36: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.evaluation_interval:type_name -> google.protobuf.Duration + 19, // 37: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.labels:type_name -> google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.LabelsEntry + 20, // 38: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.minutes:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Minutes + 21, // 39: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.hourly:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Hourly + 22, // 40: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.daily:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Daily + 23, // 41: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.row_count_test:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.RowCountTest + 24, // 42: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.boolean_test:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.BooleanTest + 30, // 43: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions.forecast_horizon:type_name -> google.protobuf.Duration + 33, // 44: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Daily.execution_time:type_name -> google.type.TimeOfDay + 32, // 45: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.RowCountTest.comparison:type_name -> google.monitoring.v3.ComparisonType + 30, // 46: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit.period:type_name -> google.protobuf.Duration + 30, // 47: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy.renotify_interval:type_name -> google.protobuf.Duration + 48, // [48:48] is the sub-list for method output_type + 48, // [48:48] is the sub-list for method input_type + 48, // [48:48] is the sub-list for extension type_name + 48, // [48:48] is the sub-list for extension extendee + 0, // [0:48] is the sub-list for field type_name } func init() { file_google_monitoring_v3_alert_proto_init() } @@ -2229,194 +2852,33 @@ func file_google_monitoring_v3_alert_proto_init() { } file_google_monitoring_v3_common_proto_init() file_google_monitoring_v3_mutation_record_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_alert_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Documentation); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_AlertStrategy); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Documentation_Link); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_Trigger); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_MetricThreshold); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_MetricAbsence); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_LogMatch); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_MonitoringQueryLanguageCondition); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_PrometheusQueryLanguageCondition); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_MetricThreshold_ForecastOptions); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[15].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_AlertStrategy_NotificationRateLimit); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[16].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_AlertStrategy_NotificationChannelStrategy); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_alert_proto_msgTypes[2].OneofWrappers = []any{ (*AlertPolicy_Condition_ConditionThreshold)(nil), (*AlertPolicy_Condition_ConditionAbsent)(nil), (*AlertPolicy_Condition_ConditionMatchedLog)(nil), (*AlertPolicy_Condition_ConditionMonitoringQueryLanguage)(nil), (*AlertPolicy_Condition_ConditionPrometheusQueryLanguage)(nil), + (*AlertPolicy_Condition_ConditionSql)(nil), } file_google_monitoring_v3_alert_proto_msgTypes[6].OneofWrappers = []any{ (*AlertPolicy_Condition_Trigger_Count)(nil), (*AlertPolicy_Condition_Trigger_Percent)(nil), } + file_google_monitoring_v3_alert_proto_msgTypes[12].OneofWrappers = []any{ + (*AlertPolicy_Condition_SqlCondition_Minutes_)(nil), + (*AlertPolicy_Condition_SqlCondition_Hourly_)(nil), + (*AlertPolicy_Condition_SqlCondition_Daily_)(nil), + (*AlertPolicy_Condition_SqlCondition_RowCountTest_)(nil), + (*AlertPolicy_Condition_SqlCondition_BooleanTest_)(nil), + } + file_google_monitoring_v3_alert_proto_msgTypes[17].OneofWrappers = []any{} type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_monitoring_v3_alert_proto_rawDesc, - NumEnums: 3, - NumMessages: 17, + NumEnums: 4, + NumMessages: 23, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert_service.pb.go index f0e149d16b64a..02103f8cd4912 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/alert_service.proto @@ -70,11 +70,9 @@ type CreateAlertPolicyRequest struct { func (x *CreateAlertPolicyRequest) Reset() { *x = CreateAlertPolicyRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateAlertPolicyRequest) String() string { @@ -85,7 +83,7 @@ func (*CreateAlertPolicyRequest) ProtoMessage() {} func (x *CreateAlertPolicyRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -128,11 +126,9 @@ type GetAlertPolicyRequest struct { func (x *GetAlertPolicyRequest) Reset() { *x = GetAlertPolicyRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetAlertPolicyRequest) String() string { @@ -143,7 +139,7 @@ func (*GetAlertPolicyRequest) ProtoMessage() {} func (x *GetAlertPolicyRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -183,34 +179,33 @@ type ListAlertPoliciesRequest struct { // [GetAlertPolicy][google.monitoring.v3.AlertPolicyService.GetAlertPolicy] // operation, instead. Name string `protobuf:"bytes,4,opt,name=name,proto3" json:"name,omitempty"` - // If provided, this field specifies the criteria that must be met by - // alert policies to be included in the response. + // Optional. If provided, this field specifies the criteria that must be met + // by alert policies to be included in the response. // // For more details, see [sorting and // filtering](https://cloud.google.com/monitoring/api/v3/sorting-and-filtering). Filter string `protobuf:"bytes,5,opt,name=filter,proto3" json:"filter,omitempty"` - // A comma-separated list of fields by which to sort the result. Supports - // the same set of field references as the `filter` field. Entries can be - // prefixed with a minus sign to sort by the field in descending order. + // Optional. A comma-separated list of fields by which to sort the result. + // Supports the same set of field references as the `filter` field. Entries + // can be prefixed with a minus sign to sort by the field in descending order. // // For more details, see [sorting and // filtering](https://cloud.google.com/monitoring/api/v3/sorting-and-filtering). OrderBy string `protobuf:"bytes,6,opt,name=order_by,json=orderBy,proto3" json:"order_by,omitempty"` - // The maximum number of results to return in a single response. + // Optional. The maximum number of results to return in a single response. PageSize int32 `protobuf:"varint,2,opt,name=page_size,json=pageSize,proto3" json:"page_size,omitempty"` - // If this field is not empty then it must contain the `nextPageToken` value - // returned by a previous call to this method. Using this field causes the - // method to return more results from the previous method call. + // Optional. If this field is not empty then it must contain the + // `nextPageToken` value returned by a previous call to this method. Using + // this field causes the method to return more results from the previous + // method call. PageToken string `protobuf:"bytes,3,opt,name=page_token,json=pageToken,proto3" json:"page_token,omitempty"` } func (x *ListAlertPoliciesRequest) Reset() { *x = ListAlertPoliciesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListAlertPoliciesRequest) String() string { @@ -221,7 +216,7 @@ func (*ListAlertPoliciesRequest) ProtoMessage() {} func (x *ListAlertPoliciesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -290,11 +285,9 @@ type ListAlertPoliciesResponse struct { func (x *ListAlertPoliciesResponse) Reset() { *x = ListAlertPoliciesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListAlertPoliciesResponse) String() string { @@ -305,7 +298,7 @@ func (*ListAlertPoliciesResponse) ProtoMessage() {} func (x *ListAlertPoliciesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -378,11 +371,9 @@ type UpdateAlertPolicyRequest struct { func (x *UpdateAlertPolicyRequest) Reset() { *x = UpdateAlertPolicyRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateAlertPolicyRequest) String() string { @@ -393,7 +384,7 @@ func (*UpdateAlertPolicyRequest) ProtoMessage() {} func (x *UpdateAlertPolicyRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -438,11 +429,9 @@ type DeleteAlertPolicyRequest struct { func (x *DeleteAlertPolicyRequest) Reset() { *x = DeleteAlertPolicyRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteAlertPolicyRequest) String() string { @@ -453,7 +442,7 @@ func (*DeleteAlertPolicyRequest) ProtoMessage() {} func (x *DeleteAlertPolicyRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -511,127 +500,128 @@ var file_google_monitoring_v3_alert_service_proto_rawDesc = []byte{ 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x2d, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x27, 0x0a, 0x25, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xcc, 0x01, 0x0a, 0x18, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xe0, 0x01, 0x0a, 0x18, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x42, 0x2d, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x27, 0x12, 0x25, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x66, - 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x66, 0x69, 0x6c, - 0x74, 0x65, 0x72, 0x12, 0x19, 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x5f, 0x62, 0x79, 0x18, - 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, 0x79, 0x12, 0x1b, - 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, - 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xac, 0x01, 0x0a, 0x19, 0x4c, - 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, - 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x48, 0x0a, 0x0e, 0x61, 0x6c, 0x65, 0x72, - 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x52, 0x0d, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, - 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, - 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, - 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1d, 0x0a, 0x0a, 0x74, 0x6f, - 0x74, 0x61, 0x6c, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x09, - 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x53, 0x69, 0x7a, 0x65, 0x22, 0xa2, 0x01, 0x0a, 0x18, 0x55, 0x70, - 0x64, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3b, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, - 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, - 0x61, 0x73, 0x6b, 0x12, 0x49, 0x0a, 0x0c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x03, 0xe0, 0x41, - 0x02, 0x52, 0x0b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x5d, - 0x0a, 0x18, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x2d, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x27, - 0x0a, 0x25, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, - 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x32, 0x9e, 0x08, - 0x0a, 0x12, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x53, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x12, 0xa8, 0x01, 0x0a, 0x11, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, - 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x32, 0xda, 0x41, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x25, 0x12, 0x23, 0x2f, 0x76, 0x33, 0x2f, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x1e, 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, + 0x72, 0x5f, 0x62, 0x79, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, + 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, 0x79, 0x12, 0x20, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, + 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x22, 0x0a, 0x0a, 0x70, 0x61, + 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, + 0xe0, 0x41, 0x01, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xac, + 0x01, 0x0a, 0x19, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x48, 0x0a, 0x0e, + 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x18, 0x03, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x0d, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, + 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1d, + 0x0a, 0x0a, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, + 0x28, 0x05, 0x52, 0x09, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x53, 0x69, 0x7a, 0x65, 0x22, 0xa7, 0x01, + 0x0a, 0x18, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, + 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, 0x61, 0x73, 0x6b, 0x12, 0x49, 0x0a, 0x0c, + 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x03, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x61, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x5d, 0x0a, 0x18, 0x44, 0x65, 0x6c, 0x65, 0x74, + 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x2d, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x27, 0x0a, 0x25, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, + 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x32, 0x9e, 0x08, 0x0a, 0x12, 0x41, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0xa8, 0x01, + 0x0a, 0x11, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, + 0x69, 0x65, 0x73, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x41, + 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x1a, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x41, + 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, + 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x32, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, + 0x93, 0x02, 0x25, 0x12, 0x23, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, 0x96, 0x01, 0x0a, 0x0e, 0x47, 0x65, 0x74, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2b, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, + 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x34, 0xda, 0x41, 0x04, + 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x27, 0x12, 0x25, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, - 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, - 0x96, 0x01, 0x0a, 0x0e, 0x47, 0x65, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x12, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x41, 0x6c, 0x65, + 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x2a, + 0x7d, 0x12, 0xb5, 0x01, 0x0a, 0x11, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, + 0x72, 0x65, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, + 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x4d, 0xda, 0x41, 0x11, 0x6e, + 0x61, 0x6d, 0x65, 0x2c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x33, 0x3a, 0x0c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x22, 0x23, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, 0x91, 0x01, 0x0a, 0x11, 0x44, 0x65, + 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, + 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, - 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x22, 0x34, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, - 0x27, 0x12, 0x25, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, - 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xb5, 0x01, 0x0a, 0x11, 0x43, 0x72, 0x65, - 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2e, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, - 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x21, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x22, 0x4d, 0xda, 0x41, 0x11, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x61, 0x6c, 0x65, 0x72, 0x74, - 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x33, 0x3a, 0x0c, 0x61, - 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x23, 0x2f, 0x76, 0x33, - 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, - 0x2a, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, - 0x12, 0x91, 0x01, 0x0a, 0x11, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, - 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x34, - 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x27, 0x2a, 0x25, 0x2f, - 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x73, 0x2f, 0x2a, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, - 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xcb, 0x01, 0x0a, 0x11, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x41, - 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x21, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x63, 0xda, - 0x41, 0x18, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2c, 0x61, 0x6c, - 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x42, - 0x3a, 0x0c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x32, 0x32, - 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, - 0x2a, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, - 0x2a, 0x7d, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, - 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, - 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, - 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, - 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x42, 0xcc, - 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x11, 0x41, 0x6c, 0x65, - 0x72, 0x74, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, - 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, - 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, - 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, - 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, - 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, - 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x34, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x27, 0x2a, 0x25, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, + 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x61, 0x6c, 0x65, + 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xcb, 0x01, + 0x0a, 0x11, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, + 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x1a, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x63, 0xda, 0x41, 0x18, 0x75, 0x70, 0x64, 0x61, 0x74, + 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x42, 0x3a, 0x0c, 0x61, 0x6c, 0x65, 0x72, 0x74, + 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x32, 0x32, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x61, 0x6c, + 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x3d, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x2a, 0x7d, 0x1a, 0xa9, 0x01, 0xca, 0x41, + 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, + 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, + 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, + 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, + 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x42, 0xcc, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x42, 0x11, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, + 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, + 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -686,80 +676,6 @@ func file_google_monitoring_v3_alert_service_proto_init() { return } file_google_monitoring_v3_alert_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_alert_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*CreateAlertPolicyRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*GetAlertPolicyRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*ListAlertPoliciesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*ListAlertPoliciesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateAlertPolicyRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*DeleteAlertPolicyRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/common.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/common.pb.go index c9aa5a02472a1..e301262a2fa7f 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/common.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/common.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/common.proto @@ -558,11 +558,9 @@ type TypedValue struct { func (x *TypedValue) Reset() { *x = TypedValue{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_common_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_common_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TypedValue) String() string { @@ -573,7 +571,7 @@ func (*TypedValue) ProtoMessage() {} func (x *TypedValue) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_common_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -724,11 +722,9 @@ type TimeInterval struct { func (x *TimeInterval) Reset() { *x = TimeInterval{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_common_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_common_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeInterval) String() string { @@ -739,7 +735,7 @@ func (*TimeInterval) ProtoMessage() {} func (x *TimeInterval) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_common_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -864,11 +860,9 @@ type Aggregation struct { func (x *Aggregation) Reset() { *x = Aggregation{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_common_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_common_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Aggregation) String() string { @@ -879,7 +873,7 @@ func (*Aggregation) ProtoMessage() {} func (x *Aggregation) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_common_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1098,44 +1092,6 @@ func file_google_monitoring_v3_common_proto_init() { if File_google_monitoring_v3_common_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_common_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*TypedValue); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_common_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*TimeInterval); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_common_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*Aggregation); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_common_proto_msgTypes[0].OneofWrappers = []any{ (*TypedValue_BoolValue)(nil), (*TypedValue_Int64Value)(nil), diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/dropped_labels.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/dropped_labels.pb.go index 7b1dc962da8ad..0dbf58e435163 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/dropped_labels.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/dropped_labels.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/dropped_labels.proto @@ -62,11 +62,9 @@ type DroppedLabels struct { func (x *DroppedLabels) Reset() { *x = DroppedLabels{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_dropped_labels_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_dropped_labels_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DroppedLabels) String() string { @@ -77,7 +75,7 @@ func (*DroppedLabels) ProtoMessage() {} func (x *DroppedLabels) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_dropped_labels_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -162,20 +160,6 @@ func file_google_monitoring_v3_dropped_labels_proto_init() { if File_google_monitoring_v3_dropped_labels_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_dropped_labels_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*DroppedLabels); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group.pb.go index dff27f9d8ce2d..11d1a62d35b94 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/group.proto @@ -93,11 +93,9 @@ type Group struct { func (x *Group) Reset() { *x = Group{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Group) String() string { @@ -108,7 +106,7 @@ func (*Group) ProtoMessage() {} func (x *Group) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -230,20 +228,6 @@ func file_google_monitoring_v3_group_proto_init() { if File_google_monitoring_v3_group_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_group_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*Group); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group_service.pb.go index 46747d9064388..3cfa112bb450c 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/group_service.proto @@ -74,11 +74,9 @@ type ListGroupsRequest struct { func (x *ListGroupsRequest) Reset() { *x = ListGroupsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListGroupsRequest) String() string { @@ -89,7 +87,7 @@ func (*ListGroupsRequest) ProtoMessage() {} func (x *ListGroupsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -212,11 +210,9 @@ type ListGroupsResponse struct { func (x *ListGroupsResponse) Reset() { *x = ListGroupsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListGroupsResponse) String() string { @@ -227,7 +223,7 @@ func (*ListGroupsResponse) ProtoMessage() {} func (x *ListGroupsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -270,11 +266,9 @@ type GetGroupRequest struct { func (x *GetGroupRequest) Reset() { *x = GetGroupRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetGroupRequest) String() string { @@ -285,7 +279,7 @@ func (*GetGroupRequest) ProtoMessage() {} func (x *GetGroupRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -328,11 +322,9 @@ type CreateGroupRequest struct { func (x *CreateGroupRequest) Reset() { *x = CreateGroupRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateGroupRequest) String() string { @@ -343,7 +335,7 @@ func (*CreateGroupRequest) ProtoMessage() {} func (x *CreateGroupRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -395,11 +387,9 @@ type UpdateGroupRequest struct { func (x *UpdateGroupRequest) Reset() { *x = UpdateGroupRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateGroupRequest) String() string { @@ -410,7 +400,7 @@ func (*UpdateGroupRequest) ProtoMessage() {} func (x *UpdateGroupRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -458,11 +448,9 @@ type DeleteGroupRequest struct { func (x *DeleteGroupRequest) Reset() { *x = DeleteGroupRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteGroupRequest) String() string { @@ -473,7 +461,7 @@ func (*DeleteGroupRequest) ProtoMessage() {} func (x *DeleteGroupRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -536,11 +524,9 @@ type ListGroupMembersRequest struct { func (x *ListGroupMembersRequest) Reset() { *x = ListGroupMembersRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListGroupMembersRequest) String() string { @@ -551,7 +537,7 @@ func (*ListGroupMembersRequest) ProtoMessage() {} func (x *ListGroupMembersRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -619,11 +605,9 @@ type ListGroupMembersResponse struct { func (x *ListGroupMembersResponse) Reset() { *x = ListGroupMembersResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListGroupMembersResponse) String() string { @@ -634,7 +618,7 @@ func (*ListGroupMembersResponse) ProtoMessage() {} func (x *ListGroupMembersResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -921,104 +905,6 @@ func file_google_monitoring_v3_group_service_proto_init() { } file_google_monitoring_v3_common_proto_init() file_google_monitoring_v3_group_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_group_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*ListGroupsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListGroupsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*GetGroupRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*CreateGroupRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateGroupRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*DeleteGroupRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*ListGroupMembersRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*ListGroupMembersResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_group_service_proto_msgTypes[0].OneofWrappers = []any{ (*ListGroupsRequest_ChildrenOfGroup)(nil), (*ListGroupsRequest_AncestorsOfGroup)(nil), diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric.pb.go index b22c22d07e551..1961a1e3a5c6f 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/metric.proto @@ -60,11 +60,9 @@ type Point struct { func (x *Point) Reset() { *x = Point{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Point) String() string { @@ -75,7 +73,7 @@ func (*Point) ProtoMessage() {} func (x *Point) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -153,17 +151,21 @@ type TimeSeries struct { Points []*Point `protobuf:"bytes,5,rep,name=points,proto3" json:"points,omitempty"` // The units in which the metric value is reported. It is only applicable // if the `value_type` is `INT64`, `DOUBLE`, or `DISTRIBUTION`. The `unit` - // defines the representation of the stored metric values. + // defines the representation of the stored metric values. This field can only + // be changed through CreateTimeSeries when it is empty. Unit string `protobuf:"bytes,8,opt,name=unit,proto3" json:"unit,omitempty"` + // Input only. A detailed description of the time series that will be + // associated with the + // [google.api.MetricDescriptor][google.api.MetricDescriptor] for the metric. + // Once set, this field cannot be changed through CreateTimeSeries. + Description string `protobuf:"bytes,9,opt,name=description,proto3" json:"description,omitempty"` } func (x *TimeSeries) Reset() { *x = TimeSeries{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeries) String() string { @@ -174,7 +176,7 @@ func (*TimeSeries) ProtoMessage() {} func (x *TimeSeries) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -238,6 +240,13 @@ func (x *TimeSeries) GetUnit() string { return "" } +func (x *TimeSeries) GetDescription() string { + if x != nil { + return x.Description + } + return "" +} + // A descriptor for the labels and points in a time series. type TimeSeriesDescriptor struct { state protoimpl.MessageState @@ -252,11 +261,9 @@ type TimeSeriesDescriptor struct { func (x *TimeSeriesDescriptor) Reset() { *x = TimeSeriesDescriptor{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesDescriptor) String() string { @@ -267,7 +274,7 @@ func (*TimeSeriesDescriptor) ProtoMessage() {} func (x *TimeSeriesDescriptor) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -314,11 +321,9 @@ type TimeSeriesData struct { func (x *TimeSeriesData) Reset() { *x = TimeSeriesData{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesData) String() string { @@ -329,7 +334,7 @@ func (*TimeSeriesData) ProtoMessage() {} func (x *TimeSeriesData) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -376,11 +381,9 @@ type LabelValue struct { func (x *LabelValue) Reset() { *x = LabelValue{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *LabelValue) String() string { @@ -391,7 +394,7 @@ func (*LabelValue) ProtoMessage() {} func (x *LabelValue) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -474,11 +477,9 @@ type QueryError struct { func (x *QueryError) Reset() { *x = QueryError{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *QueryError) String() string { @@ -489,7 +490,7 @@ func (*QueryError) ProtoMessage() {} func (x *QueryError) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -571,11 +572,9 @@ type TextLocator struct { func (x *TextLocator) Reset() { *x = TextLocator{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TextLocator) String() string { @@ -586,7 +585,7 @@ func (*TextLocator) ProtoMessage() {} func (x *TextLocator) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -657,11 +656,9 @@ type TimeSeriesDescriptor_ValueDescriptor struct { func (x *TimeSeriesDescriptor_ValueDescriptor) Reset() { *x = TimeSeriesDescriptor_ValueDescriptor{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesDescriptor_ValueDescriptor) String() string { @@ -672,7 +669,7 @@ func (*TimeSeriesDescriptor_ValueDescriptor) ProtoMessage() {} func (x *TimeSeriesDescriptor_ValueDescriptor) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -731,11 +728,9 @@ type TimeSeriesData_PointData struct { func (x *TimeSeriesData_PointData) Reset() { *x = TimeSeriesData_PointData{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesData_PointData) String() string { @@ -746,7 +741,7 @@ func (*TimeSeriesData_PointData) ProtoMessage() {} func (x *TimeSeriesData_PointData) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -790,11 +785,9 @@ type TextLocator_Position struct { func (x *TextLocator_Position) Reset() { *x = TextLocator_Position{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TextLocator_Position) String() string { @@ -805,7 +798,7 @@ func (*TextLocator_Position) ProtoMessage() {} func (x *TextLocator_Position) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -856,7 +849,7 @@ var file_google_monitoring_v3_metric_proto_rawDesc = []byte{ 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x22, 0x90, 0x03, 0x0a, 0x0a, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, + 0x6c, 0x75, 0x65, 0x22, 0xb2, 0x03, 0x0a, 0x0a, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2a, 0x0a, 0x06, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x52, 0x06, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x12, 0x39, @@ -881,102 +874,104 @@ var file_google_monitoring_v3_metric_proto_rawDesc = []byte{ 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x52, 0x06, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x73, 0x12, 0x12, 0x0a, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x22, 0x94, 0x03, 0x0a, 0x14, 0x54, 0x69, 0x6d, 0x65, 0x53, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, - 0x48, 0x0a, 0x11, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x10, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x67, 0x0a, 0x11, 0x70, 0x6f, 0x69, - 0x6e, 0x74, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x05, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, - 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x2e, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x52, 0x10, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x73, 0x1a, 0xc8, 0x01, 0x0a, 0x0f, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x45, 0x0a, 0x0a, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x26, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x54, 0x79, 0x70, 0x65, 0x52, 0x09, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, - 0x48, 0x0a, 0x0b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x6b, 0x69, 0x6e, 0x64, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, - 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x52, 0x0a, 0x6d, - 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x12, 0x12, 0x0a, 0x04, 0x75, 0x6e, 0x69, - 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x22, 0xb5, 0x02, - 0x0a, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, - 0x12, 0x43, 0x0a, 0x0c, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, - 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x61, - 0x62, 0x65, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x4d, 0x0a, 0x0a, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x64, - 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x2e, - 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x61, 0x74, 0x61, 0x52, 0x09, 0x70, 0x6f, 0x69, 0x6e, 0x74, - 0x44, 0x61, 0x74, 0x61, 0x1a, 0x8e, 0x01, 0x0a, 0x09, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x61, - 0x74, 0x61, 0x12, 0x38, 0x0a, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x52, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x47, 0x0a, 0x0d, - 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x49, - 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x52, 0x0c, 0x74, 0x69, 0x6d, 0x65, 0x49, 0x6e, 0x74, - 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0x7e, 0x0a, 0x0a, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x62, 0x6f, 0x6f, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x09, 0x62, 0x6f, 0x6f, 0x6c, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0b, 0x69, 0x6e, 0x74, 0x36, 0x34, 0x5f, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x0a, 0x69, 0x6e, 0x74, - 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, - 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, - 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0x0a, 0x05, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x63, 0x0a, 0x0a, 0x51, 0x75, 0x65, 0x72, 0x79, 0x45, 0x72, - 0x72, 0x6f, 0x72, 0x12, 0x3b, 0x0a, 0x07, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, - 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x52, 0x07, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, - 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0xf0, 0x02, 0x0a, 0x0b, 0x54, - 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x12, 0x16, 0x0a, 0x06, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x12, 0x51, 0x0a, 0x0e, 0x73, 0x74, 0x61, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x73, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x2e, 0x50, 0x6f, - 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x73, 0x74, 0x61, 0x72, 0x74, 0x50, 0x6f, 0x73, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x0c, 0x65, 0x6e, 0x64, 0x5f, 0x70, 0x6f, 0x73, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, + 0x52, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x94, 0x03, 0x0a, 0x14, 0x54, 0x69, 0x6d, + 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x12, 0x48, 0x0a, 0x11, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x44, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x10, 0x6c, 0x61, 0x62, 0x65, 0x6c, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x67, 0x0a, 0x11, 0x70, + 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, + 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x2e, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x52, 0x10, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x1a, 0xc8, 0x01, 0x0a, 0x0f, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x45, 0x0a, 0x0a, 0x76, 0x61, + 0x6c, 0x75, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x26, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x56, 0x61, 0x6c, + 0x75, 0x65, 0x54, 0x79, 0x70, 0x65, 0x52, 0x09, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x54, 0x79, 0x70, + 0x65, 0x12, 0x48, 0x0a, 0x0b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x6b, 0x69, 0x6e, 0x64, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x52, + 0x0a, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x12, 0x12, 0x0a, 0x04, 0x75, + 0x6e, 0x69, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x22, + 0xb5, 0x02, 0x0a, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, + 0x74, 0x61, 0x12, 0x43, 0x0a, 0x0c, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x62, 0x65, + 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x4d, 0x0a, 0x0a, 0x70, 0x6f, 0x69, 0x6e, 0x74, + 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x2e, 0x50, - 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x65, 0x6e, 0x64, 0x50, 0x6f, 0x73, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x48, 0x0a, 0x0e, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x6c, - 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, + 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, + 0x61, 0x2e, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x61, 0x74, 0x61, 0x52, 0x09, 0x70, 0x6f, 0x69, + 0x6e, 0x74, 0x44, 0x61, 0x74, 0x61, 0x1a, 0x8e, 0x01, 0x0a, 0x09, 0x50, 0x6f, 0x69, 0x6e, 0x74, + 0x44, 0x61, 0x74, 0x61, 0x12, 0x38, 0x0a, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x18, 0x01, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, + 0x64, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x47, + 0x0a, 0x0d, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, + 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x52, 0x0c, 0x74, 0x69, 0x6d, 0x65, 0x49, + 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0x7e, 0x0a, 0x0a, 0x4c, 0x61, 0x62, 0x65, 0x6c, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x62, 0x6f, 0x6f, 0x6c, 0x5f, 0x76, 0x61, + 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x09, 0x62, 0x6f, 0x6f, + 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0b, 0x69, 0x6e, 0x74, 0x36, 0x34, 0x5f, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x0a, 0x69, + 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x72, + 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, + 0x00, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, + 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x63, 0x0a, 0x0a, 0x51, 0x75, 0x65, 0x72, 0x79, + 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x3b, 0x0a, 0x07, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, + 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x52, 0x07, 0x6c, 0x6f, 0x63, 0x61, 0x74, + 0x6f, 0x72, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0xf0, 0x02, 0x0a, + 0x0b, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x12, 0x16, 0x0a, 0x06, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x12, 0x51, 0x0a, 0x0e, 0x73, 0x74, 0x61, 0x72, 0x74, 0x5f, 0x70, 0x6f, + 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x52, - 0x0d, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x12, 0x25, - 0x0a, 0x0e, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, - 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x52, - 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x1a, 0x36, 0x0a, 0x08, 0x50, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6c, 0x69, 0x6e, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, - 0x04, 0x6c, 0x69, 0x6e, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x42, 0xc6, 0x01, - 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x0b, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, - 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, - 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x2e, + 0x50, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x73, 0x74, 0x61, 0x72, 0x74, 0x50, + 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x0c, 0x65, 0x6e, 0x64, 0x5f, 0x70, + 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, + 0x2e, 0x50, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x65, 0x6e, 0x64, 0x50, 0x6f, + 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x48, 0x0a, 0x0e, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, + 0x5f, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, + 0x72, 0x52, 0x0d, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, + 0x12, 0x25, 0x0a, 0x0e, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x72, 0x65, 0x61, 0x73, + 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6e, + 0x67, 0x52, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x1a, 0x36, 0x0a, 0x08, 0x50, 0x6f, 0x73, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6c, 0x69, 0x6e, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x05, 0x52, 0x04, 0x6c, 0x69, 0x6e, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, + 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x42, + 0xc6, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x0b, 0x4d, 0x65, + 0x74, 0x72, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, + 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, + 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, + 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, + 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, + 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1046,128 +1041,6 @@ func file_google_monitoring_v3_metric_proto_init() { return } file_google_monitoring_v3_common_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_metric_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*Point); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeries); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesDescriptor); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesData); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*LabelValue); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*QueryError); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*TextLocator); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesDescriptor_ValueDescriptor); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesData_PointData); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*TextLocator_Position); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_metric_proto_msgTypes[4].OneofWrappers = []any{ (*LabelValue_BoolValue)(nil), (*LabelValue_Int64Value)(nil), diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric_service.pb.go index 52e1c1e0b9baf..6a83fea93de16 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/metric_service.proto @@ -124,11 +124,9 @@ type ListMonitoredResourceDescriptorsRequest struct { func (x *ListMonitoredResourceDescriptorsRequest) Reset() { *x = ListMonitoredResourceDescriptorsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListMonitoredResourceDescriptorsRequest) String() string { @@ -139,7 +137,7 @@ func (*ListMonitoredResourceDescriptorsRequest) ProtoMessage() {} func (x *ListMonitoredResourceDescriptorsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -199,11 +197,9 @@ type ListMonitoredResourceDescriptorsResponse struct { func (x *ListMonitoredResourceDescriptorsResponse) Reset() { *x = ListMonitoredResourceDescriptorsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListMonitoredResourceDescriptorsResponse) String() string { @@ -214,7 +210,7 @@ func (*ListMonitoredResourceDescriptorsResponse) ProtoMessage() {} func (x *ListMonitoredResourceDescriptorsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -260,11 +256,9 @@ type GetMonitoredResourceDescriptorRequest struct { func (x *GetMonitoredResourceDescriptorRequest) Reset() { *x = GetMonitoredResourceDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetMonitoredResourceDescriptorRequest) String() string { @@ -275,7 +269,7 @@ func (*GetMonitoredResourceDescriptorRequest) ProtoMessage() {} func (x *GetMonitoredResourceDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -309,7 +303,7 @@ type ListMetricDescriptorsRequest struct { // // projects/[PROJECT_ID_OR_NUMBER] Name string `protobuf:"bytes,5,opt,name=name,proto3" json:"name,omitempty"` - // If this field is empty, all custom and + // Optional. If this field is empty, all custom and // system-defined metric descriptors are returned. // Otherwise, the [filter](https://cloud.google.com/monitoring/api/v3/filters) // specifies which metric descriptors are to be @@ -318,23 +312,22 @@ type ListMetricDescriptorsRequest struct { // // metric.type = starts_with("custom.googleapis.com/") Filter string `protobuf:"bytes,2,opt,name=filter,proto3" json:"filter,omitempty"` - // A positive number that is the maximum number of results to return. The - // default and maximum value is 10,000. If a page_size <= 0 or > 10,000 is - // submitted, will instead return a maximum of 10,000 results. + // Optional. A positive number that is the maximum number of results to + // return. The default and maximum value is 10,000. If a page_size <= 0 or > + // 10,000 is submitted, will instead return a maximum of 10,000 results. PageSize int32 `protobuf:"varint,3,opt,name=page_size,json=pageSize,proto3" json:"page_size,omitempty"` - // If this field is not empty then it must contain the `nextPageToken` value - // returned by a previous call to this method. Using this field causes the - // method to return additional results from the previous method call. + // Optional. If this field is not empty then it must contain the + // `nextPageToken` value returned by a previous call to this method. Using + // this field causes the method to return additional results from the previous + // method call. PageToken string `protobuf:"bytes,4,opt,name=page_token,json=pageToken,proto3" json:"page_token,omitempty"` } func (x *ListMetricDescriptorsRequest) Reset() { *x = ListMetricDescriptorsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListMetricDescriptorsRequest) String() string { @@ -345,7 +338,7 @@ func (*ListMetricDescriptorsRequest) ProtoMessage() {} func (x *ListMetricDescriptorsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -405,11 +398,9 @@ type ListMetricDescriptorsResponse struct { func (x *ListMetricDescriptorsResponse) Reset() { *x = ListMetricDescriptorsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListMetricDescriptorsResponse) String() string { @@ -420,7 +411,7 @@ func (*ListMetricDescriptorsResponse) ProtoMessage() {} func (x *ListMetricDescriptorsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -467,11 +458,9 @@ type GetMetricDescriptorRequest struct { func (x *GetMetricDescriptorRequest) Reset() { *x = GetMetricDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetMetricDescriptorRequest) String() string { @@ -482,7 +471,7 @@ func (*GetMetricDescriptorRequest) ProtoMessage() {} func (x *GetMetricDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -524,11 +513,9 @@ type CreateMetricDescriptorRequest struct { func (x *CreateMetricDescriptorRequest) Reset() { *x = CreateMetricDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateMetricDescriptorRequest) String() string { @@ -539,7 +526,7 @@ func (*CreateMetricDescriptorRequest) ProtoMessage() {} func (x *CreateMetricDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -586,11 +573,9 @@ type DeleteMetricDescriptorRequest struct { func (x *DeleteMetricDescriptorRequest) Reset() { *x = DeleteMetricDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteMetricDescriptorRequest) String() string { @@ -601,7 +586,7 @@ func (*DeleteMetricDescriptorRequest) ProtoMessage() {} func (x *DeleteMetricDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -678,11 +663,9 @@ type ListTimeSeriesRequest struct { func (x *ListTimeSeriesRequest) Reset() { *x = ListTimeSeriesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListTimeSeriesRequest) String() string { @@ -693,7 +676,7 @@ func (*ListTimeSeriesRequest) ProtoMessage() {} func (x *ListTimeSeriesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -797,11 +780,9 @@ type ListTimeSeriesResponse struct { func (x *ListTimeSeriesResponse) Reset() { *x = ListTimeSeriesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListTimeSeriesResponse) String() string { @@ -812,7 +793,7 @@ func (*ListTimeSeriesResponse) ProtoMessage() {} func (x *ListTimeSeriesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -879,11 +860,9 @@ type CreateTimeSeriesRequest struct { func (x *CreateTimeSeriesRequest) Reset() { *x = CreateTimeSeriesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateTimeSeriesRequest) String() string { @@ -894,7 +873,7 @@ func (*CreateTimeSeriesRequest) ProtoMessage() {} func (x *CreateTimeSeriesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -941,11 +920,9 @@ type CreateTimeSeriesError struct { func (x *CreateTimeSeriesError) Reset() { *x = CreateTimeSeriesError{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateTimeSeriesError) String() string { @@ -956,7 +933,7 @@ func (*CreateTimeSeriesError) ProtoMessage() {} func (x *CreateTimeSeriesError) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1003,11 +980,9 @@ type CreateTimeSeriesSummary struct { func (x *CreateTimeSeriesSummary) Reset() { *x = CreateTimeSeriesSummary{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateTimeSeriesSummary) String() string { @@ -1018,7 +993,7 @@ func (*CreateTimeSeriesSummary) ProtoMessage() {} func (x *CreateTimeSeriesSummary) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1054,7 +1029,11 @@ func (x *CreateTimeSeriesSummary) GetErrors() []*CreateTimeSeriesSummary_Error { return nil } -// The `QueryTimeSeries` request. +// The `QueryTimeSeries` request. For information about the status of +// Monitoring Query Language (MQL), see the [MQL deprecation +// notice](https://cloud.google.com/stackdriver/docs/deprecations/mql). +// +// Deprecated: Marked as deprecated in google/monitoring/v3/metric_service.proto. type QueryTimeSeriesRequest struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -1080,11 +1059,9 @@ type QueryTimeSeriesRequest struct { func (x *QueryTimeSeriesRequest) Reset() { *x = QueryTimeSeriesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[13] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[13] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *QueryTimeSeriesRequest) String() string { @@ -1095,7 +1072,7 @@ func (*QueryTimeSeriesRequest) ProtoMessage() {} func (x *QueryTimeSeriesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[13] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1138,7 +1115,11 @@ func (x *QueryTimeSeriesRequest) GetPageToken() string { return "" } -// The `QueryTimeSeries` response. +// The `QueryTimeSeries` response. For information about the status of +// Monitoring Query Language (MQL), see the [MQL deprecation +// notice](https://cloud.google.com/stackdriver/docs/deprecations/mql). +// +// Deprecated: Marked as deprecated in google/monitoring/v3/metric_service.proto. type QueryTimeSeriesResponse struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -1160,11 +1141,9 @@ type QueryTimeSeriesResponse struct { func (x *QueryTimeSeriesResponse) Reset() { *x = QueryTimeSeriesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[14] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[14] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *QueryTimeSeriesResponse) String() string { @@ -1175,7 +1154,7 @@ func (*QueryTimeSeriesResponse) ProtoMessage() {} func (x *QueryTimeSeriesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[14] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1233,11 +1212,9 @@ type QueryErrorList struct { func (x *QueryErrorList) Reset() { *x = QueryErrorList{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[15] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *QueryErrorList) String() string { @@ -1248,7 +1225,7 @@ func (*QueryErrorList) ProtoMessage() {} func (x *QueryErrorList) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1291,11 +1268,9 @@ type CreateTimeSeriesSummary_Error struct { func (x *CreateTimeSeriesSummary_Error) Reset() { *x = CreateTimeSeriesSummary_Error{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[16] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[16] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateTimeSeriesSummary_Error) String() string { @@ -1306,7 +1281,7 @@ func (*CreateTimeSeriesSummary_Error) ProtoMessage() {} func (x *CreateTimeSeriesSummary_Error) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[16] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1392,363 +1367,365 @@ var file_google_monitoring_v3_metric_service_proto_rawDesc = []byte{ 0x37, 0x0a, 0x35, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xba, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xc9, 0x01, 0x0a, 0x1c, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x12, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, - 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, - 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, - 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0x94, 0x01, 0x0a, 0x1d, - 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x4b, 0x0a, - 0x12, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, - 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, - 0x65, 0x6e, 0x22, 0x64, 0x0a, 0x1a, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, - 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, - 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xb7, 0x01, 0x0a, 0x1d, 0x43, 0x72, 0x65, - 0x61, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, - 0x12, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x12, 0x4e, 0x0a, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, - 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x42, 0x03, 0xe0, 0x41, 0x02, - 0x52, 0x10, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x22, 0x67, 0x0a, 0x1d, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xad, 0x04, 0x0a, 0x15, - 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x40, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x2c, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x26, 0x12, 0x24, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, - 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, - 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, 0x69, - 0x6c, 0x74, 0x65, 0x72, 0x12, 0x43, 0x0a, 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, - 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, - 0x6d, 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, - 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x43, 0x0a, 0x0b, 0x61, 0x67, 0x67, - 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x0b, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x56, - 0x0a, 0x15, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x5f, 0x61, 0x67, 0x67, 0x72, - 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x14, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x41, 0x67, 0x67, 0x72, 0x65, - 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x5f, - 0x62, 0x79, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, - 0x79, 0x12, 0x53, 0x0a, 0x04, 0x76, 0x69, 0x65, 0x77, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, - 0x3a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x54, 0x69, 0x6d, - 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x56, 0x69, 0x65, 0x77, 0x42, 0x03, 0xe0, 0x41, 0x02, - 0x52, 0x04, 0x76, 0x69, 0x65, 0x77, 0x12, 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, - 0x69, 0x7a, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, - 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, - 0x6e, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, - 0x65, 0x6e, 0x22, 0x27, 0x0a, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, - 0x56, 0x69, 0x65, 0x77, 0x12, 0x08, 0x0a, 0x04, 0x46, 0x55, 0x4c, 0x4c, 0x10, 0x00, 0x12, 0x0b, - 0x0a, 0x07, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x53, 0x10, 0x01, 0x22, 0xd6, 0x01, 0x0a, 0x16, - 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, - 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x41, 0x0a, 0x0b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x0a, 0x74, - 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, + 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, + 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x06, 0x66, 0x69, + 0x6c, 0x74, 0x65, 0x72, 0x12, 0x20, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, + 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x70, 0x61, + 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x22, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, + 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, + 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0x94, 0x01, 0x0a, 0x1d, 0x4c, + 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x4b, 0x0a, 0x12, + 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, - 0x6e, 0x12, 0x3d, 0x0a, 0x10, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x65, - 0x72, 0x72, 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, - 0x0f, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, - 0x12, 0x12, 0x0a, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, - 0x75, 0x6e, 0x69, 0x74, 0x22, 0xaa, 0x01, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, - 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x12, 0x47, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x33, - 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2d, 0x0a, 0x2b, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x72, 0x65, 0x73, - 0x6f, 0x75, 0x72, 0x63, 0x65, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x50, 0x72, 0x6f, 0x6a, - 0x65, 0x63, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x0b, 0x74, 0x69, 0x6d, - 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, + 0x6e, 0x22, 0x64, 0x0a, 0x1a, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, + 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, 0xe0, + 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xb7, 0x01, 0x0a, 0x1d, 0x43, 0x72, 0x65, 0x61, + 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x12, + 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x12, 0x4e, 0x0a, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, + 0x10, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x22, 0x67, 0x0a, 0x1d, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xad, 0x04, 0x0a, 0x15, 0x4c, + 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x12, 0x40, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x2c, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x26, 0x12, 0x24, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, + 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, 0x69, 0x6c, + 0x74, 0x65, 0x72, 0x12, 0x43, 0x0a, 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, + 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x08, + 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x43, 0x0a, 0x0b, 0x61, 0x67, 0x67, 0x72, + 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x0b, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x56, 0x0a, + 0x15, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x5f, 0x61, 0x67, 0x67, 0x72, 0x65, + 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x14, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x5f, 0x62, + 0x79, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, 0x79, + 0x12, 0x53, 0x0a, 0x04, 0x76, 0x69, 0x65, 0x77, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, - 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x22, 0x8e, 0x01, 0x0a, 0x15, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, - 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x45, 0x0a, 0x0b, 0x74, - 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x12, 0x2e, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, - 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x42, 0x02, 0x18, 0x01, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x22, 0x98, 0x02, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, - 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x12, 0x2a, - 0x0a, 0x11, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, - 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x0f, 0x74, 0x6f, 0x74, 0x61, 0x6c, - 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x2e, 0x0a, 0x13, 0x73, 0x75, - 0x63, 0x63, 0x65, 0x73, 0x73, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, - 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x11, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, - 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x4b, 0x0a, 0x06, 0x65, 0x72, - 0x72, 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, + 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x54, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x56, 0x69, 0x65, 0x77, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, + 0x04, 0x76, 0x69, 0x65, 0x77, 0x12, 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, + 0x7a, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, + 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, + 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, + 0x6e, 0x22, 0x27, 0x0a, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x56, + 0x69, 0x65, 0x77, 0x12, 0x08, 0x0a, 0x04, 0x46, 0x55, 0x4c, 0x4c, 0x10, 0x00, 0x12, 0x0b, 0x0a, + 0x07, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x53, 0x10, 0x01, 0x22, 0xd6, 0x01, 0x0a, 0x16, 0x4c, + 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, + 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x41, 0x0a, 0x0b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, + 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x2e, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x52, - 0x06, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x1a, 0x54, 0x0a, 0x05, 0x45, 0x72, 0x72, 0x6f, 0x72, - 0x12, 0x2a, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, - 0x61, 0x74, 0x75, 0x73, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x1f, 0x0a, 0x0b, - 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x0a, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x88, 0x01, - 0x0a, 0x16, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x1b, 0x0a, 0x09, - 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x05, 0x52, - 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, - 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, - 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xae, 0x02, 0x0a, 0x17, 0x51, 0x75, 0x65, - 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, - 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x60, 0x0a, 0x16, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, - 0x69, 0x65, 0x73, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x18, 0x08, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, - 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x52, 0x14, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x4e, 0x0a, 0x10, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x52, 0x0e, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, - 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x39, - 0x0a, 0x0e, 0x70, 0x61, 0x72, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, - 0x18, 0x0b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x0d, 0x70, 0x61, 0x72, 0x74, - 0x69, 0x61, 0x6c, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x22, 0x6f, 0x0a, 0x0e, 0x51, 0x75, 0x65, - 0x72, 0x79, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4c, 0x69, 0x73, 0x74, 0x12, 0x38, 0x0a, 0x06, 0x65, - 0x72, 0x72, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x52, 0x06, 0x65, - 0x72, 0x72, 0x6f, 0x72, 0x73, 0x12, 0x23, 0x0a, 0x0d, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x73, - 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x65, 0x72, - 0x72, 0x6f, 0x72, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x32, 0xbc, 0x0f, 0x0a, 0x0d, 0x4d, - 0x65, 0x74, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0xe4, 0x01, 0x0a, - 0x20, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x73, 0x12, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x3e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, + 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x0a, 0x74, 0x69, + 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, + 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, + 0x12, 0x3d, 0x0a, 0x10, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x65, 0x72, + 0x72, 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x0f, + 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x12, + 0x12, 0x0a, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x75, + 0x6e, 0x69, 0x74, 0x22, 0xaa, 0x01, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, + 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, + 0x47, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x33, 0xe0, + 0x41, 0x02, 0xfa, 0x41, 0x2d, 0x0a, 0x2b, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x72, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x50, 0x72, 0x6f, 0x6a, 0x65, + 0x63, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x0b, 0x74, 0x69, 0x6d, 0x65, + 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, + 0x22, 0x8e, 0x01, 0x0a, 0x15, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, + 0x65, 0x72, 0x69, 0x65, 0x73, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x45, 0x0a, 0x0b, 0x74, 0x69, + 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x12, 0x2e, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, + 0x74, 0x61, 0x74, 0x75, 0x73, 0x42, 0x02, 0x18, 0x01, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, + 0x73, 0x22, 0x98, 0x02, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x12, 0x2a, 0x0a, + 0x11, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, + 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x0f, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x50, + 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x2e, 0x0a, 0x13, 0x73, 0x75, 0x63, + 0x63, 0x65, 0x73, 0x73, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x11, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x50, + 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x4b, 0x0a, 0x06, 0x65, 0x72, 0x72, + 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, + 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x2e, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x52, 0x06, + 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x1a, 0x54, 0x0a, 0x05, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, + 0x2a, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, + 0x74, 0x75, 0x73, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x70, + 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, + 0x52, 0x0a, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x8c, 0x01, 0x0a, + 0x16, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x1b, 0x0a, 0x09, 0x70, + 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, + 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, + 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, + 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x3a, 0x02, 0x18, 0x01, 0x22, 0xb2, 0x02, 0x0a, 0x17, + 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, + 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x60, 0x0a, 0x16, 0x74, 0x69, 0x6d, 0x65, 0x5f, + 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, + 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x52, 0x14, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x4e, 0x0a, 0x10, 0x74, 0x69, 0x6d, + 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x09, 0x20, + 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, + 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x52, 0x0e, 0x74, 0x69, 0x6d, 0x65, 0x53, + 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, + 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0a, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, + 0x6e, 0x12, 0x39, 0x0a, 0x0e, 0x70, 0x61, 0x72, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x65, 0x72, 0x72, + 0x6f, 0x72, 0x73, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x0d, 0x70, + 0x61, 0x72, 0x74, 0x69, 0x61, 0x6c, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x3a, 0x02, 0x18, 0x01, + 0x22, 0x6f, 0x0a, 0x0e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4c, 0x69, + 0x73, 0x74, 0x12, 0x38, 0x0a, 0x06, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x45, + 0x72, 0x72, 0x6f, 0x72, 0x52, 0x06, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x12, 0x23, 0x0a, 0x0d, + 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x73, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0c, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, + 0x79, 0x32, 0xbc, 0x0f, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, + 0x69, 0x63, 0x65, 0x12, 0xe4, 0x01, 0x0a, 0x20, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, - 0x22, 0x41, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x34, 0x12, - 0x32, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, - 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x73, 0x12, 0xcc, 0x01, 0x0a, 0x1e, 0x47, 0x65, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x3b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, - 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x1a, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, - 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x44, 0xda, 0x41, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x37, 0x12, 0x35, 0x2f, 0x76, 0x33, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x3e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, + 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, + 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x41, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x34, 0x12, 0x32, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, + 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xcc, 0x01, 0x0a, 0x1e, 0x47, + 0x65, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x3b, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, + 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x27, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, + 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x22, 0x44, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, + 0x02, 0x37, 0x12, 0x35, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x7d, 0x12, 0xb8, 0x01, 0x0a, 0x15, 0x4c, 0x69, + 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x73, 0x12, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, + 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x36, 0xda, 0x41, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x29, 0x12, 0x27, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, - 0x2a, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, - 0x2a, 0x7d, 0x12, 0xb8, 0x01, 0x0a, 0x15, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, - 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x32, 0x2e, 0x67, + 0x2a, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x12, 0xa0, 0x01, 0x0a, 0x13, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x30, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, - 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x36, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, - 0xe4, 0x93, 0x02, 0x29, 0x12, 0x27, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xa0, 0x01, - 0x0a, 0x13, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x30, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, + 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x1c, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x39, 0xda, 0x41, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2c, 0x12, 0x2a, 0x2f, 0x76, 0x33, + 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, + 0x2a, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x7d, 0x12, 0xc8, 0x01, 0x0a, 0x16, 0x43, 0x72, 0x65, 0x61, + 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, - 0xe4, 0x93, 0x02, 0x2c, 0x12, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, - 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x7d, - 0x12, 0xc8, 0x01, 0x0a, 0x16, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, - 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x33, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, - 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x5b, - 0xda, 0x41, 0x16, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x3c, 0x3a, - 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x22, 0x27, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, - 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xa0, 0x01, 0x0a, 0x16, - 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, - 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, - 0x70, 0x74, 0x79, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, - 0x02, 0x2c, 0x2a, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, - 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x7d, 0x12, 0xfe, - 0x01, 0x0a, 0x0e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x12, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, - 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2c, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, - 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x90, 0x01, 0xda, - 0x41, 0x19, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x2c, 0x69, 0x6e, - 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x2c, 0x76, 0x69, 0x65, 0x77, 0x82, 0xd3, 0xe4, 0x93, 0x02, - 0x6e, 0x5a, 0x27, 0x12, 0x25, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x6f, - 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, - 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x5a, 0x21, 0x12, 0x1f, 0x2f, 0x76, - 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, - 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x20, 0x2f, - 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, - 0x99, 0x01, 0x0a, 0x10, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, - 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, - 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x3e, 0xda, 0x41, 0x10, - 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, - 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x25, 0x3a, 0x01, 0x2a, 0x22, 0x20, 0x2f, 0x76, 0x33, 0x2f, 0x7b, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x5b, 0xda, 0x41, 0x16, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x6d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x3c, 0x3a, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x27, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, - 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0xae, 0x01, 0x0a, 0x17, - 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x54, 0x69, 0x6d, - 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, - 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x4c, - 0xda, 0x41, 0x10, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, - 0x69, 0x65, 0x73, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x33, 0x3a, 0x01, 0x2a, 0x22, 0x2e, 0x2f, 0x76, - 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, - 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x3a, 0x63, - 0x72, 0x65, 0x61, 0x74, 0x65, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x1a, 0xda, 0x01, 0xca, - 0x41, 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0xba, 0x01, 0x68, - 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, - 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, - 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, - 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, - 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x77, 0x72, 0x69, 0x74, 0x65, 0x42, 0x89, 0x08, 0xea, 0x41, 0xf0, 0x01, - 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x3b, 0x70, 0x72, - 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x45, 0x6f, 0x72, 0x67, 0x61, 0x6e, - 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, - 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, + 0x72, 0x73, 0x12, 0xa0, 0x01, 0x0a, 0x16, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, + 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x33, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2c, 0x2a, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, + 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, + 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x73, 0x2f, 0x2a, 0x2a, 0x7d, 0x12, 0xfe, 0x01, 0x0a, 0x0e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, + 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, + 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x22, 0x90, 0x01, 0xda, 0x41, 0x19, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x66, 0x69, + 0x6c, 0x74, 0x65, 0x72, 0x2c, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x2c, 0x76, 0x69, + 0x65, 0x77, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x6e, 0x5a, 0x27, 0x12, 0x25, 0x2f, 0x76, 0x33, 0x2f, + 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x5a, 0x21, 0x12, 0x1f, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x66, + 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, + 0x72, 0x69, 0x65, 0x73, 0x12, 0x20, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x99, 0x01, 0x0a, 0x10, 0x43, 0x72, 0x65, 0x61, 0x74, + 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, + 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, + 0x74, 0x79, 0x22, 0x3e, 0xda, 0x41, 0x10, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x74, 0x69, 0x6d, 0x65, + 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x25, 0x3a, 0x01, 0x2a, + 0x22, 0x20, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, + 0x65, 0x73, 0x12, 0xae, 0x01, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x53, 0x65, 0x72, + 0x76, 0x69, 0x63, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x4c, 0xda, 0x41, 0x10, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x74, + 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x33, + 0x3a, 0x01, 0x2a, 0x22, 0x2e, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, + 0x65, 0x72, 0x69, 0x65, 0x73, 0x3a, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x53, 0x65, 0x72, 0x76, + 0x69, 0x63, 0x65, 0x1a, 0xda, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0xd2, 0x41, 0xba, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, + 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, + 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, + 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, + 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x2c, + 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x77, 0x72, 0x69, 0x74, 0x65, + 0x42, 0x89, 0x08, 0xea, 0x41, 0xf0, 0x01, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x12, 0x3b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x3d, 0x2a, 0x2a, 0x7d, - 0x12, 0x39, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, - 0x72, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x01, 0x2a, 0x20, 0x01, - 0xea, 0x41, 0xb7, 0x02, 0x0a, 0x35, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x4f, 0x70, 0x72, 0x6f, - 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, - 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x59, 0x6f, 0x72, - 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, - 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x4d, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, - 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, - 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x01, 0x2a, 0x20, 0x01, 0xea, 0x41, 0x51, 0x0a, 0x23, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x57, 0x6f, 0x72, 0x6b, 0x73, 0x70, - 0x61, 0x63, 0x65, 0x12, 0x12, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x12, 0x16, 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x70, 0x61, - 0x63, 0x65, 0x73, 0x2f, 0x7b, 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x70, 0x61, 0x63, 0x65, 0x7d, 0xea, - 0x41, 0xb5, 0x01, 0x0a, 0x24, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x54, - 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2b, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x74, 0x69, - 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x12, 0x35, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, - 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x12, 0x29, 0x66, - 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, - 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x74, 0x69, 0x6d, 0x65, - 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x42, 0x12, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, - 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, - 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, - 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x12, 0x45, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, + 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x2f, 0x7b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x39, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, + 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x65, 0x74, + 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x3d, 0x2a, + 0x2a, 0x7d, 0x12, 0x01, 0x2a, 0x20, 0x01, 0xea, 0x41, 0xb7, 0x02, 0x0a, 0x35, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, + 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, + 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x12, 0x4f, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, + 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, + 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x7d, 0x12, 0x59, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x4d, + 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, + 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x01, 0x2a, + 0x20, 0x01, 0xea, 0x41, 0x51, 0x0a, 0x23, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0x2f, 0x57, 0x6f, 0x72, 0x6b, 0x73, 0x70, 0x61, 0x63, 0x65, 0x12, 0x12, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x12, 0x16, + 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x70, 0x61, 0x63, 0x65, 0x73, 0x2f, 0x7b, 0x77, 0x6f, 0x72, 0x6b, + 0x73, 0x70, 0x61, 0x63, 0x65, 0x7d, 0xea, 0x41, 0xb5, 0x01, 0x0a, 0x24, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, + 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, + 0x12, 0x2b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, + 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x12, 0x35, 0x6f, + 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, + 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, + 0x69, 0x65, 0x73, 0x7d, 0x12, 0x29, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, + 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x2f, 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x0a, + 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x12, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, + 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, + 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, + 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, + 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1846,212 +1823,6 @@ func file_google_monitoring_v3_metric_service_proto_init() { } file_google_monitoring_v3_common_proto_init() file_google_monitoring_v3_metric_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_metric_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*ListMonitoredResourceDescriptorsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListMonitoredResourceDescriptorsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*GetMonitoredResourceDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*ListMetricDescriptorsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*ListMetricDescriptorsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*GetMetricDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*CreateMetricDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*DeleteMetricDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*ListTimeSeriesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*ListTimeSeriesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*CreateTimeSeriesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*CreateTimeSeriesError); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*CreateTimeSeriesSummary); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[13].Exporter = func(v any, i int) any { - switch v := v.(*QueryTimeSeriesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[14].Exporter = func(v any, i int) any { - switch v := v.(*QueryTimeSeriesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[15].Exporter = func(v any, i int) any { - switch v := v.(*QueryErrorList); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[16].Exporter = func(v any, i int) any { - switch v := v.(*CreateTimeSeriesSummary_Error); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/mutation_record.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/mutation_record.pb.go index 643b244e4d396..5fd4f33807592 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/mutation_record.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/mutation_record.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/mutation_record.proto @@ -50,11 +50,9 @@ type MutationRecord struct { func (x *MutationRecord) Reset() { *x = MutationRecord{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_mutation_record_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_mutation_record_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *MutationRecord) String() string { @@ -65,7 +63,7 @@ func (*MutationRecord) ProtoMessage() {} func (x *MutationRecord) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_mutation_record_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -157,20 +155,6 @@ func file_google_monitoring_v3_mutation_record_proto_init() { if File_google_monitoring_v3_mutation_record_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_mutation_record_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*MutationRecord); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification.pb.go index 603b5bcdde12f..48d69d1431dc7 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/notification.proto @@ -146,11 +146,9 @@ type NotificationChannelDescriptor struct { func (x *NotificationChannelDescriptor) Reset() { *x = NotificationChannelDescriptor{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *NotificationChannelDescriptor) String() string { @@ -161,7 +159,7 @@ func (*NotificationChannelDescriptor) ProtoMessage() {} func (x *NotificationChannelDescriptor) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -241,7 +239,7 @@ type NotificationChannel struct { // [NotificationChannelDescriptor.type][google.monitoring.v3.NotificationChannelDescriptor.type] // field. Type string `protobuf:"bytes,1,opt,name=type,proto3" json:"type,omitempty"` - // The full REST resource name for this channel. The format is: + // Identifier. The full REST resource name for this channel. The format is: // // projects/[PROJECT_ID_OR_NUMBER]/notificationChannels/[CHANNEL_ID] // @@ -306,11 +304,9 @@ type NotificationChannel struct { func (x *NotificationChannel) Reset() { *x = NotificationChannel{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *NotificationChannel) String() string { @@ -321,7 +317,7 @@ func (*NotificationChannel) ProtoMessage() {} func (x *NotificationChannel) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -413,140 +409,142 @@ var file_google_monitoring_v3_notification_proto_rawDesc = []byte{ 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x14, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x1a, - 0x16, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x62, 0x65, - 0x6c, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, - 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x19, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, - 0x70, 0x69, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x1a, 0x21, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x2a, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x6d, 0x75, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x22, 0xf0, 0x04, 0x0a, 0x1d, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, - 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x20, 0x0a, - 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, - 0x33, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x62, - 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x06, 0x6c, 0x61, - 0x62, 0x65, 0x6c, 0x73, 0x12, 0x4e, 0x0a, 0x0f, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, - 0x64, 0x5f, 0x74, 0x69, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x21, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x54, 0x69, 0x65, 0x72, - 0x42, 0x02, 0x18, 0x01, 0x52, 0x0e, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, 0x54, - 0x69, 0x65, 0x72, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, - 0x74, 0x61, 0x67, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, - 0x61, 0x67, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, 0x65, - 0x3a, 0xa0, 0x02, 0xea, 0x41, 0x9c, 0x02, 0x0a, 0x37, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, - 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, - 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x12, 0x46, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, - 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x50, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, - 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x44, 0x66, 0x6f, 0x6c, 0x64, - 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, - 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, - 0x12, 0x01, 0x2a, 0x22, 0xc6, 0x08, 0x0a, 0x13, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x12, 0x0a, 0x04, 0x74, - 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, - 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, - 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, - 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, - 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x5a, 0x0a, 0x0b, 0x75, 0x73, 0x65, 0x72, 0x5f, - 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, - 0x65, 0x6c, 0x73, 0x12, 0x6d, 0x0a, 0x13, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, - 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x56, 0x65, 0x72, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x12, - 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x12, 0x34, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x0b, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, - 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x4d, 0x0a, 0x0f, 0x63, 0x72, 0x65, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, 0x0c, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x4f, 0x0a, 0x10, 0x6d, 0x75, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x18, 0x0d, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0f, 0x6d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, - 0x02, 0x38, 0x01, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, - 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, - 0x38, 0x01, 0x22, 0x57, 0x0a, 0x12, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x23, 0x0a, 0x1f, 0x56, 0x45, 0x52, 0x49, - 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, - 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0e, 0x0a, - 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, - 0x08, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x02, 0x3a, 0xfe, 0x01, 0xea, 0x41, - 0xfa, 0x01, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x12, 0x3e, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, + 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x66, 0x69, 0x65, 0x6c, + 0x64, 0x5f, 0x62, 0x65, 0x68, 0x61, 0x76, 0x69, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x1a, 0x16, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x62, + 0x65, 0x6c, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x19, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, + 0x61, 0x70, 0x69, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x1a, 0x21, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x2a, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x6d, 0x75, 0x74, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x22, 0xf0, 0x04, 0x0a, 0x1d, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, + 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x20, + 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x33, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, + 0x62, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x06, 0x6c, + 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x4e, 0x0a, 0x0f, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, + 0x65, 0x64, 0x5f, 0x74, 0x69, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x21, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x54, 0x69, 0x65, + 0x72, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0e, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, + 0x54, 0x69, 0x65, 0x72, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, + 0x73, 0x74, 0x61, 0x67, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, + 0x74, 0x61, 0x67, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, + 0x65, 0x3a, 0xa0, 0x02, 0xea, 0x41, 0x9c, 0x02, 0x0a, 0x37, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x12, 0x46, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x7d, 0x12, 0x48, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, - 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x7d, 0x12, 0x3c, 0x66, 0x6f, 0x6c, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x50, 0x6f, 0x72, 0x67, 0x61, 0x6e, + 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, + 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x44, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x7d, 0x12, 0x01, 0x2a, 0x42, 0xcc, 0x01, 0x0a, - 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x11, 0x4e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, - 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, - 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, - 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, - 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, - 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, - 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x33, + 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x7d, 0x12, 0x01, 0x2a, 0x22, 0xcb, 0x08, 0x0a, 0x13, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x12, 0x0a, 0x04, + 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, + 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, + 0xe0, 0x41, 0x08, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, + 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x20, 0x0a, 0x0b, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, + 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x35, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, + 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x5a, 0x0a, + 0x0b, 0x75, 0x73, 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x08, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x55, 0x73, + 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, + 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x6d, 0x0a, 0x13, 0x76, 0x65, 0x72, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, + 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, + 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x2e, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, + 0x61, 0x74, 0x75, 0x73, 0x52, 0x12, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x34, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, + 0x6c, 0x65, 0x64, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x4d, + 0x0a, 0x0f, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, + 0x64, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, + 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x63, + 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x4f, 0x0a, + 0x10, 0x6d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, + 0x73, 0x18, 0x0d, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, + 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0f, 0x6d, + 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x1a, 0x39, + 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, + 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, + 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, 0x73, 0x65, + 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, + 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, + 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x57, 0x0a, 0x12, 0x56, 0x65, 0x72, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x23, + 0x0a, 0x1f, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, + 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, + 0x02, 0x3a, 0xfe, 0x01, 0xea, 0x41, 0xfa, 0x01, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x3e, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, + 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, + 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x7d, 0x12, 0x48, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x7d, 0x12, 0x3c, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, + 0x65, 0x72, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x7d, 0x12, + 0x01, 0x2a, 0x42, 0xcc, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, + 0x11, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, + 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, + 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, + 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, + 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, + 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -599,32 +597,6 @@ func file_google_monitoring_v3_notification_proto_init() { } file_google_monitoring_v3_common_proto_init() file_google_monitoring_v3_mutation_record_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_notification_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*NotificationChannelDescriptor); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*NotificationChannel); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification_service.pb.go index ac7bafd1f10d3..9ae6580b1b43b 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/notification_service.proto @@ -73,11 +73,9 @@ type ListNotificationChannelDescriptorsRequest struct { func (x *ListNotificationChannelDescriptorsRequest) Reset() { *x = ListNotificationChannelDescriptorsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListNotificationChannelDescriptorsRequest) String() string { @@ -88,7 +86,7 @@ func (*ListNotificationChannelDescriptorsRequest) ProtoMessage() {} func (x *ListNotificationChannelDescriptorsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -142,11 +140,9 @@ type ListNotificationChannelDescriptorsResponse struct { func (x *ListNotificationChannelDescriptorsResponse) Reset() { *x = ListNotificationChannelDescriptorsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListNotificationChannelDescriptorsResponse) String() string { @@ -157,7 +153,7 @@ func (*ListNotificationChannelDescriptorsResponse) ProtoMessage() {} func (x *ListNotificationChannelDescriptorsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -200,11 +196,9 @@ type GetNotificationChannelDescriptorRequest struct { func (x *GetNotificationChannelDescriptorRequest) Reset() { *x = GetNotificationChannelDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetNotificationChannelDescriptorRequest) String() string { @@ -215,7 +209,7 @@ func (*GetNotificationChannelDescriptorRequest) ProtoMessage() {} func (x *GetNotificationChannelDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -260,11 +254,9 @@ type CreateNotificationChannelRequest struct { func (x *CreateNotificationChannelRequest) Reset() { *x = CreateNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateNotificationChannelRequest) String() string { @@ -275,7 +267,7 @@ func (*CreateNotificationChannelRequest) ProtoMessage() {} func (x *CreateNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -323,24 +315,24 @@ type ListNotificationChannelsRequest struct { // [`GetNotificationChannel`][google.monitoring.v3.NotificationChannelService.GetNotificationChannel] // operation. Name string `protobuf:"bytes,5,opt,name=name,proto3" json:"name,omitempty"` - // If provided, this field specifies the criteria that must be met by - // notification channels to be included in the response. + // Optional. If provided, this field specifies the criteria that must be met + // by notification channels to be included in the response. // // For more details, see [sorting and // filtering](https://cloud.google.com/monitoring/api/v3/sorting-and-filtering). Filter string `protobuf:"bytes,6,opt,name=filter,proto3" json:"filter,omitempty"` - // A comma-separated list of fields by which to sort the result. Supports - // the same set of fields as in `filter`. Entries can be prefixed with - // a minus sign to sort in descending rather than ascending order. + // Optional. A comma-separated list of fields by which to sort the result. + // Supports the same set of fields as in `filter`. Entries can be prefixed + // with a minus sign to sort in descending rather than ascending order. // // For more details, see [sorting and // filtering](https://cloud.google.com/monitoring/api/v3/sorting-and-filtering). OrderBy string `protobuf:"bytes,7,opt,name=order_by,json=orderBy,proto3" json:"order_by,omitempty"` - // The maximum number of results to return in a single response. If + // Optional. The maximum number of results to return in a single response. If // not set to a positive number, a reasonable value will be chosen by the // service. PageSize int32 `protobuf:"varint,3,opt,name=page_size,json=pageSize,proto3" json:"page_size,omitempty"` - // If non-empty, `page_token` must contain a value returned as the + // Optional. If non-empty, `page_token` must contain a value returned as the // `next_page_token` in a previous response to request the next set // of results. PageToken string `protobuf:"bytes,4,opt,name=page_token,json=pageToken,proto3" json:"page_token,omitempty"` @@ -348,11 +340,9 @@ type ListNotificationChannelsRequest struct { func (x *ListNotificationChannelsRequest) Reset() { *x = ListNotificationChannelsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListNotificationChannelsRequest) String() string { @@ -363,7 +353,7 @@ func (*ListNotificationChannelsRequest) ProtoMessage() {} func (x *ListNotificationChannelsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -433,11 +423,9 @@ type ListNotificationChannelsResponse struct { func (x *ListNotificationChannelsResponse) Reset() { *x = ListNotificationChannelsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListNotificationChannelsResponse) String() string { @@ -448,7 +436,7 @@ func (*ListNotificationChannelsResponse) ProtoMessage() {} func (x *ListNotificationChannelsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -498,11 +486,9 @@ type GetNotificationChannelRequest struct { func (x *GetNotificationChannelRequest) Reset() { *x = GetNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetNotificationChannelRequest) String() string { @@ -513,7 +499,7 @@ func (*GetNotificationChannelRequest) ProtoMessage() {} func (x *GetNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -541,7 +527,7 @@ type UpdateNotificationChannelRequest struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // The fields to update. + // Optional. The fields to update. UpdateMask *fieldmaskpb.FieldMask `protobuf:"bytes,2,opt,name=update_mask,json=updateMask,proto3" json:"update_mask,omitempty"` // Required. A description of the changes to be applied to the specified // notification channel. The description must provide a definition for @@ -552,11 +538,9 @@ type UpdateNotificationChannelRequest struct { func (x *UpdateNotificationChannelRequest) Reset() { *x = UpdateNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateNotificationChannelRequest) String() string { @@ -567,7 +551,7 @@ func (*UpdateNotificationChannelRequest) ProtoMessage() {} func (x *UpdateNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -608,18 +592,16 @@ type DeleteNotificationChannelRequest struct { Name string `protobuf:"bytes,3,opt,name=name,proto3" json:"name,omitempty"` // If true, the notification channel will be deleted regardless of its // use in alert policies (the policies will be updated to remove the - // channel). If false, channels that are still referenced by an existing - // alerting policy will fail to be deleted in a delete operation. + // channel). If false, this operation will fail if the notification channel + // is referenced by existing alerting policies. Force bool `protobuf:"varint,5,opt,name=force,proto3" json:"force,omitempty"` } func (x *DeleteNotificationChannelRequest) Reset() { *x = DeleteNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteNotificationChannelRequest) String() string { @@ -630,7 +612,7 @@ func (*DeleteNotificationChannelRequest) ProtoMessage() {} func (x *DeleteNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -671,11 +653,9 @@ type SendNotificationChannelVerificationCodeRequest struct { func (x *SendNotificationChannelVerificationCodeRequest) Reset() { *x = SendNotificationChannelVerificationCodeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *SendNotificationChannelVerificationCodeRequest) String() string { @@ -686,7 +666,7 @@ func (*SendNotificationChannelVerificationCodeRequest) ProtoMessage() {} func (x *SendNotificationChannelVerificationCodeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -732,11 +712,9 @@ type GetNotificationChannelVerificationCodeRequest struct { func (x *GetNotificationChannelVerificationCodeRequest) Reset() { *x = GetNotificationChannelVerificationCodeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetNotificationChannelVerificationCodeRequest) String() string { @@ -747,7 +725,7 @@ func (*GetNotificationChannelVerificationCodeRequest) ProtoMessage() {} func (x *GetNotificationChannelVerificationCodeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -795,11 +773,9 @@ type GetNotificationChannelVerificationCodeResponse struct { func (x *GetNotificationChannelVerificationCodeResponse) Reset() { *x = GetNotificationChannelVerificationCodeResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetNotificationChannelVerificationCodeResponse) String() string { @@ -810,7 +786,7 @@ func (*GetNotificationChannelVerificationCodeResponse) ProtoMessage() {} func (x *GetNotificationChannelVerificationCodeResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -859,11 +835,9 @@ type VerifyNotificationChannelRequest struct { func (x *VerifyNotificationChannelRequest) Reset() { *x = VerifyNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *VerifyNotificationChannelRequest) String() string { @@ -874,7 +848,7 @@ func (*VerifyNotificationChannelRequest) ProtoMessage() {} func (x *VerifyNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -971,262 +945,263 @@ var file_google_monitoring_v3_notification_service_proto_rawDesc = []byte{ 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x13, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x22, 0xdb, 0x01, 0x0a, 0x1f, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, + 0x65, 0x6c, 0x22, 0xef, 0x01, 0x0a, 0x1f, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x12, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x12, 0x16, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x19, 0x0a, 0x08, 0x6f, 0x72, 0x64, - 0x65, 0x72, 0x5f, 0x62, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6f, 0x72, 0x64, - 0x65, 0x72, 0x42, 0x79, 0x12, 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, - 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, - 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, - 0x22, 0xc9, 0x01, 0x0a, 0x20, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x52, 0x65, 0x73, - 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x5e, 0x0a, 0x15, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x18, 0x03, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, - 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, - 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, - 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, - 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1d, 0x0a, - 0x0a, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x09, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x53, 0x69, 0x7a, 0x65, 0x22, 0x6a, 0x0a, 0x1d, - 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, - 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, - 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, - 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xc2, 0x01, 0x0a, 0x20, 0x55, 0x70, 0x64, - 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, - 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3b, 0x0a, - 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x52, 0x0a, - 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, 0x61, 0x73, 0x6b, 0x12, 0x61, 0x0a, 0x14, 0x6e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x1e, + 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x5f, 0x62, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, 0x79, 0x12, 0x20, + 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x05, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, + 0x12, 0x22, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x04, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, + 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xc9, 0x01, 0x0a, 0x20, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x5e, 0x0a, 0x15, 0x6e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x13, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x83, 0x01, - 0x0a, 0x20, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, - 0x05, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x05, 0x66, 0x6f, - 0x72, 0x63, 0x65, 0x22, 0x7b, 0x0a, 0x2e, 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, + 0x6e, 0x65, 0x6c, 0x52, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, + 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, + 0x6e, 0x12, 0x1d, 0x0a, 0x0a, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x09, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x53, 0x69, 0x7a, 0x65, + 0x22, 0x6a, 0x0a, 0x1d, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, + 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, + 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xc7, 0x01, 0x0a, + 0x20, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, + 0x74, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, + 0x73, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, + 0x61, 0x73, 0x6b, 0x12, 0x61, 0x0a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x42, 0x03, 0xe0, 0x41, + 0x02, 0x52, 0x13, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x83, 0x01, 0x0a, 0x20, 0x44, 0x65, 0x6c, 0x65, 0x74, + 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, + 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, + 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x18, + 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x05, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x22, 0x7b, 0x0a, 0x2e, + 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, + 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, + 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, + 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xb7, 0x01, 0x0a, 0x2d, 0x47, 0x65, + 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, + 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, + 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x0b, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, + 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, + 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0a, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x54, + 0x69, 0x6d, 0x65, 0x22, 0x81, 0x01, 0x0a, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, - 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x22, 0xb7, 0x01, 0x0a, 0x2d, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, - 0x0b, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0a, - 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x22, 0x81, 0x01, 0x0a, 0x2e, 0x47, - 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, - 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x12, 0x0a, - 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x63, 0x6f, 0x64, - 0x65, 0x12, 0x3b, 0x0a, 0x0b, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, - 0x6d, 0x70, 0x52, 0x0a, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x22, 0x86, - 0x01, 0x0a, 0x20, 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x17, - 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, - 0x02, 0x52, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x32, 0xea, 0x12, 0x0a, 0x1a, 0x4e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, - 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0xec, 0x01, 0x0a, 0x22, 0x4c, 0x69, 0x73, 0x74, 0x4e, - 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x3f, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x40, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x12, 0x3b, 0x0a, 0x0b, 0x65, 0x78, + 0x70, 0x69, 0x72, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0a, 0x65, 0x78, 0x70, + 0x69, 0x72, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x22, 0x86, 0x01, 0x0a, 0x20, 0x56, 0x65, 0x72, 0x69, + 0x66, 0x79, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, + 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, + 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, + 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x17, 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x63, 0x6f, 0x64, 0x65, + 0x32, 0xea, 0x12, 0x0a, 0x1a, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, + 0xec, 0x01, 0x0a, 0x22, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x3f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, + 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x40, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, + 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x43, 0xda, 0x41, 0x04, 0x6e, 0x61, + 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x36, 0x12, 0x34, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, + 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, + 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xdd, + 0x01, 0x0a, 0x20, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x12, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, + 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x1a, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, - 0x22, 0x43, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x36, 0x12, - 0x34, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xdd, 0x01, 0x0a, 0x20, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x45, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x38, 0x12, 0x36, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, + 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, - 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x45, - 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x38, 0x12, 0x36, 0x2f, - 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xc4, 0x01, 0x0a, 0x18, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x73, 0x12, 0x35, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xc4, + 0x01, 0x0a, 0x18, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x35, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x1a, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, - 0x65, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2c, - 0x12, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, - 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0xb5, 0x01, 0x0a, - 0x16, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, - 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, - 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x3b, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2e, 0x12, 0x2c, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, - 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, + 0x6c, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2c, 0x12, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, + 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, + 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, + 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0xb5, 0x01, 0x0a, 0x16, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xe4, 0x01, 0x0a, 0x19, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4e, + 0x22, 0x3b, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2e, 0x12, + 0x2c, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, + 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xe4, 0x01, + 0x0a, 0x19, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x64, + 0xda, 0x41, 0x19, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x82, 0xd3, 0xe4, 0x93, + 0x02, 0x42, 0x3a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, + 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, + 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x83, 0x02, 0x0a, 0x19, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, - 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x64, 0xda, 0x41, 0x19, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x6e, - 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x42, 0x3a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, - 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x83, 0x02, 0x0a, 0x19, - 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x82, 0x01, 0xda, - 0x41, 0x20, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2c, 0x6e, 0x6f, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x82, 0x01, 0xda, 0x41, 0x20, 0x75, 0x70, 0x64, 0x61, 0x74, + 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2c, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x82, 0xd3, 0xe4, 0x93, 0x02, + 0x59, 0x3a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x32, 0x41, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x59, 0x3a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x32, 0x41, - 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, - 0x7d, 0x12, 0xae, 0x01, 0x0a, 0x19, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, - 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, - 0x41, 0xda, 0x41, 0x0a, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x82, 0xd3, - 0xe4, 0x93, 0x02, 0x2e, 0x2a, 0x2c, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, - 0x2a, 0x7d, 0x12, 0xdc, 0x01, 0x0a, 0x27, 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, - 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x44, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x53, 0xda, 0x41, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x46, 0x3a, 0x01, 0x2a, 0x22, 0x41, - 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, - 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x3a, 0x73, 0x65, 0x6e, - 0x64, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, - 0x65, 0x12, 0x87, 0x02, 0x0a, 0x26, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x43, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x1a, 0x44, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, - 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, - 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x52, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x45, 0x3a, 0x01, 0x2a, 0x22, 0x40, 0x2f, 0x76, 0x33, 0x2f, 0x7b, - 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, - 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x3a, 0x67, 0x65, 0x74, 0x56, 0x65, 0x72, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0xca, 0x01, 0x0a, 0x19, - 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x4a, 0xda, 0x41, - 0x09, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x63, 0x6f, 0x64, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x38, - 0x3a, 0x01, 0x2a, 0x22, 0x33, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, - 0x7d, 0x3a, 0x76, 0x65, 0x72, 0x69, 0x66, 0x79, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, - 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, - 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, - 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, - 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, - 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x72, 0x65, 0x61, 0x64, 0x42, 0xd3, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, + 0x65, 0x6c, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, + 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xae, 0x01, 0x0a, 0x19, 0x44, + 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, + 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x41, 0xda, 0x41, 0x0a, 0x6e, 0x61, 0x6d, + 0x65, 0x2c, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2e, 0x2a, 0x2c, 0x2f, + 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, + 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xdc, 0x01, 0x0a, 0x27, + 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x44, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, + 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x53, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, + 0xe4, 0x93, 0x02, 0x46, 0x3a, 0x01, 0x2a, 0x22, 0x41, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, + 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, + 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x3a, 0x73, 0x65, 0x6e, 0x64, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x87, 0x02, 0x0a, 0x26, 0x47, + 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x43, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, + 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x44, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, + 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, + 0x22, 0x52, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x45, 0x3a, + 0x01, 0x2a, 0x22, 0x40, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, + 0x3a, 0x67, 0x65, 0x74, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x6f, 0x64, 0x65, 0x12, 0xca, 0x01, 0x0a, 0x19, 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, 0x4e, + 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, + 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, + 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x42, 0x18, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, - 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, - 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, - 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, - 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, - 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, - 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, + 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x4a, 0xda, 0x41, 0x09, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x63, + 0x6f, 0x64, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x38, 0x3a, 0x01, 0x2a, 0x22, 0x33, 0x2f, 0x76, + 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, + 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x3a, 0x76, 0x65, 0x72, 0x69, 0x66, + 0x79, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, + 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, + 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, + 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, + 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x42, 0xd3, 0x01, + 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x18, 0x4e, 0x6f, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, + 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, + 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, + 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1303,164 +1278,6 @@ func file_google_monitoring_v3_notification_service_proto_init() { return } file_google_monitoring_v3_notification_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_notification_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*ListNotificationChannelDescriptorsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListNotificationChannelDescriptorsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*GetNotificationChannelDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*CreateNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*ListNotificationChannelsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*ListNotificationChannelsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*GetNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*UpdateNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*DeleteNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*SendNotificationChannelVerificationCodeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*GetNotificationChannelVerificationCodeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*GetNotificationChannelVerificationCodeResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*VerifyNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/query_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/query_service.pb.go index e9bfbd68f5379..b1f18a6d2534f 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/query_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/query_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/query_service.proto @@ -52,42 +52,42 @@ var file_google_monitoring_v3_query_service_proto_rawDesc = []byte{ 0x74, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x29, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x32, 0xde, 0x02, 0x0a, 0x0c, 0x51, 0x75, 0x65, 0x72, 0x79, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x12, 0xa1, 0x01, 0x0a, 0x0f, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, + 0x74, 0x6f, 0x32, 0xe1, 0x02, 0x0a, 0x0c, 0x51, 0x75, 0x65, 0x72, 0x79, 0x53, 0x65, 0x72, 0x76, + 0x69, 0x63, 0x65, 0x12, 0xa4, 0x01, 0x0a, 0x0f, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, - 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x31, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2b, 0x3a, 0x01, 0x2a, 0x22, + 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x34, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2b, 0x3a, 0x01, 0x2a, 0x22, 0x26, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x3a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, - 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, - 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, - 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, - 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, - 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x72, - 0x65, 0x61, 0x64, 0x42, 0xcc, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x42, 0x11, 0x51, 0x75, 0x65, 0x72, 0x79, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, - 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, - 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, - 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, - 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x73, 0x3a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x88, 0x02, 0x01, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, + 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, + 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, + 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, + 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, + 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x42, 0xcc, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x42, 0x11, 0x51, 0x75, 0x65, 0x72, 0x79, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, + 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, + 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, + 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var file_google_monitoring_v3_query_service_proto_goTypes = []any{ @@ -141,7 +141,11 @@ const _ = grpc.SupportPackageIsVersion6 // // For semantics around ctx use and closing/ending streaming RPCs, please refer to https://godoc.org/google.golang.org/grpc#ClientConn.NewStream. type QueryServiceClient interface { - // Queries time series using Monitoring Query Language. + // Deprecated: Do not use. + // Queries time series by using Monitoring Query Language (MQL). We recommend + // using PromQL instead of MQL. For more information about the status of MQL, + // see the [MQL deprecation + // notice](https://cloud.google.com/stackdriver/docs/deprecations/mql). QueryTimeSeries(ctx context.Context, in *QueryTimeSeriesRequest, opts ...grpc.CallOption) (*QueryTimeSeriesResponse, error) } @@ -153,6 +157,7 @@ func NewQueryServiceClient(cc grpc.ClientConnInterface) QueryServiceClient { return &queryServiceClient{cc} } +// Deprecated: Do not use. func (c *queryServiceClient) QueryTimeSeries(ctx context.Context, in *QueryTimeSeriesRequest, opts ...grpc.CallOption) (*QueryTimeSeriesResponse, error) { out := new(QueryTimeSeriesResponse) err := c.cc.Invoke(ctx, "/google.monitoring.v3.QueryService/QueryTimeSeries", in, out, opts...) @@ -164,7 +169,11 @@ func (c *queryServiceClient) QueryTimeSeries(ctx context.Context, in *QueryTimeS // QueryServiceServer is the server API for QueryService service. type QueryServiceServer interface { - // Queries time series using Monitoring Query Language. + // Deprecated: Do not use. + // Queries time series by using Monitoring Query Language (MQL). We recommend + // using PromQL instead of MQL. For more information about the status of MQL, + // see the [MQL deprecation + // notice](https://cloud.google.com/stackdriver/docs/deprecations/mql). QueryTimeSeries(context.Context, *QueryTimeSeriesRequest) (*QueryTimeSeriesResponse, error) } diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service.pb.go index 869a3738c09b9..aa462351d7c48 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/service.proto @@ -147,11 +147,9 @@ type Service struct { func (x *Service) Reset() { *x = Service{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service) String() string { @@ -162,7 +160,7 @@ func (*Service) ProtoMessage() {} func (x *Service) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -387,7 +385,7 @@ type ServiceLevelObjective struct { // quality. ServiceLevelIndicator *ServiceLevelIndicator `protobuf:"bytes,3,opt,name=service_level_indicator,json=serviceLevelIndicator,proto3" json:"service_level_indicator,omitempty"` // The fraction of service that must be good in order for this objective to be - // met. `0 < goal <= 0.999`. + // met. `0 < goal <= 0.9999`. Goal float64 `protobuf:"fixed64,4,opt,name=goal,proto3" json:"goal,omitempty"` // The time period over which the objective will be evaluated. // @@ -407,11 +405,9 @@ type ServiceLevelObjective struct { func (x *ServiceLevelObjective) Reset() { *x = ServiceLevelObjective{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ServiceLevelObjective) String() string { @@ -422,7 +418,7 @@ func (*ServiceLevelObjective) ProtoMessage() {} func (x *ServiceLevelObjective) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -546,11 +542,9 @@ type ServiceLevelIndicator struct { func (x *ServiceLevelIndicator) Reset() { *x = ServiceLevelIndicator{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ServiceLevelIndicator) String() string { @@ -561,7 +555,7 @@ func (*ServiceLevelIndicator) ProtoMessage() {} func (x *ServiceLevelIndicator) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -669,11 +663,9 @@ type BasicSli struct { func (x *BasicSli) Reset() { *x = BasicSli{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *BasicSli) String() string { @@ -684,7 +676,7 @@ func (*BasicSli) ProtoMessage() {} func (x *BasicSli) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -775,11 +767,9 @@ type Range struct { func (x *Range) Reset() { *x = Range{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Range) String() string { @@ -790,7 +780,7 @@ func (*Range) ProtoMessage() {} func (x *Range) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -837,11 +827,9 @@ type RequestBasedSli struct { func (x *RequestBasedSli) Reset() { *x = RequestBasedSli{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *RequestBasedSli) String() string { @@ -852,7 +840,7 @@ func (*RequestBasedSli) ProtoMessage() {} func (x *RequestBasedSli) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -941,11 +929,9 @@ type TimeSeriesRatio struct { func (x *TimeSeriesRatio) Reset() { *x = TimeSeriesRatio{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesRatio) String() string { @@ -956,7 +942,7 @@ func (*TimeSeriesRatio) ProtoMessage() {} func (x *TimeSeriesRatio) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1013,11 +999,9 @@ type DistributionCut struct { func (x *DistributionCut) Reset() { *x = DistributionCut{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DistributionCut) String() string { @@ -1028,7 +1012,7 @@ func (*DistributionCut) ProtoMessage() {} func (x *DistributionCut) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1081,11 +1065,9 @@ type WindowsBasedSli struct { func (x *WindowsBasedSli) Reset() { *x = WindowsBasedSli{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *WindowsBasedSli) String() string { @@ -1096,7 +1078,7 @@ func (*WindowsBasedSli) ProtoMessage() {} func (x *WindowsBasedSli) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1200,11 +1182,9 @@ type Service_Custom struct { func (x *Service_Custom) Reset() { *x = Service_Custom{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_Custom) String() string { @@ -1215,7 +1195,7 @@ func (*Service_Custom) ProtoMessage() {} func (x *Service_Custom) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1244,11 +1224,9 @@ type Service_AppEngine struct { func (x *Service_AppEngine) Reset() { *x = Service_AppEngine{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_AppEngine) String() string { @@ -1259,7 +1237,7 @@ func (*Service_AppEngine) ProtoMessage() {} func (x *Service_AppEngine) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1295,11 +1273,9 @@ type Service_CloudEndpoints struct { func (x *Service_CloudEndpoints) Reset() { *x = Service_CloudEndpoints{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_CloudEndpoints) String() string { @@ -1310,7 +1286,7 @@ func (*Service_CloudEndpoints) ProtoMessage() {} func (x *Service_CloudEndpoints) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1358,11 +1334,9 @@ type Service_ClusterIstio struct { func (x *Service_ClusterIstio) Reset() { *x = Service_ClusterIstio{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_ClusterIstio) String() string { @@ -1373,7 +1347,7 @@ func (*Service_ClusterIstio) ProtoMessage() {} func (x *Service_ClusterIstio) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1436,11 +1410,9 @@ type Service_MeshIstio struct { func (x *Service_MeshIstio) Reset() { *x = Service_MeshIstio{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[13] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[13] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_MeshIstio) String() string { @@ -1451,7 +1423,7 @@ func (*Service_MeshIstio) ProtoMessage() {} func (x *Service_MeshIstio) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[13] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1512,11 +1484,9 @@ type Service_IstioCanonicalService struct { func (x *Service_IstioCanonicalService) Reset() { *x = Service_IstioCanonicalService{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[14] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[14] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_IstioCanonicalService) String() string { @@ -1527,7 +1497,7 @@ func (*Service_IstioCanonicalService) ProtoMessage() {} func (x *Service_IstioCanonicalService) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[14] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1581,11 +1551,9 @@ type Service_CloudRun struct { func (x *Service_CloudRun) Reset() { *x = Service_CloudRun{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[15] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_CloudRun) String() string { @@ -1596,7 +1564,7 @@ func (*Service_CloudRun) ProtoMessage() {} func (x *Service_CloudRun) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1647,11 +1615,9 @@ type Service_GkeNamespace struct { func (x *Service_GkeNamespace) Reset() { *x = Service_GkeNamespace{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[16] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[16] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_GkeNamespace) String() string { @@ -1662,7 +1628,7 @@ func (*Service_GkeNamespace) ProtoMessage() {} func (x *Service_GkeNamespace) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[16] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1731,11 +1697,9 @@ type Service_GkeWorkload struct { func (x *Service_GkeWorkload) Reset() { *x = Service_GkeWorkload{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[17] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[17] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_GkeWorkload) String() string { @@ -1746,7 +1710,7 @@ func (*Service_GkeWorkload) ProtoMessage() {} func (x *Service_GkeWorkload) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[17] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1830,11 +1794,9 @@ type Service_GkeService struct { func (x *Service_GkeService) Reset() { *x = Service_GkeService{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[18] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[18] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_GkeService) String() string { @@ -1845,7 +1807,7 @@ func (*Service_GkeService) ProtoMessage() {} func (x *Service_GkeService) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[18] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1917,11 +1879,9 @@ type Service_BasicService struct { func (x *Service_BasicService) Reset() { *x = Service_BasicService{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[19] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[19] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_BasicService) String() string { @@ -1932,7 +1892,7 @@ func (*Service_BasicService) ProtoMessage() {} func (x *Service_BasicService) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[19] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1974,11 +1934,9 @@ type Service_Telemetry struct { func (x *Service_Telemetry) Reset() { *x = Service_Telemetry{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[20] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[20] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_Telemetry) String() string { @@ -1989,7 +1947,7 @@ func (*Service_Telemetry) ProtoMessage() {} func (x *Service_Telemetry) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[20] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2020,11 +1978,9 @@ type BasicSli_AvailabilityCriteria struct { func (x *BasicSli_AvailabilityCriteria) Reset() { *x = BasicSli_AvailabilityCriteria{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[24] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[24] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *BasicSli_AvailabilityCriteria) String() string { @@ -2035,7 +1991,7 @@ func (*BasicSli_AvailabilityCriteria) ProtoMessage() {} func (x *BasicSli_AvailabilityCriteria) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[24] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2063,11 +2019,9 @@ type BasicSli_LatencyCriteria struct { func (x *BasicSli_LatencyCriteria) Reset() { *x = BasicSli_LatencyCriteria{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[25] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[25] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *BasicSli_LatencyCriteria) String() string { @@ -2078,7 +2032,7 @@ func (*BasicSli_LatencyCriteria) ProtoMessage() {} func (x *BasicSli_LatencyCriteria) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[25] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2121,11 +2075,9 @@ type WindowsBasedSli_PerformanceThreshold struct { func (x *WindowsBasedSli_PerformanceThreshold) Reset() { *x = WindowsBasedSli_PerformanceThreshold{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[26] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[26] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *WindowsBasedSli_PerformanceThreshold) String() string { @@ -2136,7 +2088,7 @@ func (*WindowsBasedSli_PerformanceThreshold) ProtoMessage() {} func (x *WindowsBasedSli_PerformanceThreshold) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[26] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2218,11 +2170,9 @@ type WindowsBasedSli_MetricRange struct { func (x *WindowsBasedSli_MetricRange) Reset() { *x = WindowsBasedSli_MetricRange{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[27] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[27] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *WindowsBasedSli_MetricRange) String() string { @@ -2233,7 +2183,7 @@ func (*WindowsBasedSli_MetricRange) ProtoMessage() {} func (x *WindowsBasedSli_MetricRange) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[27] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2744,308 +2694,6 @@ func file_google_monitoring_v3_service_proto_init() { if File_google_monitoring_v3_service_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*Service); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ServiceLevelObjective); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*ServiceLevelIndicator); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*BasicSli); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*Range); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*RequestBasedSli); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesRatio); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*DistributionCut); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*WindowsBasedSli); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*Service_Custom); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*Service_AppEngine); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*Service_CloudEndpoints); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*Service_ClusterIstio); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[13].Exporter = func(v any, i int) any { - switch v := v.(*Service_MeshIstio); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[14].Exporter = func(v any, i int) any { - switch v := v.(*Service_IstioCanonicalService); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[15].Exporter = func(v any, i int) any { - switch v := v.(*Service_CloudRun); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[16].Exporter = func(v any, i int) any { - switch v := v.(*Service_GkeNamespace); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[17].Exporter = func(v any, i int) any { - switch v := v.(*Service_GkeWorkload); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[18].Exporter = func(v any, i int) any { - switch v := v.(*Service_GkeService); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[19].Exporter = func(v any, i int) any { - switch v := v.(*Service_BasicService); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[20].Exporter = func(v any, i int) any { - switch v := v.(*Service_Telemetry); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[24].Exporter = func(v any, i int) any { - switch v := v.(*BasicSli_AvailabilityCriteria); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[25].Exporter = func(v any, i int) any { - switch v := v.(*BasicSli_LatencyCriteria); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[26].Exporter = func(v any, i int) any { - switch v := v.(*WindowsBasedSli_PerformanceThreshold); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[27].Exporter = func(v any, i int) any { - switch v := v.(*WindowsBasedSli_MetricRange); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_service_proto_msgTypes[0].OneofWrappers = []any{ (*Service_Custom_)(nil), (*Service_AppEngine_)(nil), diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service_service.pb.go index 15e1f04d6a50f..01520d88a2ce6 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/service_service.proto @@ -63,11 +63,9 @@ type CreateServiceRequest struct { func (x *CreateServiceRequest) Reset() { *x = CreateServiceRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateServiceRequest) String() string { @@ -78,7 +76,7 @@ func (*CreateServiceRequest) ProtoMessage() {} func (x *CreateServiceRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -128,11 +126,9 @@ type GetServiceRequest struct { func (x *GetServiceRequest) Reset() { *x = GetServiceRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetServiceRequest) String() string { @@ -143,7 +139,7 @@ func (*GetServiceRequest) ProtoMessage() {} func (x *GetServiceRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -208,11 +204,9 @@ type ListServicesRequest struct { func (x *ListServicesRequest) Reset() { *x = ListServicesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListServicesRequest) String() string { @@ -223,7 +217,7 @@ func (*ListServicesRequest) ProtoMessage() {} func (x *ListServicesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -282,11 +276,9 @@ type ListServicesResponse struct { func (x *ListServicesResponse) Reset() { *x = ListServicesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListServicesResponse) String() string { @@ -297,7 +289,7 @@ func (*ListServicesResponse) ProtoMessage() {} func (x *ListServicesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -341,11 +333,9 @@ type UpdateServiceRequest struct { func (x *UpdateServiceRequest) Reset() { *x = UpdateServiceRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateServiceRequest) String() string { @@ -356,7 +346,7 @@ func (*UpdateServiceRequest) ProtoMessage() {} func (x *UpdateServiceRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -399,11 +389,9 @@ type DeleteServiceRequest struct { func (x *DeleteServiceRequest) Reset() { *x = DeleteServiceRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteServiceRequest) String() string { @@ -414,7 +402,7 @@ func (*DeleteServiceRequest) ProtoMessage() {} func (x *DeleteServiceRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -458,11 +446,9 @@ type CreateServiceLevelObjectiveRequest struct { func (x *CreateServiceLevelObjectiveRequest) Reset() { *x = CreateServiceLevelObjectiveRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateServiceLevelObjectiveRequest) String() string { @@ -473,7 +459,7 @@ func (*CreateServiceLevelObjectiveRequest) ProtoMessage() {} func (x *CreateServiceLevelObjectiveRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -529,11 +515,9 @@ type GetServiceLevelObjectiveRequest struct { func (x *GetServiceLevelObjectiveRequest) Reset() { *x = GetServiceLevelObjectiveRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetServiceLevelObjectiveRequest) String() string { @@ -544,7 +528,7 @@ func (*GetServiceLevelObjectiveRequest) ProtoMessage() {} func (x *GetServiceLevelObjectiveRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -603,11 +587,9 @@ type ListServiceLevelObjectivesRequest struct { func (x *ListServiceLevelObjectivesRequest) Reset() { *x = ListServiceLevelObjectivesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListServiceLevelObjectivesRequest) String() string { @@ -618,7 +600,7 @@ func (*ListServiceLevelObjectivesRequest) ProtoMessage() {} func (x *ListServiceLevelObjectivesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -684,11 +666,9 @@ type ListServiceLevelObjectivesResponse struct { func (x *ListServiceLevelObjectivesResponse) Reset() { *x = ListServiceLevelObjectivesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListServiceLevelObjectivesResponse) String() string { @@ -699,7 +679,7 @@ func (*ListServiceLevelObjectivesResponse) ProtoMessage() {} func (x *ListServiceLevelObjectivesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -743,11 +723,9 @@ type UpdateServiceLevelObjectiveRequest struct { func (x *UpdateServiceLevelObjectiveRequest) Reset() { *x = UpdateServiceLevelObjectiveRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateServiceLevelObjectiveRequest) String() string { @@ -758,7 +736,7 @@ func (*UpdateServiceLevelObjectiveRequest) ProtoMessage() {} func (x *UpdateServiceLevelObjectiveRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -802,11 +780,9 @@ type DeleteServiceLevelObjectiveRequest struct { func (x *DeleteServiceLevelObjectiveRequest) Reset() { *x = DeleteServiceLevelObjectiveRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteServiceLevelObjectiveRequest) String() string { @@ -817,7 +793,7 @@ func (*DeleteServiceLevelObjectiveRequest) ProtoMessage() {} func (x *DeleteServiceLevelObjectiveRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1205,152 +1181,6 @@ func file_google_monitoring_v3_service_service_proto_init() { return } file_google_monitoring_v3_service_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_service_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*CreateServiceRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*GetServiceRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*ListServicesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*ListServicesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateServiceRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*DeleteServiceRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*CreateServiceLevelObjectiveRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*GetServiceLevelObjectiveRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*ListServiceLevelObjectivesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*ListServiceLevelObjectivesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*UpdateServiceLevelObjectiveRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*DeleteServiceLevelObjectiveRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze.pb.go index ab49868045dcc..dc835473887df 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/snooze.proto @@ -45,7 +45,7 @@ type Snooze struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Required. The name of the `Snooze`. The format is: + // Required. Identifier. The name of the `Snooze`. The format is: // // projects/[PROJECT_ID_OR_NUMBER]/snoozes/[SNOOZE_ID] // @@ -67,11 +67,9 @@ type Snooze struct { func (x *Snooze) Reset() { *x = Snooze{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Snooze) String() string { @@ -82,7 +80,7 @@ func (*Snooze) ProtoMessage() {} func (x *Snooze) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -145,11 +143,9 @@ type Snooze_Criteria struct { func (x *Snooze_Criteria) Reset() { *x = Snooze_Criteria{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Snooze_Criteria) String() string { @@ -160,7 +156,7 @@ func (*Snooze_Criteria) ProtoMessage() {} func (x *Snooze_Criteria) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -196,7 +192,7 @@ var file_google_monitoring_v3_snooze_proto_rawDesc = []byte{ 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xf6, 0x02, 0x0a, 0x06, 0x53, 0x6e, 0x6f, 0x6f, 0x7a, 0x65, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x08, + 0x09, 0x42, 0x03, 0xe0, 0x41, 0x08, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x08, 0x63, 0x72, 0x69, 0x74, 0x65, 0x72, 0x69, 0x61, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x6e, 0x6f, 0x6f, 0x7a, 0x65, 0x2e, 0x43, 0x72, 0x69, @@ -268,32 +264,6 @@ func file_google_monitoring_v3_snooze_proto_init() { return } file_google_monitoring_v3_common_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_snooze_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*Snooze); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*Snooze_Criteria); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze_service.pb.go index 39388a9982884..8c9ffaa9d4f88 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/snooze_service.proto @@ -61,11 +61,9 @@ type CreateSnoozeRequest struct { func (x *CreateSnoozeRequest) Reset() { *x = CreateSnoozeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateSnoozeRequest) String() string { @@ -76,7 +74,7 @@ func (*CreateSnoozeRequest) ProtoMessage() {} func (x *CreateSnoozeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -144,11 +142,9 @@ type ListSnoozesRequest struct { func (x *ListSnoozesRequest) Reset() { *x = ListSnoozesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListSnoozesRequest) String() string { @@ -159,7 +155,7 @@ func (*ListSnoozesRequest) ProtoMessage() {} func (x *ListSnoozesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -218,11 +214,9 @@ type ListSnoozesResponse struct { func (x *ListSnoozesResponse) Reset() { *x = ListSnoozesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListSnoozesResponse) String() string { @@ -233,7 +227,7 @@ func (*ListSnoozesResponse) ProtoMessage() {} func (x *ListSnoozesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -277,11 +271,9 @@ type GetSnoozeRequest struct { func (x *GetSnoozeRequest) Reset() { *x = GetSnoozeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetSnoozeRequest) String() string { @@ -292,7 +284,7 @@ func (*GetSnoozeRequest) ProtoMessage() {} func (x *GetSnoozeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -361,11 +353,9 @@ type UpdateSnoozeRequest struct { func (x *UpdateSnoozeRequest) Reset() { *x = UpdateSnoozeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateSnoozeRequest) String() string { @@ -376,7 +366,7 @@ func (*UpdateSnoozeRequest) ProtoMessage() {} func (x *UpdateSnoozeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -580,68 +570,6 @@ func file_google_monitoring_v3_snooze_service_proto_init() { return } file_google_monitoring_v3_snooze_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_snooze_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*CreateSnoozeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListSnoozesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*ListSnoozesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*GetSnoozeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateSnoozeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/span_context.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/span_context.pb.go index 5a55ecc665091..3555d6e0a1cd5 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/span_context.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/span_context.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/span_context.proto @@ -61,11 +61,9 @@ type SpanContext struct { func (x *SpanContext) Reset() { *x = SpanContext{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_span_context_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_span_context_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *SpanContext) String() string { @@ -76,7 +74,7 @@ func (*SpanContext) ProtoMessage() {} func (x *SpanContext) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_span_context_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -153,20 +151,6 @@ func file_google_monitoring_v3_span_context_proto_init() { if File_google_monitoring_v3_span_context_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_span_context_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*SpanContext); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime.pb.go index e0b9e4a385a67..7e122ade520fa 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/uptime.proto @@ -699,11 +699,9 @@ type InternalChecker struct { func (x *InternalChecker) Reset() { *x = InternalChecker{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *InternalChecker) String() string { @@ -714,7 +712,7 @@ func (*InternalChecker) ProtoMessage() {} func (x *InternalChecker) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -787,11 +785,9 @@ type SyntheticMonitorTarget struct { func (x *SyntheticMonitorTarget) Reset() { *x = SyntheticMonitorTarget{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *SyntheticMonitorTarget) String() string { @@ -802,7 +798,7 @@ func (*SyntheticMonitorTarget) ProtoMessage() {} func (x *SyntheticMonitorTarget) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -928,11 +924,9 @@ type UptimeCheckConfig struct { func (x *UptimeCheckConfig) Reset() { *x = UptimeCheckConfig{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig) String() string { @@ -943,7 +937,7 @@ func (*UptimeCheckConfig) ProtoMessage() {} func (x *UptimeCheckConfig) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1157,11 +1151,9 @@ type UptimeCheckIp struct { func (x *UptimeCheckIp) Reset() { *x = UptimeCheckIp{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckIp) String() string { @@ -1172,7 +1164,7 @@ func (*UptimeCheckIp) ProtoMessage() {} func (x *UptimeCheckIp) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1227,11 +1219,9 @@ type SyntheticMonitorTarget_CloudFunctionV2Target struct { func (x *SyntheticMonitorTarget_CloudFunctionV2Target) Reset() { *x = SyntheticMonitorTarget_CloudFunctionV2Target{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *SyntheticMonitorTarget_CloudFunctionV2Target) String() string { @@ -1242,7 +1232,7 @@ func (*SyntheticMonitorTarget_CloudFunctionV2Target) ProtoMessage() {} func (x *SyntheticMonitorTarget_CloudFunctionV2Target) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1288,11 +1278,9 @@ type UptimeCheckConfig_ResourceGroup struct { func (x *UptimeCheckConfig_ResourceGroup) Reset() { *x = UptimeCheckConfig_ResourceGroup{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_ResourceGroup) String() string { @@ -1303,7 +1291,7 @@ func (*UptimeCheckConfig_ResourceGroup) ProtoMessage() {} func (x *UptimeCheckConfig_ResourceGroup) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1346,11 +1334,9 @@ type UptimeCheckConfig_PingConfig struct { func (x *UptimeCheckConfig_PingConfig) Reset() { *x = UptimeCheckConfig_PingConfig{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_PingConfig) String() string { @@ -1361,7 +1347,7 @@ func (*UptimeCheckConfig_PingConfig) ProtoMessage() {} func (x *UptimeCheckConfig_PingConfig) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1474,11 +1460,9 @@ type UptimeCheckConfig_HttpCheck struct { func (x *UptimeCheckConfig_HttpCheck) Reset() { *x = UptimeCheckConfig_HttpCheck{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_HttpCheck) String() string { @@ -1489,7 +1473,7 @@ func (*UptimeCheckConfig_HttpCheck) ProtoMessage() {} func (x *UptimeCheckConfig_HttpCheck) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1639,11 +1623,9 @@ type UptimeCheckConfig_TcpCheck struct { func (x *UptimeCheckConfig_TcpCheck) Reset() { *x = UptimeCheckConfig_TcpCheck{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_TcpCheck) String() string { @@ -1654,7 +1636,7 @@ func (*UptimeCheckConfig_TcpCheck) ProtoMessage() {} func (x *UptimeCheckConfig_TcpCheck) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1711,11 +1693,9 @@ type UptimeCheckConfig_ContentMatcher struct { func (x *UptimeCheckConfig_ContentMatcher) Reset() { *x = UptimeCheckConfig_ContentMatcher{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_ContentMatcher) String() string { @@ -1726,7 +1706,7 @@ func (*UptimeCheckConfig_ContentMatcher) ProtoMessage() {} func (x *UptimeCheckConfig_ContentMatcher) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1798,11 +1778,9 @@ type UptimeCheckConfig_HttpCheck_BasicAuthentication struct { func (x *UptimeCheckConfig_HttpCheck_BasicAuthentication) Reset() { *x = UptimeCheckConfig_HttpCheck_BasicAuthentication{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_HttpCheck_BasicAuthentication) String() string { @@ -1813,7 +1791,7 @@ func (*UptimeCheckConfig_HttpCheck_BasicAuthentication) ProtoMessage() {} func (x *UptimeCheckConfig_HttpCheck_BasicAuthentication) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1860,11 +1838,9 @@ type UptimeCheckConfig_HttpCheck_ResponseStatusCode struct { func (x *UptimeCheckConfig_HttpCheck_ResponseStatusCode) Reset() { *x = UptimeCheckConfig_HttpCheck_ResponseStatusCode{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_HttpCheck_ResponseStatusCode) String() string { @@ -1875,7 +1851,7 @@ func (*UptimeCheckConfig_HttpCheck_ResponseStatusCode) ProtoMessage() {} func (x *UptimeCheckConfig_HttpCheck_ResponseStatusCode) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1931,10 +1907,11 @@ func (*UptimeCheckConfig_HttpCheck_ResponseStatusCode_StatusValue) isUptimeCheck func (*UptimeCheckConfig_HttpCheck_ResponseStatusCode_StatusClass_) isUptimeCheckConfig_HttpCheck_ResponseStatusCode_StatusCode() { } -// Contains information needed for generating an +// Contains information needed for generating either an // [OpenID Connect -// token](https://developers.google.com/identity/protocols/OpenIDConnect). -// The OIDC token will be generated for the Monitoring service agent service +// token](https://developers.google.com/identity/protocols/OpenIDConnect) or +// [OAuth token](https://developers.google.com/identity/protocols/oauth2). +// The token will be generated for the Monitoring service agent service // account. type UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication struct { state protoimpl.MessageState @@ -1947,11 +1924,9 @@ type UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication struct { func (x *UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication) Reset() { *x = UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[13] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[13] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication) String() string { @@ -1962,7 +1937,7 @@ func (*UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication) ProtoMessage() {} func (x *UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[13] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2002,11 +1977,9 @@ type UptimeCheckConfig_ContentMatcher_JsonPathMatcher struct { func (x *UptimeCheckConfig_ContentMatcher_JsonPathMatcher) Reset() { *x = UptimeCheckConfig_ContentMatcher_JsonPathMatcher{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[15] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_ContentMatcher_JsonPathMatcher) String() string { @@ -2017,7 +1990,7 @@ func (*UptimeCheckConfig_ContentMatcher_JsonPathMatcher) ProtoMessage() {} func (x *UptimeCheckConfig_ContentMatcher_JsonPathMatcher) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2054,377 +2027,379 @@ var file_google_monitoring_v3_uptime_proto_rawDesc = []byte{ 0x6f, 0x74, 0x6f, 0x12, 0x14, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x1a, 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x62, 0x65, 0x68, 0x61, - 0x76, 0x69, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x23, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, - 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, - 0x19, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x72, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xa1, 0x02, 0x0a, 0x0f, 0x49, - 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x12, 0x12, - 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, - 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, - 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x12, - 0x19, 0x0a, 0x08, 0x67, 0x63, 0x70, 0x5f, 0x7a, 0x6f, 0x6e, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x07, 0x67, 0x63, 0x70, 0x5a, 0x6f, 0x6e, 0x65, 0x12, 0x26, 0x0a, 0x0f, 0x70, 0x65, - 0x65, 0x72, 0x5f, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x06, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x65, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x49, 0x64, 0x12, 0x41, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x74, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, - 0x0e, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, - 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x52, 0x05, - 0x73, 0x74, 0x61, 0x74, 0x65, 0x22, 0x33, 0x0a, 0x05, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x0f, - 0x0a, 0x0b, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, - 0x0c, 0x0a, 0x08, 0x43, 0x52, 0x45, 0x41, 0x54, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0b, 0x0a, - 0x07, 0x52, 0x55, 0x4e, 0x4e, 0x49, 0x4e, 0x47, 0x10, 0x02, 0x3a, 0x02, 0x18, 0x01, 0x22, 0xc4, - 0x02, 0x0a, 0x16, 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x12, 0x70, 0x0a, 0x11, 0x63, 0x6c, 0x6f, - 0x75, 0x64, 0x5f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x76, 0x32, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x42, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x79, 0x6e, 0x74, - 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, - 0x65, 0x74, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x56, 0x32, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6c, 0x6f, 0x75, - 0x64, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x32, 0x1a, 0xad, 0x01, 0x0a, 0x15, + 0x76, 0x69, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1b, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x69, 0x6e, 0x66, + 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x23, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, + 0x61, 0x70, 0x69, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x19, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xa1, 0x02, 0x0a, 0x0f, 0x49, 0x6e, 0x74, 0x65, + 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, + 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, + 0x6d, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x07, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x12, 0x19, 0x0a, 0x08, + 0x67, 0x63, 0x70, 0x5f, 0x7a, 0x6f, 0x6e, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, + 0x67, 0x63, 0x70, 0x5a, 0x6f, 0x6e, 0x65, 0x12, 0x26, 0x0a, 0x0f, 0x70, 0x65, 0x65, 0x72, 0x5f, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x0d, 0x70, 0x65, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x49, 0x64, 0x12, + 0x41, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x74, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, + 0x65, 0x63, 0x6b, 0x65, 0x72, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x52, 0x05, 0x73, 0x74, 0x61, + 0x74, 0x65, 0x22, 0x33, 0x0a, 0x05, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x55, + 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, + 0x43, 0x52, 0x45, 0x41, 0x54, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0b, 0x0a, 0x07, 0x52, 0x55, + 0x4e, 0x4e, 0x49, 0x4e, 0x47, 0x10, 0x02, 0x3a, 0x02, 0x18, 0x01, 0x22, 0xc4, 0x02, 0x0a, 0x16, + 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x12, 0x70, 0x0a, 0x11, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x5f, + 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x76, 0x32, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x42, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, + 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x32, 0x54, - 0x61, 0x72, 0x67, 0x65, 0x74, 0x12, 0x42, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x2e, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x28, 0x0a, 0x26, 0x63, 0x6c, 0x6f, - 0x75, 0x64, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x46, 0x75, 0x6e, 0x63, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x50, 0x0a, 0x12, 0x63, 0x6c, 0x6f, - 0x75, 0x64, 0x5f, 0x72, 0x75, 0x6e, 0x5f, 0x72, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, - 0x70, 0x69, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x10, 0x63, 0x6c, 0x6f, 0x75, 0x64, - 0x52, 0x75, 0x6e, 0x52, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0x0a, 0x06, 0x74, - 0x61, 0x72, 0x67, 0x65, 0x74, 0x22, 0x94, 0x23, 0x0a, 0x11, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, - 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x17, 0x0a, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x08, 0x52, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, - 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x4e, 0x0a, 0x12, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, - 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x48, 0x00, 0x52, 0x11, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x5e, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x5f, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x35, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x48, 0x00, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x12, 0x5b, 0x0a, 0x11, 0x73, 0x79, 0x6e, 0x74, 0x68, - 0x65, 0x74, 0x69, 0x63, 0x5f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x18, 0x15, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, - 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, - 0x48, 0x00, 0x52, 0x10, 0x73, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x12, 0x52, 0x0a, 0x0a, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x63, 0x68, 0x65, - 0x63, 0x6b, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x61, 0x72, 0x67, 0x65, 0x74, 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x46, 0x75, + 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x32, 0x1a, 0xad, 0x01, 0x0a, 0x15, 0x43, 0x6c, 0x6f, + 0x75, 0x64, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x32, 0x54, 0x61, 0x72, 0x67, + 0x65, 0x74, 0x12, 0x42, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x2e, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x28, 0x0a, 0x26, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x66, + 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x50, 0x0a, 0x12, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x5f, + 0x72, 0x75, 0x6e, 0x5f, 0x72, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, + 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x10, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x52, 0x75, 0x6e, + 0x52, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0x0a, 0x06, 0x74, 0x61, 0x72, 0x67, + 0x65, 0x74, 0x22, 0x94, 0x23, 0x0a, 0x11, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, + 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x08, 0x52, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, + 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x4e, 0x0a, 0x12, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, + 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, + 0x00, 0x52, 0x11, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x12, 0x5e, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x5f, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x72, + 0x6f, 0x75, 0x70, 0x48, 0x00, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, + 0x72, 0x6f, 0x75, 0x70, 0x12, 0x5b, 0x0a, 0x11, 0x73, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, + 0x63, 0x5f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, + 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x48, 0x00, 0x52, + 0x10, 0x73, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x12, 0x52, 0x0a, 0x0a, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x18, + 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, + 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, + 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x48, 0x01, 0x52, 0x09, 0x68, 0x74, 0x74, 0x70, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x4f, 0x0a, 0x09, 0x74, 0x63, 0x70, 0x5f, 0x63, 0x68, 0x65, + 0x63, 0x6b, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x48, 0x01, 0x52, 0x09, 0x68, - 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x4f, 0x0a, 0x09, 0x74, 0x63, 0x70, 0x5f, - 0x63, 0x68, 0x65, 0x63, 0x6b, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x54, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x48, 0x01, 0x52, - 0x08, 0x74, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x31, 0x0a, 0x06, 0x70, 0x65, 0x72, - 0x69, 0x6f, 0x64, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x12, 0x33, 0x0a, 0x07, - 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, - 0x74, 0x12, 0x61, 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x65, 0x72, 0x73, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x67, 0x6f, + 0x67, 0x2e, 0x54, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x48, 0x01, 0x52, 0x08, 0x74, 0x63, + 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x31, 0x0a, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, + 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x52, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x12, 0x33, 0x0a, 0x07, 0x74, 0x69, 0x6d, + 0x65, 0x6f, 0x75, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x12, 0x61, + 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, + 0x72, 0x73, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, + 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, + 0x73, 0x12, 0x56, 0x0a, 0x0c, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x5f, 0x74, 0x79, 0x70, + 0x65, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, + 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0b, 0x63, 0x68, + 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x52, 0x0a, 0x10, 0x73, 0x65, 0x6c, + 0x65, 0x63, 0x74, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0a, 0x20, + 0x03, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, + 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x73, 0x65, + 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x23, 0x0a, + 0x0b, 0x69, 0x73, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x18, 0x0f, 0x20, 0x01, + 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x69, 0x73, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, + 0x61, 0x6c, 0x12, 0x56, 0x0a, 0x11, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x5f, 0x63, + 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x73, 0x18, 0x0e, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x65, + 0x63, 0x6b, 0x65, 0x72, 0x42, 0x02, 0x18, 0x01, 0x52, 0x10, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, + 0x61, 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x73, 0x12, 0x58, 0x0a, 0x0b, 0x75, 0x73, + 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x14, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x37, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, + 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, + 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, 0x72, 0x4c, 0x61, + 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x78, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x47, 0x72, 0x6f, 0x75, 0x70, 0x12, 0x19, 0x0a, 0x08, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x5f, 0x69, + 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x49, 0x64, + 0x12, 0x4c, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, + 0x72, 0x6f, 0x75, 0x70, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, + 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x1a, 0x2d, + 0x0a, 0x0a, 0x50, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x1f, 0x0a, 0x0b, + 0x70, 0x69, 0x6e, 0x67, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x05, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x1a, 0xef, 0x0e, + 0x0a, 0x09, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x66, 0x0a, 0x0e, 0x72, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x18, 0x08, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x3f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, + 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, + 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, + 0x74, 0x68, 0x6f, 0x64, 0x52, 0x0d, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x12, 0x17, 0x0a, 0x07, 0x75, 0x73, 0x65, 0x5f, 0x73, 0x73, 0x6c, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, 0x75, 0x73, 0x65, 0x53, 0x73, 0x6c, 0x12, 0x12, 0x0a, 0x04, + 0x70, 0x61, 0x74, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, + 0x12, 0x12, 0x0a, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, + 0x70, 0x6f, 0x72, 0x74, 0x12, 0x62, 0x0a, 0x09, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x69, 0x6e, 0x66, + 0x6f, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x45, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, + 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x42, 0x61, 0x73, 0x69, 0x63, + 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, + 0x61, 0x75, 0x74, 0x68, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x21, 0x0a, 0x0c, 0x6d, 0x61, 0x73, 0x6b, + 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, + 0x6d, 0x61, 0x73, 0x6b, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x58, 0x0a, 0x07, 0x68, + 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3e, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, + 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x07, 0x68, 0x65, + 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x60, 0x0a, 0x0c, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, + 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x73, 0x12, 0x56, 0x0a, 0x0c, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x5f, - 0x74, 0x79, 0x70, 0x65, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x52, - 0x0b, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x52, 0x0a, 0x10, - 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, - 0x18, 0x0a, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, - 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x52, - 0x0f, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, - 0x12, 0x23, 0x0a, 0x0b, 0x69, 0x73, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x18, - 0x0f, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x69, 0x73, 0x49, 0x6e, 0x74, - 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x12, 0x56, 0x0a, 0x11, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, - 0x6c, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x73, 0x18, 0x0e, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, - 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x42, 0x02, 0x18, 0x01, 0x52, 0x10, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x73, 0x12, 0x58, 0x0a, - 0x0b, 0x75, 0x73, 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x14, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x37, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, - 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x55, 0x73, 0x65, 0x72, - 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, - 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x78, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x12, 0x19, 0x0a, 0x08, 0x67, 0x72, 0x6f, 0x75, - 0x70, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x67, 0x72, 0x6f, 0x75, - 0x70, 0x49, 0x64, 0x12, 0x4c, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, - 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, - 0x79, 0x70, 0x65, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, - 0x65, 0x1a, 0x2d, 0x0a, 0x0a, 0x50, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, - 0x1f, 0x0a, 0x0b, 0x70, 0x69, 0x6e, 0x67, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x05, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, - 0x1a, 0xef, 0x0e, 0x0a, 0x09, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x66, - 0x0a, 0x0e, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, - 0x18, 0x08, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, - 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x52, 0x0d, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x17, 0x0a, 0x07, 0x75, 0x73, 0x65, 0x5f, 0x73, 0x73, - 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, 0x75, 0x73, 0x65, 0x53, 0x73, 0x6c, 0x12, - 0x12, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x70, - 0x61, 0x74, 0x68, 0x12, 0x12, 0x0a, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x12, 0x62, 0x0a, 0x09, 0x61, 0x75, 0x74, 0x68, 0x5f, - 0x69, 0x6e, 0x66, 0x6f, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x45, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x42, 0x61, - 0x73, 0x69, 0x63, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x08, 0x61, 0x75, 0x74, 0x68, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x21, 0x0a, 0x0c, 0x6d, - 0x61, 0x73, 0x6b, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, - 0x08, 0x52, 0x0b, 0x6d, 0x61, 0x73, 0x6b, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x58, - 0x0a, 0x07, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x3e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x43, + 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0b, 0x63, 0x6f, 0x6e, 0x74, + 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x2e, 0x0a, 0x13, 0x63, 0x75, 0x73, 0x74, 0x6f, + 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x0d, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x43, 0x6f, 0x6e, 0x74, + 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x76, 0x61, 0x6c, 0x69, 0x64, + 0x61, 0x74, 0x65, 0x5f, 0x73, 0x73, 0x6c, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, 0x76, + 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x53, 0x73, 0x6c, 0x12, 0x12, 0x0a, 0x04, 0x62, 0x6f, + 0x64, 0x79, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x04, 0x62, 0x6f, 0x64, 0x79, 0x12, 0x89, + 0x01, 0x0a, 0x1e, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x70, + 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6f, 0x64, 0x65, + 0x73, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, + 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x1b, 0x61, + 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, + 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x73, 0x12, 0x53, 0x0a, 0x0b, 0x70, 0x69, + 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, - 0x07, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x60, 0x0a, 0x0c, 0x63, 0x6f, 0x6e, 0x74, - 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3d, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0b, 0x63, - 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x2e, 0x0a, 0x13, 0x63, 0x75, - 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x79, 0x70, - 0x65, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x43, - 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x76, 0x61, - 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x73, 0x73, 0x6c, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, - 0x52, 0x0b, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x53, 0x73, 0x6c, 0x12, 0x12, 0x0a, - 0x04, 0x62, 0x6f, 0x64, 0x79, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x04, 0x62, 0x6f, 0x64, - 0x79, 0x12, 0x89, 0x01, 0x0a, 0x1e, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x5f, 0x72, - 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, - 0x6f, 0x64, 0x65, 0x73, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, - 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, - 0x52, 0x1b, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, - 0x73, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x73, 0x12, 0x53, 0x0a, - 0x0b, 0x70, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x0c, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, - 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x50, 0x69, 0x6e, 0x67, - 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x12, 0x90, 0x01, 0x0a, 0x1c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x61, - 0x67, 0x65, 0x6e, 0x74, 0x5f, 0x61, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x53, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x1a, 0x73, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x4d, 0x0a, 0x13, 0x42, 0x61, 0x73, 0x69, 0x63, 0x41, 0x75, - 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1a, 0x0a, 0x08, - 0x75, 0x73, 0x65, 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, - 0x75, 0x73, 0x65, 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x70, 0x61, 0x73, 0x73, - 0x77, 0x6f, 0x72, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x70, 0x61, 0x73, 0x73, - 0x77, 0x6f, 0x72, 0x64, 0x1a, 0xf6, 0x02, 0x0a, 0x12, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, - 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, - 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x05, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x12, 0x75, 0x0a, 0x0c, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x50, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x50, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, + 0x90, 0x01, 0x0a, 0x1c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x61, 0x67, 0x65, 0x6e, + 0x74, 0x5f, 0x61, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, - 0x73, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x2e, 0x53, 0x74, 0x61, - 0x74, 0x75, 0x73, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x22, 0xb4, 0x01, 0x0a, 0x0b, 0x53, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x12, 0x1c, 0x0a, 0x18, 0x53, 0x54, 0x41, 0x54, 0x55, - 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, - 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, - 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x31, 0x58, 0x58, 0x10, 0x64, 0x12, 0x15, 0x0a, 0x10, 0x53, - 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x32, 0x58, 0x58, 0x10, - 0xc8, 0x01, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, - 0x53, 0x53, 0x5f, 0x33, 0x58, 0x58, 0x10, 0xac, 0x02, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, - 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x34, 0x58, 0x58, 0x10, 0x90, 0x03, - 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, - 0x5f, 0x35, 0x58, 0x58, 0x10, 0xf4, 0x03, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, - 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x41, 0x4e, 0x59, 0x10, 0xe8, 0x07, 0x42, 0x0d, - 0x0a, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x1a, 0x82, 0x02, - 0x0a, 0x1a, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, - 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x7f, 0x0a, 0x04, - 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x6b, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x53, 0x65, - 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, - 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, - 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x22, 0x63, 0x0a, - 0x1e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, - 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x12, - 0x31, 0x0a, 0x2d, 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x5f, 0x41, 0x47, 0x45, 0x4e, 0x54, - 0x5f, 0x41, 0x55, 0x54, 0x48, 0x45, 0x4e, 0x54, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, - 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, - 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, 0x4f, 0x49, 0x44, 0x43, 0x5f, 0x54, 0x4f, 0x4b, 0x45, 0x4e, - 0x10, 0x01, 0x1a, 0x3a, 0x0a, 0x0c, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x3a, - 0x0a, 0x0d, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, - 0x16, 0x0a, 0x12, 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, - 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x47, 0x45, 0x54, 0x10, 0x01, - 0x12, 0x08, 0x0a, 0x04, 0x50, 0x4f, 0x53, 0x54, 0x10, 0x02, 0x22, 0x47, 0x0a, 0x0b, 0x43, 0x6f, - 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x59, 0x50, - 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, - 0x0f, 0x0a, 0x0b, 0x55, 0x52, 0x4c, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, 0x45, 0x44, 0x10, 0x01, - 0x12, 0x11, 0x0a, 0x0d, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x50, 0x52, 0x4f, 0x56, 0x49, 0x44, 0x45, - 0x44, 0x10, 0x02, 0x42, 0x0d, 0x0a, 0x0b, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x6d, 0x65, 0x74, 0x68, - 0x6f, 0x64, 0x1a, 0x73, 0x0a, 0x08, 0x54, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x12, - 0x0a, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x70, 0x6f, - 0x72, 0x74, 0x12, 0x53, 0x0a, 0x0b, 0x70, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, + 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x1a, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, + 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x1a, 0x4d, 0x0a, 0x13, 0x42, 0x61, 0x73, 0x69, 0x63, 0x41, 0x75, 0x74, 0x68, 0x65, + 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1a, 0x0a, 0x08, 0x75, 0x73, 0x65, + 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x75, 0x73, 0x65, + 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x70, 0x61, 0x73, 0x73, 0x77, 0x6f, 0x72, + 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x70, 0x61, 0x73, 0x73, 0x77, 0x6f, 0x72, + 0x64, 0x1a, 0xf6, 0x02, 0x0a, 0x12, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, 0x74, + 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x61, 0x74, + 0x75, 0x73, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x48, 0x00, + 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x75, 0x0a, + 0x0c, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x50, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, + 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, + 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, + 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, + 0x43, 0x6c, 0x61, 0x73, 0x73, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, + 0x6c, 0x61, 0x73, 0x73, 0x22, 0xb4, 0x01, 0x0a, 0x0b, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, + 0x6c, 0x61, 0x73, 0x73, 0x12, 0x1c, 0x0a, 0x18, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, + 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, + 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, + 0x53, 0x53, 0x5f, 0x31, 0x58, 0x58, 0x10, 0x64, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, + 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x32, 0x58, 0x58, 0x10, 0xc8, 0x01, 0x12, + 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, + 0x33, 0x58, 0x58, 0x10, 0xac, 0x02, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, + 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x34, 0x58, 0x58, 0x10, 0x90, 0x03, 0x12, 0x15, 0x0a, + 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x35, 0x58, + 0x58, 0x10, 0xf4, 0x03, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, + 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x41, 0x4e, 0x59, 0x10, 0xe8, 0x07, 0x42, 0x0d, 0x0a, 0x0b, 0x73, + 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x1a, 0x82, 0x02, 0x0a, 0x1a, 0x53, + 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, + 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x7f, 0x0a, 0x04, 0x74, 0x79, 0x70, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x6b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x50, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x69, 0x6e, - 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0x84, 0x06, 0x0a, 0x0e, 0x43, 0x6f, 0x6e, 0x74, - 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x18, 0x0a, 0x07, 0x63, 0x6f, - 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x63, 0x6f, 0x6e, - 0x74, 0x65, 0x6e, 0x74, 0x12, 0x65, 0x0a, 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, + 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x22, 0x63, 0x0a, 0x1e, 0x53, 0x65, + 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, + 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x12, 0x31, 0x0a, 0x2d, + 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x5f, 0x41, 0x47, 0x45, 0x4e, 0x54, 0x5f, 0x41, 0x55, + 0x54, 0x48, 0x45, 0x4e, 0x54, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, + 0x0e, 0x0a, 0x0a, 0x4f, 0x49, 0x44, 0x43, 0x5f, 0x54, 0x4f, 0x4b, 0x45, 0x4e, 0x10, 0x01, 0x1a, + 0x3a, 0x0a, 0x0c, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, + 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, + 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x3a, 0x0a, 0x0d, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x16, 0x0a, 0x12, + 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, + 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x47, 0x45, 0x54, 0x10, 0x01, 0x12, 0x08, 0x0a, + 0x04, 0x50, 0x4f, 0x53, 0x54, 0x10, 0x02, 0x22, 0x47, 0x0a, 0x0b, 0x43, 0x6f, 0x6e, 0x74, 0x65, + 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, + 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, + 0x55, 0x52, 0x4c, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, 0x45, 0x44, 0x10, 0x01, 0x12, 0x11, 0x0a, + 0x0d, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x50, 0x52, 0x4f, 0x56, 0x49, 0x44, 0x45, 0x44, 0x10, 0x02, + 0x42, 0x0d, 0x0a, 0x0b, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x1a, + 0x73, 0x0a, 0x08, 0x54, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x12, 0x0a, 0x04, 0x70, + 0x6f, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x12, + 0x53, 0x0a, 0x0b, 0x70, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, + 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x50, 0x69, + 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x1a, 0x84, 0x06, 0x0a, 0x0e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x18, 0x0a, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, + 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, + 0x74, 0x12, 0x65, 0x0a, 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x0e, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x74, + 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, + 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x74, 0x0a, 0x11, 0x6a, 0x73, 0x6f, 0x6e, + 0x5f, 0x70, 0x61, 0x74, 0x68, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x46, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, + 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, + 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x4a, 0x73, 0x6f, 0x6e, + 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x0f, 0x6a, + 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x1a, 0x94, + 0x02, 0x0a, 0x0f, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x70, 0x61, 0x74, 0x68, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x12, + 0x7f, 0x0a, 0x0c, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x5c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, - 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x43, 0x6f, - 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x74, 0x0a, 0x11, 0x6a, - 0x73, 0x6f, 0x6e, 0x5f, 0x70, 0x61, 0x74, 0x68, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x46, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, - 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x4a, - 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, - 0x52, 0x0f, 0x6a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, - 0x72, 0x1a, 0x94, 0x02, 0x0a, 0x0f, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x70, 0x61, - 0x74, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x50, 0x61, - 0x74, 0x68, 0x12, 0x7f, 0x0a, 0x0c, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x5c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, - 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x2e, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x2e, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x6a, 0x73, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x22, 0x63, 0x0a, 0x15, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, - 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x28, 0x0a, 0x24, - 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x50, 0x41, 0x54, 0x48, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, + 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x4a, 0x73, + 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x4a, 0x73, + 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x6a, 0x73, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, + 0x22, 0x63, 0x0a, 0x15, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, + 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x28, 0x0a, 0x24, 0x4a, 0x53, 0x4f, + 0x4e, 0x5f, 0x50, 0x41, 0x54, 0x48, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x52, 0x5f, 0x4f, + 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, 0x45, 0x58, 0x41, 0x43, 0x54, 0x5f, 0x4d, 0x41, 0x54, + 0x43, 0x48, 0x10, 0x01, 0x12, 0x0f, 0x0a, 0x0b, 0x52, 0x45, 0x47, 0x45, 0x58, 0x5f, 0x4d, 0x41, + 0x54, 0x43, 0x48, 0x10, 0x02, 0x22, 0xc8, 0x01, 0x0a, 0x14, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, + 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x26, + 0x0a, 0x22, 0x43, 0x4f, 0x4e, 0x54, 0x45, 0x4e, 0x54, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x52, 0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, - 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, 0x45, 0x58, 0x41, 0x43, 0x54, 0x5f, - 0x4d, 0x41, 0x54, 0x43, 0x48, 0x10, 0x01, 0x12, 0x0f, 0x0a, 0x0b, 0x52, 0x45, 0x47, 0x45, 0x58, - 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x10, 0x02, 0x22, 0xc8, 0x01, 0x0a, 0x14, 0x43, 0x6f, 0x6e, - 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x26, 0x0a, 0x22, 0x43, 0x4f, 0x4e, 0x54, 0x45, 0x4e, 0x54, 0x5f, 0x4d, 0x41, 0x54, - 0x43, 0x48, 0x45, 0x52, 0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, - 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x43, 0x4f, 0x4e, - 0x54, 0x41, 0x49, 0x4e, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x17, - 0x0a, 0x13, 0x4e, 0x4f, 0x54, 0x5f, 0x43, 0x4f, 0x4e, 0x54, 0x41, 0x49, 0x4e, 0x53, 0x5f, 0x53, - 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x02, 0x12, 0x11, 0x0a, 0x0d, 0x4d, 0x41, 0x54, 0x43, 0x48, - 0x45, 0x53, 0x5f, 0x52, 0x45, 0x47, 0x45, 0x58, 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, 0x4e, 0x4f, - 0x54, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x52, 0x45, 0x47, 0x45, 0x58, 0x10, - 0x04, 0x12, 0x15, 0x0a, 0x11, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x4a, 0x53, 0x4f, - 0x4e, 0x5f, 0x50, 0x41, 0x54, 0x48, 0x10, 0x05, 0x12, 0x19, 0x0a, 0x15, 0x4e, 0x4f, 0x54, 0x5f, - 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x50, 0x41, 0x54, - 0x48, 0x10, 0x06, 0x42, 0x19, 0x0a, 0x17, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, - 0x6c, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x66, 0x6f, 0x1a, 0x3d, - 0x0a, 0x0f, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, - 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, - 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x55, 0x0a, - 0x0b, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1c, 0x0a, 0x18, - 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, - 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x16, 0x0a, 0x12, 0x53, 0x54, - 0x41, 0x54, 0x49, 0x43, 0x5f, 0x49, 0x50, 0x5f, 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, 0x52, 0x53, - 0x10, 0x01, 0x12, 0x10, 0x0a, 0x0c, 0x56, 0x50, 0x43, 0x5f, 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, - 0x52, 0x53, 0x10, 0x03, 0x3a, 0xf3, 0x01, 0xea, 0x41, 0xef, 0x01, 0x0a, 0x2b, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, - 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x3b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, - 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x75, 0x70, 0x74, - 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x2f, - 0x7b, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x7d, 0x12, 0x45, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x7d, 0x2f, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x2f, 0x7b, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, - 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x7d, 0x12, 0x39, 0x66, 0x6f, - 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x75, - 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x73, 0x2f, 0x7b, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x7d, 0x12, 0x01, 0x2a, 0x42, 0x0a, 0x0a, 0x08, 0x72, 0x65, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x14, 0x0a, 0x12, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, - 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x22, 0x8b, 0x01, 0x0a, - 0x0d, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x49, 0x70, 0x12, 0x3f, - 0x0a, 0x06, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x12, - 0x1a, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1d, 0x0a, 0x0a, 0x69, - 0x70, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x09, 0x69, 0x70, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x2a, 0x95, 0x01, 0x0a, 0x11, 0x55, - 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, - 0x12, 0x16, 0x0a, 0x12, 0x52, 0x45, 0x47, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, - 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x55, 0x53, 0x41, 0x10, - 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x45, 0x55, 0x52, 0x4f, 0x50, 0x45, 0x10, 0x02, 0x12, 0x11, 0x0a, - 0x0d, 0x53, 0x4f, 0x55, 0x54, 0x48, 0x5f, 0x41, 0x4d, 0x45, 0x52, 0x49, 0x43, 0x41, 0x10, 0x03, - 0x12, 0x10, 0x0a, 0x0c, 0x41, 0x53, 0x49, 0x41, 0x5f, 0x50, 0x41, 0x43, 0x49, 0x46, 0x49, 0x43, - 0x10, 0x04, 0x12, 0x0e, 0x0a, 0x0a, 0x55, 0x53, 0x41, 0x5f, 0x4f, 0x52, 0x45, 0x47, 0x4f, 0x4e, - 0x10, 0x05, 0x12, 0x0c, 0x0a, 0x08, 0x55, 0x53, 0x41, 0x5f, 0x49, 0x4f, 0x57, 0x41, 0x10, 0x06, - 0x12, 0x10, 0x0a, 0x0c, 0x55, 0x53, 0x41, 0x5f, 0x56, 0x49, 0x52, 0x47, 0x49, 0x4e, 0x49, 0x41, - 0x10, 0x07, 0x2a, 0x5b, 0x0a, 0x11, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x52, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1d, 0x0a, 0x19, 0x52, 0x45, 0x53, 0x4f, 0x55, - 0x52, 0x43, 0x45, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, - 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4e, 0x53, 0x54, 0x41, 0x4e, - 0x43, 0x45, 0x10, 0x01, 0x12, 0x19, 0x0a, 0x15, 0x41, 0x57, 0x53, 0x5f, 0x45, 0x4c, 0x42, 0x5f, - 0x4c, 0x4f, 0x41, 0x44, 0x5f, 0x42, 0x41, 0x4c, 0x41, 0x4e, 0x43, 0x45, 0x52, 0x10, 0x02, 0x42, - 0xaf, 0x02, 0xea, 0x41, 0x66, 0x0a, 0x26, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x66, 0x75, 0x6e, 0x63, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3c, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x7d, 0x2f, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6c, 0x6f, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x2f, 0x7b, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x0a, 0x18, 0x63, 0x6f, 0x6d, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x0b, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, - 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, - 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, - 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, - 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x43, 0x4f, 0x4e, 0x54, 0x41, 0x49, + 0x4e, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x17, 0x0a, 0x13, 0x4e, + 0x4f, 0x54, 0x5f, 0x43, 0x4f, 0x4e, 0x54, 0x41, 0x49, 0x4e, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, + 0x4e, 0x47, 0x10, 0x02, 0x12, 0x11, 0x0a, 0x0d, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, + 0x52, 0x45, 0x47, 0x45, 0x58, 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, 0x4e, 0x4f, 0x54, 0x5f, 0x4d, + 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x52, 0x45, 0x47, 0x45, 0x58, 0x10, 0x04, 0x12, 0x15, + 0x0a, 0x11, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x50, + 0x41, 0x54, 0x48, 0x10, 0x05, 0x12, 0x19, 0x0a, 0x15, 0x4e, 0x4f, 0x54, 0x5f, 0x4d, 0x41, 0x54, + 0x43, 0x48, 0x45, 0x53, 0x5f, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x50, 0x41, 0x54, 0x48, 0x10, 0x06, + 0x42, 0x19, 0x0a, 0x17, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x5f, 0x6d, + 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x66, 0x6f, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, + 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, + 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, + 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x55, 0x0a, 0x0b, 0x43, 0x68, + 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1c, 0x0a, 0x18, 0x43, 0x48, 0x45, + 0x43, 0x4b, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, + 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x16, 0x0a, 0x12, 0x53, 0x54, 0x41, 0x54, 0x49, + 0x43, 0x5f, 0x49, 0x50, 0x5f, 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, 0x52, 0x53, 0x10, 0x01, 0x12, + 0x10, 0x0a, 0x0c, 0x56, 0x50, 0x43, 0x5f, 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, 0x52, 0x53, 0x10, + 0x03, 0x3a, 0xf3, 0x01, 0xea, 0x41, 0xef, 0x01, 0x0a, 0x2b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x3b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, + 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x2f, 0x7b, 0x75, 0x70, + 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x7d, 0x12, 0x45, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, + 0x2f, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x73, 0x2f, 0x7b, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, + 0x6b, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x7d, 0x12, 0x39, 0x66, 0x6f, 0x6c, 0x64, 0x65, + 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x75, 0x70, 0x74, 0x69, + 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x2f, 0x7b, + 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x7d, 0x12, 0x01, 0x2a, 0x42, 0x0a, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x42, 0x14, 0x0a, 0x12, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x72, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x22, 0x8b, 0x01, 0x0a, 0x0d, 0x55, 0x70, + 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x49, 0x70, 0x12, 0x3f, 0x0a, 0x06, 0x72, + 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, + 0x67, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x12, 0x1a, 0x0a, 0x08, + 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, + 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1d, 0x0a, 0x0a, 0x69, 0x70, 0x5f, 0x61, + 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x69, 0x70, + 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x2a, 0x95, 0x01, 0x0a, 0x11, 0x55, 0x70, 0x74, 0x69, + 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, + 0x12, 0x52, 0x45, 0x47, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, + 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x55, 0x53, 0x41, 0x10, 0x01, 0x12, 0x0a, + 0x0a, 0x06, 0x45, 0x55, 0x52, 0x4f, 0x50, 0x45, 0x10, 0x02, 0x12, 0x11, 0x0a, 0x0d, 0x53, 0x4f, + 0x55, 0x54, 0x48, 0x5f, 0x41, 0x4d, 0x45, 0x52, 0x49, 0x43, 0x41, 0x10, 0x03, 0x12, 0x10, 0x0a, + 0x0c, 0x41, 0x53, 0x49, 0x41, 0x5f, 0x50, 0x41, 0x43, 0x49, 0x46, 0x49, 0x43, 0x10, 0x04, 0x12, + 0x0e, 0x0a, 0x0a, 0x55, 0x53, 0x41, 0x5f, 0x4f, 0x52, 0x45, 0x47, 0x4f, 0x4e, 0x10, 0x05, 0x12, + 0x0c, 0x0a, 0x08, 0x55, 0x53, 0x41, 0x5f, 0x49, 0x4f, 0x57, 0x41, 0x10, 0x06, 0x12, 0x10, 0x0a, + 0x0c, 0x55, 0x53, 0x41, 0x5f, 0x56, 0x49, 0x52, 0x47, 0x49, 0x4e, 0x49, 0x41, 0x10, 0x07, 0x2a, + 0x5b, 0x0a, 0x11, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x54, 0x79, 0x70, 0x65, 0x12, 0x1d, 0x0a, 0x19, 0x52, 0x45, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, + 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4e, 0x53, 0x54, 0x41, 0x4e, 0x43, 0x45, 0x10, + 0x01, 0x12, 0x19, 0x0a, 0x15, 0x41, 0x57, 0x53, 0x5f, 0x45, 0x4c, 0x42, 0x5f, 0x4c, 0x4f, 0x41, + 0x44, 0x5f, 0x42, 0x41, 0x4c, 0x41, 0x4e, 0x43, 0x45, 0x52, 0x10, 0x02, 0x42, 0xaf, 0x02, 0xea, + 0x41, 0x66, 0x0a, 0x26, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3c, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6c, + 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x7d, 0x2f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x66, + 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x42, 0x0b, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, + 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, + 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, + 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, + 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, + 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, + 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -2514,176 +2489,6 @@ func file_google_monitoring_v3_uptime_proto_init() { if File_google_monitoring_v3_uptime_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_uptime_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*InternalChecker); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*SyntheticMonitorTarget); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckIp); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*SyntheticMonitorTarget_CloudFunctionV2Target); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_ResourceGroup); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_PingConfig); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_HttpCheck); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_TcpCheck); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_ContentMatcher); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_HttpCheck_BasicAuthentication); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_HttpCheck_ResponseStatusCode); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[13].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[15].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_ContentMatcher_JsonPathMatcher); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_uptime_proto_msgTypes[1].OneofWrappers = []any{ (*SyntheticMonitorTarget_CloudFunctionV2)(nil), } diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime_service.pb.go index d4ba902fb07a2..d2958b865899a 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/uptime_service.proto @@ -73,11 +73,9 @@ type ListUptimeCheckConfigsRequest struct { func (x *ListUptimeCheckConfigsRequest) Reset() { *x = ListUptimeCheckConfigsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListUptimeCheckConfigsRequest) String() string { @@ -88,7 +86,7 @@ func (*ListUptimeCheckConfigsRequest) ProtoMessage() {} func (x *ListUptimeCheckConfigsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -152,11 +150,9 @@ type ListUptimeCheckConfigsResponse struct { func (x *ListUptimeCheckConfigsResponse) Reset() { *x = ListUptimeCheckConfigsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListUptimeCheckConfigsResponse) String() string { @@ -167,7 +163,7 @@ func (*ListUptimeCheckConfigsResponse) ProtoMessage() {} func (x *ListUptimeCheckConfigsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -217,11 +213,9 @@ type GetUptimeCheckConfigRequest struct { func (x *GetUptimeCheckConfigRequest) Reset() { *x = GetUptimeCheckConfigRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetUptimeCheckConfigRequest) String() string { @@ -232,7 +226,7 @@ func (*GetUptimeCheckConfigRequest) ProtoMessage() {} func (x *GetUptimeCheckConfigRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -272,11 +266,9 @@ type CreateUptimeCheckConfigRequest struct { func (x *CreateUptimeCheckConfigRequest) Reset() { *x = CreateUptimeCheckConfigRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateUptimeCheckConfigRequest) String() string { @@ -287,7 +279,7 @@ func (*CreateUptimeCheckConfigRequest) ProtoMessage() {} func (x *CreateUptimeCheckConfigRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -343,11 +335,9 @@ type UpdateUptimeCheckConfigRequest struct { func (x *UpdateUptimeCheckConfigRequest) Reset() { *x = UpdateUptimeCheckConfigRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateUptimeCheckConfigRequest) String() string { @@ -358,7 +348,7 @@ func (*UpdateUptimeCheckConfigRequest) ProtoMessage() {} func (x *UpdateUptimeCheckConfigRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -401,11 +391,9 @@ type DeleteUptimeCheckConfigRequest struct { func (x *DeleteUptimeCheckConfigRequest) Reset() { *x = DeleteUptimeCheckConfigRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteUptimeCheckConfigRequest) String() string { @@ -416,7 +404,7 @@ func (*DeleteUptimeCheckConfigRequest) ProtoMessage() {} func (x *DeleteUptimeCheckConfigRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -459,11 +447,9 @@ type ListUptimeCheckIpsRequest struct { func (x *ListUptimeCheckIpsRequest) Reset() { *x = ListUptimeCheckIpsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListUptimeCheckIpsRequest) String() string { @@ -474,7 +460,7 @@ func (*ListUptimeCheckIpsRequest) ProtoMessage() {} func (x *ListUptimeCheckIpsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -523,11 +509,9 @@ type ListUptimeCheckIpsResponse struct { func (x *ListUptimeCheckIpsResponse) Reset() { *x = ListUptimeCheckIpsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListUptimeCheckIpsResponse) String() string { @@ -538,7 +522,7 @@ func (*ListUptimeCheckIpsResponse) ProtoMessage() {} func (x *ListUptimeCheckIpsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -823,104 +807,6 @@ func file_google_monitoring_v3_uptime_service_proto_init() { return } file_google_monitoring_v3_uptime_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_uptime_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*ListUptimeCheckConfigsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListUptimeCheckConfigsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*GetUptimeCheckConfigRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*CreateUptimeCheckConfigRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateUptimeCheckConfigRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*DeleteUptimeCheckConfigRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*ListUptimeCheckIpsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*ListUptimeCheckIpsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ @@ -969,7 +855,7 @@ type UptimeCheckServiceClient interface { // if the Uptime check configuration is referenced by an alert policy or // other dependent configs that would be rendered invalid by the deletion. DeleteUptimeCheckConfig(ctx context.Context, in *DeleteUptimeCheckConfigRequest, opts ...grpc.CallOption) (*emptypb.Empty, error) - // Returns the list of IP addresses that checkers run from + // Returns the list of IP addresses that checkers run from. ListUptimeCheckIps(ctx context.Context, in *ListUptimeCheckIpsRequest, opts ...grpc.CallOption) (*ListUptimeCheckIpsResponse, error) } @@ -1053,7 +939,7 @@ type UptimeCheckServiceServer interface { // if the Uptime check configuration is referenced by an alert policy or // other dependent configs that would be rendered invalid by the deletion. DeleteUptimeCheckConfig(context.Context, *DeleteUptimeCheckConfigRequest) (*emptypb.Empty, error) - // Returns the list of IP addresses that checkers run from + // Returns the list of IP addresses that checkers run from. ListUptimeCheckIps(context.Context, *ListUptimeCheckIpsRequest) (*ListUptimeCheckIpsResponse, error) } diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/notification_channel_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/notification_channel_client.go index 6f7fe5d7c493d..ad64cb1292a06 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/notification_channel_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/notification_channel_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -329,6 +330,8 @@ type notificationChannelGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewNotificationChannelClient creates a new notification channel service client based on gRPC. @@ -356,6 +359,7 @@ func NewNotificationChannelClient(ctx context.Context, opts ...option.ClientOpti connPool: connPool, notificationChannelClient: monitoringpb.NewNotificationChannelServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -409,7 +413,7 @@ func (c *notificationChannelGRPCClient) ListNotificationChannelDescriptors(ctx c } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.ListNotificationChannelDescriptors(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.ListNotificationChannelDescriptors, req, settings.GRPC, c.logger, "ListNotificationChannelDescriptors") return err }, opts...) if err != nil { @@ -444,7 +448,7 @@ func (c *notificationChannelGRPCClient) GetNotificationChannelDescriptor(ctx con var resp *monitoringpb.NotificationChannelDescriptor err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.GetNotificationChannelDescriptor(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.GetNotificationChannelDescriptor, req, settings.GRPC, c.logger, "GetNotificationChannelDescriptor") return err }, opts...) if err != nil { @@ -473,7 +477,7 @@ func (c *notificationChannelGRPCClient) ListNotificationChannels(ctx context.Con } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.ListNotificationChannels(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.ListNotificationChannels, req, settings.GRPC, c.logger, "ListNotificationChannels") return err }, opts...) if err != nil { @@ -508,7 +512,7 @@ func (c *notificationChannelGRPCClient) GetNotificationChannel(ctx context.Conte var resp *monitoringpb.NotificationChannel err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.GetNotificationChannel(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.GetNotificationChannel, req, settings.GRPC, c.logger, "GetNotificationChannel") return err }, opts...) if err != nil { @@ -526,7 +530,7 @@ func (c *notificationChannelGRPCClient) CreateNotificationChannel(ctx context.Co var resp *monitoringpb.NotificationChannel err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.CreateNotificationChannel(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.CreateNotificationChannel, req, settings.GRPC, c.logger, "CreateNotificationChannel") return err }, opts...) if err != nil { @@ -544,7 +548,7 @@ func (c *notificationChannelGRPCClient) UpdateNotificationChannel(ctx context.Co var resp *monitoringpb.NotificationChannel err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.UpdateNotificationChannel(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.UpdateNotificationChannel, req, settings.GRPC, c.logger, "UpdateNotificationChannel") return err }, opts...) if err != nil { @@ -561,7 +565,7 @@ func (c *notificationChannelGRPCClient) DeleteNotificationChannel(ctx context.Co opts = append((*c.CallOptions).DeleteNotificationChannel[0:len((*c.CallOptions).DeleteNotificationChannel):len((*c.CallOptions).DeleteNotificationChannel)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.notificationChannelClient.DeleteNotificationChannel(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.notificationChannelClient.DeleteNotificationChannel, req, settings.GRPC, c.logger, "DeleteNotificationChannel") return err }, opts...) return err @@ -575,7 +579,7 @@ func (c *notificationChannelGRPCClient) SendNotificationChannelVerificationCode( opts = append((*c.CallOptions).SendNotificationChannelVerificationCode[0:len((*c.CallOptions).SendNotificationChannelVerificationCode):len((*c.CallOptions).SendNotificationChannelVerificationCode)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.notificationChannelClient.SendNotificationChannelVerificationCode(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.notificationChannelClient.SendNotificationChannelVerificationCode, req, settings.GRPC, c.logger, "SendNotificationChannelVerificationCode") return err }, opts...) return err @@ -590,7 +594,7 @@ func (c *notificationChannelGRPCClient) GetNotificationChannelVerificationCode(c var resp *monitoringpb.GetNotificationChannelVerificationCodeResponse err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.GetNotificationChannelVerificationCode(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.GetNotificationChannelVerificationCode, req, settings.GRPC, c.logger, "GetNotificationChannelVerificationCode") return err }, opts...) if err != nil { @@ -608,7 +612,7 @@ func (c *notificationChannelGRPCClient) VerifyNotificationChannel(ctx context.Co var resp *monitoringpb.NotificationChannel err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.VerifyNotificationChannel(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.VerifyNotificationChannel, req, settings.GRPC, c.logger, "VerifyNotificationChannel") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/query_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/query_client.go index 3c111637e19d9..dcd19e6985227 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/query_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/query_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" @@ -105,7 +106,12 @@ func (c *QueryClient) Connection() *grpc.ClientConn { return c.internalClient.Connection() } -// QueryTimeSeries queries time series using Monitoring Query Language. +// QueryTimeSeries queries time series by using Monitoring Query Language (MQL). We recommend +// using PromQL instead of MQL. For more information about the status of MQL, +// see the MQL deprecation +// notice (at https://cloud.google.com/stackdriver/docs/deprecations/mql). +// +// Deprecated: QueryTimeSeries may be removed in a future version. func (c *QueryClient) QueryTimeSeries(ctx context.Context, req *monitoringpb.QueryTimeSeriesRequest, opts ...gax.CallOption) *TimeSeriesDataIterator { return c.internalClient.QueryTimeSeries(ctx, req, opts...) } @@ -125,6 +131,8 @@ type queryGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewQueryClient creates a new query service client based on gRPC. @@ -153,6 +161,7 @@ func NewQueryClient(ctx context.Context, opts ...option.ClientOption) (*QueryCli connPool: connPool, queryClient: monitoringpb.NewQueryServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -206,7 +215,7 @@ func (c *queryGRPCClient) QueryTimeSeries(ctx context.Context, req *monitoringpb } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.queryClient.QueryTimeSeries(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.queryClient.QueryTimeSeries, req, settings.GRPC, c.logger, "QueryTimeSeries") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/service_monitoring_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/service_monitoring_client.go index 7776c425f9f84..206b7e4c1131d 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/service_monitoring_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/service_monitoring_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -274,6 +275,8 @@ type serviceMonitoringGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewServiceMonitoringClient creates a new service monitoring service client based on gRPC. @@ -303,6 +306,7 @@ func NewServiceMonitoringClient(ctx context.Context, opts ...option.ClientOption connPool: connPool, serviceMonitoringClient: monitoringpb.NewServiceMonitoringServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -345,7 +349,7 @@ func (c *serviceMonitoringGRPCClient) CreateService(ctx context.Context, req *mo var resp *monitoringpb.Service err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.CreateService(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.CreateService, req, settings.GRPC, c.logger, "CreateService") return err }, opts...) if err != nil { @@ -363,7 +367,7 @@ func (c *serviceMonitoringGRPCClient) GetService(ctx context.Context, req *monit var resp *monitoringpb.Service err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.GetService(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.GetService, req, settings.GRPC, c.logger, "GetService") return err }, opts...) if err != nil { @@ -392,7 +396,7 @@ func (c *serviceMonitoringGRPCClient) ListServices(ctx context.Context, req *mon } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.ListServices(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.ListServices, req, settings.GRPC, c.logger, "ListServices") return err }, opts...) if err != nil { @@ -427,7 +431,7 @@ func (c *serviceMonitoringGRPCClient) UpdateService(ctx context.Context, req *mo var resp *monitoringpb.Service err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.UpdateService(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.UpdateService, req, settings.GRPC, c.logger, "UpdateService") return err }, opts...) if err != nil { @@ -444,7 +448,7 @@ func (c *serviceMonitoringGRPCClient) DeleteService(ctx context.Context, req *mo opts = append((*c.CallOptions).DeleteService[0:len((*c.CallOptions).DeleteService):len((*c.CallOptions).DeleteService)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.serviceMonitoringClient.DeleteService(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.serviceMonitoringClient.DeleteService, req, settings.GRPC, c.logger, "DeleteService") return err }, opts...) return err @@ -459,7 +463,7 @@ func (c *serviceMonitoringGRPCClient) CreateServiceLevelObjective(ctx context.Co var resp *monitoringpb.ServiceLevelObjective err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.CreateServiceLevelObjective(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.CreateServiceLevelObjective, req, settings.GRPC, c.logger, "CreateServiceLevelObjective") return err }, opts...) if err != nil { @@ -477,7 +481,7 @@ func (c *serviceMonitoringGRPCClient) GetServiceLevelObjective(ctx context.Conte var resp *monitoringpb.ServiceLevelObjective err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.GetServiceLevelObjective(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.GetServiceLevelObjective, req, settings.GRPC, c.logger, "GetServiceLevelObjective") return err }, opts...) if err != nil { @@ -506,7 +510,7 @@ func (c *serviceMonitoringGRPCClient) ListServiceLevelObjectives(ctx context.Con } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.ListServiceLevelObjectives(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.ListServiceLevelObjectives, req, settings.GRPC, c.logger, "ListServiceLevelObjectives") return err }, opts...) if err != nil { @@ -541,7 +545,7 @@ func (c *serviceMonitoringGRPCClient) UpdateServiceLevelObjective(ctx context.Co var resp *monitoringpb.ServiceLevelObjective err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.UpdateServiceLevelObjective(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.UpdateServiceLevelObjective, req, settings.GRPC, c.logger, "UpdateServiceLevelObjective") return err }, opts...) if err != nil { @@ -558,7 +562,7 @@ func (c *serviceMonitoringGRPCClient) DeleteServiceLevelObjective(ctx context.Co opts = append((*c.CallOptions).DeleteServiceLevelObjective[0:len((*c.CallOptions).DeleteServiceLevelObjective):len((*c.CallOptions).DeleteServiceLevelObjective)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.serviceMonitoringClient.DeleteServiceLevelObjective(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.serviceMonitoringClient.DeleteServiceLevelObjective, req, settings.GRPC, c.logger, "DeleteServiceLevelObjective") return err }, opts...) return err diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/snooze_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/snooze_client.go index 32cad577e3ff5..ce238659ed902 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/snooze_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/snooze_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -181,6 +182,8 @@ type snoozeGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewSnoozeClient creates a new snooze service client based on gRPC. @@ -209,6 +212,7 @@ func NewSnoozeClient(ctx context.Context, opts ...option.ClientOption) (*SnoozeC connPool: connPool, snoozeClient: monitoringpb.NewSnoozeServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -251,7 +255,7 @@ func (c *snoozeGRPCClient) CreateSnooze(ctx context.Context, req *monitoringpb.C var resp *monitoringpb.Snooze err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.snoozeClient.CreateSnooze(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.snoozeClient.CreateSnooze, req, settings.GRPC, c.logger, "CreateSnooze") return err }, opts...) if err != nil { @@ -280,7 +284,7 @@ func (c *snoozeGRPCClient) ListSnoozes(ctx context.Context, req *monitoringpb.Li } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.snoozeClient.ListSnoozes(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.snoozeClient.ListSnoozes, req, settings.GRPC, c.logger, "ListSnoozes") return err }, opts...) if err != nil { @@ -315,7 +319,7 @@ func (c *snoozeGRPCClient) GetSnooze(ctx context.Context, req *monitoringpb.GetS var resp *monitoringpb.Snooze err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.snoozeClient.GetSnooze(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.snoozeClient.GetSnooze, req, settings.GRPC, c.logger, "GetSnooze") return err }, opts...) if err != nil { @@ -333,7 +337,7 @@ func (c *snoozeGRPCClient) UpdateSnooze(ctx context.Context, req *monitoringpb.U var resp *monitoringpb.Snooze err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.snoozeClient.UpdateSnooze(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.snoozeClient.UpdateSnooze, req, settings.GRPC, c.logger, "UpdateSnooze") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/uptime_check_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/uptime_check_client.go index d3815251374da..6f0c7feca5a18 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/uptime_check_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/uptime_check_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -206,7 +207,7 @@ func (c *UptimeCheckClient) DeleteUptimeCheckConfig(ctx context.Context, req *mo return c.internalClient.DeleteUptimeCheckConfig(ctx, req, opts...) } -// ListUptimeCheckIps returns the list of IP addresses that checkers run from +// ListUptimeCheckIps returns the list of IP addresses that checkers run from. func (c *UptimeCheckClient) ListUptimeCheckIps(ctx context.Context, req *monitoringpb.ListUptimeCheckIpsRequest, opts ...gax.CallOption) *UptimeCheckIpIterator { return c.internalClient.ListUptimeCheckIps(ctx, req, opts...) } @@ -226,6 +227,8 @@ type uptimeCheckGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewUptimeCheckClient creates a new uptime check service client based on gRPC. @@ -259,6 +262,7 @@ func NewUptimeCheckClient(ctx context.Context, opts ...option.ClientOption) (*Up connPool: connPool, uptimeCheckClient: monitoringpb.NewUptimeCheckServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -312,7 +316,7 @@ func (c *uptimeCheckGRPCClient) ListUptimeCheckConfigs(ctx context.Context, req } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.ListUptimeCheckConfigs(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.ListUptimeCheckConfigs, req, settings.GRPC, c.logger, "ListUptimeCheckConfigs") return err }, opts...) if err != nil { @@ -347,7 +351,7 @@ func (c *uptimeCheckGRPCClient) GetUptimeCheckConfig(ctx context.Context, req *m var resp *monitoringpb.UptimeCheckConfig err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.GetUptimeCheckConfig(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.GetUptimeCheckConfig, req, settings.GRPC, c.logger, "GetUptimeCheckConfig") return err }, opts...) if err != nil { @@ -365,7 +369,7 @@ func (c *uptimeCheckGRPCClient) CreateUptimeCheckConfig(ctx context.Context, req var resp *monitoringpb.UptimeCheckConfig err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.CreateUptimeCheckConfig(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.CreateUptimeCheckConfig, req, settings.GRPC, c.logger, "CreateUptimeCheckConfig") return err }, opts...) if err != nil { @@ -383,7 +387,7 @@ func (c *uptimeCheckGRPCClient) UpdateUptimeCheckConfig(ctx context.Context, req var resp *monitoringpb.UptimeCheckConfig err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.UpdateUptimeCheckConfig(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.UpdateUptimeCheckConfig, req, settings.GRPC, c.logger, "UpdateUptimeCheckConfig") return err }, opts...) if err != nil { @@ -400,7 +404,7 @@ func (c *uptimeCheckGRPCClient) DeleteUptimeCheckConfig(ctx context.Context, req opts = append((*c.CallOptions).DeleteUptimeCheckConfig[0:len((*c.CallOptions).DeleteUptimeCheckConfig):len((*c.CallOptions).DeleteUptimeCheckConfig)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.uptimeCheckClient.DeleteUptimeCheckConfig(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.uptimeCheckClient.DeleteUptimeCheckConfig, req, settings.GRPC, c.logger, "DeleteUptimeCheckConfig") return err }, opts...) return err @@ -423,7 +427,7 @@ func (c *uptimeCheckGRPCClient) ListUptimeCheckIps(ctx context.Context, req *mon } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.ListUptimeCheckIps(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.ListUptimeCheckIps, req, settings.GRPC, c.logger, "ListUptimeCheckIps") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/internal/version.go b/vendor/cloud.google.com/go/monitoring/internal/version.go index 96b26337cb742..08bddba748611 100644 --- a/vendor/cloud.google.com/go/monitoring/internal/version.go +++ b/vendor/cloud.google.com/go/monitoring/internal/version.go @@ -15,4 +15,4 @@ package internal // Version is the current tagged release of the library. -const Version = "1.21.2" +const Version = "1.22.1" diff --git a/vendor/cloud.google.com/go/storage/CHANGES.md b/vendor/cloud.google.com/go/storage/CHANGES.md index a1961604faef7..e90454d01ade7 100644 --- a/vendor/cloud.google.com/go/storage/CHANGES.md +++ b/vendor/cloud.google.com/go/storage/CHANGES.md @@ -1,6 +1,30 @@ # Changes +## [1.50.0](https://github.com/googleapis/google-cloud-go/compare/storage/v1.49.0...storage/v1.50.0) (2025-01-09) + + +### Features + +* **storage/internal:** Add new appendable Object to BidiWrite API ([2e4feb9](https://github.com/googleapis/google-cloud-go/commit/2e4feb938ce9ab023c8aa6bd1dbdf36fe589213a)) +* **storage/internal:** Add new preview BidiReadObject API ([2e4feb9](https://github.com/googleapis/google-cloud-go/commit/2e4feb938ce9ab023c8aa6bd1dbdf36fe589213a)) +* **storage:** Add support for gRPC bi-directional multi-range reads. This API is in private preview and not generally and is not yet available for general use. ([#11377](https://github.com/googleapis/google-cloud-go/issues/11377)) ([b4d86a5](https://github.com/googleapis/google-cloud-go/commit/b4d86a52bd319a602115cdb710a743c71494a88b)) +* **storage:** Add support for ReadHandle, a gRPC feature that allows for accelerated resumption of streams when one is interrupted. ReadHandle requires the bi-directional read API, which is in private preview and is not yet available for general use. ([#11377](https://github.com/googleapis/google-cloud-go/issues/11377)) ([b4d86a5](https://github.com/googleapis/google-cloud-go/commit/b4d86a52bd319a602115cdb710a743c71494a88b)) +* **storage:** Support appendable semantics for writes in gRPC. This API is in preview. ([#11377](https://github.com/googleapis/google-cloud-go/issues/11377)) ([b4d86a5](https://github.com/googleapis/google-cloud-go/commit/b4d86a52bd319a602115cdb710a743c71494a88b)) +* **storage:** Refactor gRPC writer flow ([#11377](https://github.com/googleapis/google-cloud-go/issues/11377)) ([b4d86a5](https://github.com/googleapis/google-cloud-go/commit/b4d86a52bd319a602115cdb710a743c71494a88b)) + + +### Bug Fixes + +* **storage:** Add mutex around uses of mrd variables ([#11405](https://github.com/googleapis/google-cloud-go/issues/11405)) ([54bfc32](https://github.com/googleapis/google-cloud-go/commit/54bfc32db7a0ff40a493de4d466f21ad624de04e)) +* **storage:** Return the appropriate error for method not supported ([#11416](https://github.com/googleapis/google-cloud-go/issues/11416)) ([56d704e](https://github.com/googleapis/google-cloud-go/commit/56d704e3037840aeb87b22cc83f2b6088c79bcee)) + + +### Documentation + +* **storage/internal:** Add IAM information to RPC comments for reference documentation ([2e4feb9](https://github.com/googleapis/google-cloud-go/commit/2e4feb938ce9ab023c8aa6bd1dbdf36fe589213a)) +* **storage:** Add preview comment to NewMultiRangeDownloader ([#11420](https://github.com/googleapis/google-cloud-go/issues/11420)) ([4ec1d66](https://github.com/googleapis/google-cloud-go/commit/4ec1d66ee180e800606568e8693a282645ec7369)) + ## [1.49.0](https://github.com/googleapis/google-cloud-go/compare/storage/v1.48.0...storage/v1.49.0) (2024-12-21) diff --git a/vendor/cloud.google.com/go/storage/client.go b/vendor/cloud.google.com/go/storage/client.go index 2d697202843a4..1ea1d98ce5df7 100644 --- a/vendor/cloud.google.com/go/storage/client.go +++ b/vendor/cloud.google.com/go/storage/client.go @@ -108,6 +108,8 @@ type storageClient interface { ListNotifications(ctx context.Context, bucket string, opts ...storageOption) (map[string]*Notification, error) CreateNotification(ctx context.Context, bucket string, n *Notification, opts ...storageOption) (*Notification, error) DeleteNotification(ctx context.Context, bucket string, id string, opts ...storageOption) error + + NewMultiRangeDownloader(ctx context.Context, params *newMultiRangeDownloaderParams, opts ...storageOption) (*MultiRangeDownloader, error) } // settings contains transport-agnostic configuration for API calls made via @@ -261,6 +263,9 @@ type openWriterParams struct { // sendCRC32C - see `Writer.SendCRC32C`. // Optional. sendCRC32C bool + // append - Write with appendable object semantics. + // Optional. + append bool // Writer callbacks @@ -278,6 +283,15 @@ type openWriterParams struct { setObj func(*ObjectAttrs) } +type newMultiRangeDownloaderParams struct { + bucket string + conds *Conditions + encryptionKey []byte + gen int64 + object string + handle *ReadHandle +} + type newRangeReaderParams struct { bucket string conds *Conditions @@ -287,6 +301,7 @@ type newRangeReaderParams struct { object string offset int64 readCompressed bool // Use accept-encoding: gzip. Only works for HTTP currently. + handle *ReadHandle } type getObjectParams struct { diff --git a/vendor/cloud.google.com/go/storage/experimental/experimental.go b/vendor/cloud.google.com/go/storage/experimental/experimental.go index b35de64d39d25..5bcc59ad2f456 100644 --- a/vendor/cloud.google.com/go/storage/experimental/experimental.go +++ b/vendor/cloud.google.com/go/storage/experimental/experimental.go @@ -73,3 +73,15 @@ type ReadStallTimeoutConfig struct { // and retried. TargetPercentile float64 } + +// WithGRPCBidiReads provides an [option.ClientOption] that may be passed to +// [cloud.google.com/go/storage.NewGRPCClient]. +// It enables the client to use bi-directional gRPC APIs for downloads rather than the +// server streaming API. In particular, it allows users to use the [storage.MultiRangeDownloader] +// surface, which requires bi-directional streaming. +// +// The bi-directional API is in private preview; please contact your account manager if +// interested. +func WithGRPCBidiReads() option.ClientOption { + return internal.WithGRPCBidiReads.(func() option.ClientOption)() +} diff --git a/vendor/cloud.google.com/go/storage/grpc_client.go b/vendor/cloud.google.com/go/storage/grpc_client.go index 424d2a287a4ec..2d243bf9fe171 100644 --- a/vendor/cloud.google.com/go/storage/grpc_client.go +++ b/vendor/cloud.google.com/go/storage/grpc_client.go @@ -24,12 +24,12 @@ import ( "log" "net/url" "os" + "sync" "cloud.google.com/go/iam/apiv1/iampb" "cloud.google.com/go/internal/trace" gapic "cloud.google.com/go/storage/internal/apiv2" "cloud.google.com/go/storage/internal/apiv2/storagepb" - "github.com/google/uuid" "github.com/googleapis/gax-go/v2" "google.golang.org/api/googleapi" "google.golang.org/api/iterator" @@ -116,6 +116,7 @@ func defaultGRPCOptions() []option.ClientOption { type grpcStorageClient struct { raw *gapic.Client settings *settings + config *storageConfig } func enableClientMetrics(ctx context.Context, s *settings, config storageConfig) (*metricsContext, error) { @@ -166,6 +167,7 @@ func newGRPCStorageClient(ctx context.Context, opts ...storageOption) (storageCl return &grpcStorageClient{ raw: g, settings: s, + config: &config, }, nil } @@ -1010,7 +1012,7 @@ func (c *grpcStorageClient) RewriteObject(ctx context.Context, req *rewriteObjec return r, nil } -// Custom codec to be used for unmarshaling ReadObjectResponse messages. +// Custom codec to be used for unmarshaling BidiReadObjectResponse messages. // This is used to avoid a copy of object data in proto.Unmarshal. type bytesCodecV2 struct { } @@ -1034,7 +1036,7 @@ func (bytesCodecV2) Marshal(v any) (mem.BufferSlice, error) { return data, nil } -// Unmarshal is used for data received for ReadObjectResponse. We want to preserve +// Unmarshal is used for data received for BidiReadObjectResponse. We want to preserve // the mem.BufferSlice in most cases rather than copying and calling proto.Unmarshal. func (bytesCodecV2) Unmarshal(data mem.BufferSlice, v any) error { switch v := v.(type) { @@ -1055,7 +1057,439 @@ func (bytesCodecV2) Name() string { return "" } +func contextMetadataFromBidiReadObject(req *storagepb.BidiReadObjectRequest) []string { + if len(req.GetReadObjectSpec().GetRoutingToken()) > 0 { + return []string{"x-goog-request-params", fmt.Sprintf("bucket=%s&routing_token=%s", req.GetReadObjectSpec().GetBucket(), req.GetReadObjectSpec().GetRoutingToken())} + } + return []string{"x-goog-request-params", fmt.Sprintf("bucket=%s", req.GetReadObjectSpec().GetBucket())} +} + +type rangeSpec struct { + readID int64 + writer io.Writer + offset int64 + limit int64 + bytesWritten int64 + callback func(int64, int64, error) +} + +func (c *grpcStorageClient) NewMultiRangeDownloader(ctx context.Context, params *newMultiRangeDownloaderParams, opts ...storageOption) (mr *MultiRangeDownloader, err error) { + ctx = trace.StartSpan(ctx, "cloud.google.com/go/storage.grpcStorageClient.NewMultiRangeDownloader") + defer func() { trace.EndSpan(ctx, err) }() + s := callSettings(c.settings, opts...) + + if s.userProject != "" { + ctx = setUserProjectMetadata(ctx, s.userProject) + } + + b := bucketResourceName(globalProjectAlias, params.bucket) + object := params.object + r := &storagepb.BidiReadObjectSpec{ + Bucket: b, + Object: object, + CommonObjectRequestParams: toProtoCommonObjectRequestParams(params.encryptionKey), + } + + // The default is a negative value, which means latest. + if params.gen >= 0 { + r.Generation = params.gen + } + + if params.handle != nil { + r.ReadHandle = &storagepb.BidiReadHandle{ + Handle: *params.handle, + } + } + req := &storagepb.BidiReadObjectRequest{ + ReadObjectSpec: r, + } + + ctx = gax.InsertMetadataIntoOutgoingContext(ctx, contextMetadataFromBidiReadObject(req)...) + + openStream := func() (*bidiReadStreamResponse, context.CancelFunc, error) { + if err := applyCondsProto("grpcStorageClient.BidiReadObject", params.gen, params.conds, r); err != nil { + return nil, nil, err + } + var stream storagepb.Storage_BidiReadObjectClient + var resp *storagepb.BidiReadObjectResponse + cc, cancel := context.WithCancel(ctx) + err = run(cc, func(ctx context.Context) error { + stream, err = c.raw.BidiReadObject(ctx, s.gax...) + if err != nil { + // BidiReadObjectRedirectedError error is only returned on initial open in case of a redirect. + // The routing token that should be used when reopening the read stream. Needs to be exported. + rpcStatus := status.Convert(err) + details := rpcStatus.Details() + for _, detail := range details { + if bidiError, ok := detail.(*storagepb.BidiReadObjectRedirectedError); ok { + r.ReadHandle = bidiError.ReadHandle + r.RoutingToken = bidiError.RoutingToken + req.ReadObjectSpec = r + ctx = gax.InsertMetadataIntoOutgoingContext(ctx, contextMetadataFromBidiReadObject(req)...) + } + } + return err + } + // Incase stream opened succesfully, send first message on the stream. + // First message to stream should contain read_object_spec + err = stream.Send(req) + if err != nil { + return err + } + resp, err = stream.Recv() + if err != nil { + return err + } + return nil + }, s.retry, s.idempotent) + if err != nil { + // Close the stream context we just created to ensure we don't leak + // resources. + cancel() + return nil, nil, err + } + return &bidiReadStreamResponse{stream: stream, response: resp}, cancel, nil + } + + // For the first time open stream without adding any range. + resp, cancel, err := openStream() + if err != nil { + return nil, err + } + + // The first message was Recv'd on stream open, use it to populate the + // object metadata. + msg := resp.response + obj := msg.GetMetadata() + // This is the size of the entire object, even if only a range was requested. + size := obj.GetSize() + + rr := &gRPCBidiReader{ + stream: resp.stream, + cancel: cancel, + settings: s, + readHandle: msg.GetReadHandle().GetHandle(), + readID: 1, + reopen: openStream, + readSpec: r, + data: make(chan []rangeSpec, 100), + ctx: ctx, + closeReceiver: make(chan bool, 10), + closeManager: make(chan bool, 10), + managerRetry: make(chan bool), // create unbuffered channel for closing the streamManager goroutine. + receiverRetry: make(chan bool), // create unbuffered channel for closing the streamReceiver goroutine. + mp: make(map[int64]rangeSpec), + done: false, + activeTask: 0, + streamRecreation: false, + } + + // streamManager goroutine runs in background where we send message to gcs and process response. + streamManager := func() { + var currentSpec []rangeSpec + for { + select { + case <-rr.ctx.Done(): + rr.mu.Lock() + rr.done = true + rr.mu.Unlock() + return + case <-rr.managerRetry: + return + case <-rr.closeManager: + rr.mu.Lock() + if len(rr.mp) != 0 { + for key := range rr.mp { + rr.mp[key].callback(rr.mp[key].offset, rr.mp[key].limit, fmt.Errorf("stream closed early")) + delete(rr.mp, key) + } + } + rr.mu.Unlock() + return + case currentSpec = <-rr.data: + var readRanges []*storagepb.ReadRange + var err error + rr.mu.Lock() + for _, v := range currentSpec { + rr.mp[v.readID] = v + readRanges = append(readRanges, &storagepb.ReadRange{ReadOffset: v.offset, ReadLength: v.limit, ReadId: v.readID}) + } + rr.mu.Unlock() + // We can just send 100 request to gcs in one request. + // In case of Add we will send only one range request to gcs but in case of retry we can have more than 100 ranges. + // Hence be will divide the request in chunk of 100. + // For example with 457 ranges on stream we will have 5 request to gcs [0:99], [100:199], [200:299], [300:399], [400:456] + requestCount := len(readRanges) / 100 + if len(readRanges)%100 != 0 { + requestCount++ + } + for i := 0; i < requestCount; i++ { + start := i * 100 + end := (i + 1) * 100 + if end > len(readRanges) { + end = len(readRanges) + } + curReq := readRanges[start:end] + err = rr.stream.Send(&storagepb.BidiReadObjectRequest{ + ReadRanges: curReq, + }) + if err != nil { + // cancel stream and reopen the stream again. + // Incase again an error is thrown close the streamManager goroutine. + rr.retrier(err, "manager") + break + } + } + + } + } + } + + streamReceiver := func() { + var resp *storagepb.BidiReadObjectResponse + var err error + for { + select { + case <-rr.ctx.Done(): + rr.done = true + return + case <-rr.receiverRetry: + return + case <-rr.closeReceiver: + return + default: + // This function reads the data sent for a particular range request and has a callback + // to indicate that output buffer is filled. + resp, err = rr.stream.Recv() + if resp.GetReadHandle().GetHandle() != nil { + rr.readHandle = resp.GetReadHandle().GetHandle() + } + if err == io.EOF { + err = nil + } + if err != nil { + // cancel stream and reopen the stream again. + // Incase again an error is thrown close the streamManager goroutine. + rr.retrier(err, "receiver") + } + + if err == nil { + rr.mu.Lock() + if len(rr.mp) == 0 && rr.activeTask == 0 { + rr.closeReceiver <- true + rr.closeManager <- true + return + } + rr.mu.Unlock() + arr := resp.GetObjectDataRanges() + for _, val := range arr { + id := val.GetReadRange().GetReadId() + rr.mu.Lock() + _, err = rr.mp[id].writer.Write(val.GetChecksummedData().GetContent()) + if err != nil { + rr.mp[id].callback(rr.mp[id].offset, rr.mp[id].limit, err) + rr.activeTask-- + delete(rr.mp, id) + } else { + rr.mp[id] = rangeSpec{ + readID: rr.mp[id].readID, + writer: rr.mp[id].writer, + offset: rr.mp[id].offset, + limit: rr.mp[id].limit, + bytesWritten: rr.mp[id].bytesWritten + int64(len(val.GetChecksummedData().GetContent())), + callback: rr.mp[id].callback, + } + } + if val.GetRangeEnd() { + rr.mp[id].callback(rr.mp[id].offset, rr.mp[id].limit, nil) + rr.activeTask-- + delete(rr.mp, id) + } + rr.mu.Unlock() + } + } + + } + } + } + + rr.retrier = func(err error, thread string) { + rr.mu.Lock() + if !rr.streamRecreation { + rr.streamRecreation = true + } else { + rr.mu.Unlock() + return + } + rr.mu.Unlock() + // close both the go routines to make the stream recreation syncronous. + if thread == "receiver" { + rr.managerRetry <- true + } else { + rr.receiverRetry <- true + } + err = rr.retryStream(err) + if err != nil { + rr.mu.Lock() + for key := range rr.mp { + rr.mp[key].callback(rr.mp[key].offset, rr.mp[key].limit, err) + delete(rr.mp, key) + } + rr.mu.Unlock() + rr.close() + } else { + // If stream recreation happened successfully lets again start + // both the goroutine making the whole flow asynchronous again. + if thread == "receiver" { + go streamManager() + } else { + go streamReceiver() + } + } + rr.mu.Lock() + rr.streamRecreation = false + rr.mu.Unlock() + } + + rr.mu.Lock() + rr.objectSize = size + rr.mu.Unlock() + + go streamManager() + go streamReceiver() + + return &MultiRangeDownloader{ + Attrs: ReaderObjectAttrs{ + Size: size, + ContentType: obj.GetContentType(), + ContentEncoding: obj.GetContentEncoding(), + CacheControl: obj.GetCacheControl(), + LastModified: obj.GetUpdateTime().AsTime(), + Metageneration: obj.GetMetageneration(), + Generation: obj.GetGeneration(), + }, + reader: rr, + }, nil +} + +func getActiveRange(r *gRPCBidiReader) []rangeSpec { + r.mu.Lock() + defer r.mu.Unlock() + var activeRange []rangeSpec + for k, v := range r.mp { + activeRange = append(activeRange, rangeSpec{ + readID: k, + writer: v.writer, + offset: (v.offset + v.bytesWritten), + limit: v.limit - v.bytesWritten, + callback: v.callback, + bytesWritten: 0, + }) + r.mp[k] = activeRange[len(activeRange)-1] + } + return activeRange +} + +// retryStream cancel's stream and reopen the stream again. +func (r *gRPCBidiReader) retryStream(err error) error { + var shouldRetry = ShouldRetry + if r.settings.retry != nil && r.settings.retry.shouldRetry != nil { + shouldRetry = r.settings.retry.shouldRetry + } + if shouldRetry(err) { + // This will "close" the existing stream and immediately attempt to + // reopen the stream, but will backoff if further attempts are necessary. + // When Reopening the stream only failed readID will be added to stream. + return r.reopenStream(getActiveRange(r)) + } + return err +} + +// reopenStream "closes" the existing stream and attempts to reopen a stream and +// sets the Reader's stream and cancelStream properties in the process. +func (r *gRPCBidiReader) reopenStream(failSpec []rangeSpec) error { + // Close existing stream and initialize new stream with updated offset. + if r.cancel != nil { + r.cancel() + } + + res, cancel, err := r.reopen() + if err != nil { + return err + } + r.stream = res.stream + r.cancel = cancel + r.readHandle = res.response.GetReadHandle().GetHandle() + if failSpec != nil { + r.data <- failSpec + } + return nil +} + +// Add will add current range to stream. +func (mr *gRPCBidiReader) add(output io.Writer, offset, limit int64, callback func(int64, int64, error)) { + mr.mu.Lock() + objectSize := mr.objectSize + mr.mu.Unlock() + + if offset > objectSize { + callback(offset, limit, fmt.Errorf("offset larger than size of object: %v", objectSize)) + return + } + if limit < 0 { + callback(offset, limit, fmt.Errorf("limit can't be negative")) + return + } + mr.mu.Lock() + curentID := (*mr).readID + (*mr).readID++ + if !mr.done { + spec := rangeSpec{readID: curentID, writer: output, offset: offset, limit: limit, bytesWritten: 0, callback: callback} + mr.mp[curentID] = spec + mr.activeTask++ + mr.data <- []rangeSpec{spec} + } else { + callback(offset, limit, fmt.Errorf("stream is closed, can't add range")) + } + mr.mu.Unlock() +} + +func (mr *gRPCBidiReader) wait() { + mr.mu.Lock() + keepWaiting := len(mr.mp) != 0 && mr.activeTask != 0 + mr.mu.Unlock() + + for keepWaiting { + mr.mu.Lock() + keepWaiting = len(mr.mp) != 0 && mr.activeTask != 0 + mr.mu.Unlock() + } +} + +// Close will notify stream manager goroutine that the reader has been closed, if it's still running. +func (mr *gRPCBidiReader) close() error { + if mr.cancel != nil { + mr.cancel() + } + mr.mu.Lock() + mr.done = true + mr.activeTask = 0 + mr.mu.Unlock() + mr.closeReceiver <- true + mr.closeManager <- true + return nil +} + +func (mrr *gRPCBidiReader) getHandle() []byte { + return mrr.readHandle +} + func (c *grpcStorageClient) NewRangeReader(ctx context.Context, params *newRangeReaderParams, opts ...storageOption) (r *Reader, err error) { + // If bidi reads was not selected, use the legacy read object API. + if !c.config.grpcBidiReads { + return c.NewRangeReaderReadObject(ctx, params, opts...) + } + ctx = trace.StartSpan(ctx, "cloud.google.com/go/storage.grpcStorageClient.NewRangeReader") defer func() { trace.EndSpan(ctx, err) }() @@ -1070,15 +1504,25 @@ func (c *grpcStorageClient) NewRangeReader(ctx context.Context, params *newRange } b := bucketResourceName(globalProjectAlias, params.bucket) - req := &storagepb.ReadObjectRequest{ + + // Create a BidiReadObjectRequest. + spec := &storagepb.BidiReadObjectSpec{ Bucket: b, Object: params.object, CommonObjectRequestParams: toProtoCommonObjectRequestParams(params.encryptionKey), } - // The default is a negative value, which means latest. - if params.gen >= 0 { - req.Generation = params.gen + if err := applyCondsProto("gRPCReader.NewRangeReader", params.gen, params.conds, spec); err != nil { + return nil, err + } + if params.handle != nil { + spec.ReadHandle = &storagepb.BidiReadHandle{ + Handle: *params.handle, + } } + req := &storagepb.BidiReadObjectRequest{ + ReadObjectSpec: spec, + } + ctx = gax.InsertMetadataIntoOutgoingContext(ctx, contextMetadataFromBidiReadObject(req)...) // Define a function that initiates a Read with offset and length, assuming // we have already read seen bytes. @@ -1091,35 +1535,43 @@ func (c *grpcStorageClient) NewRangeReader(ctx context.Context, params *newRange cc, cancel := context.WithCancel(ctx) - req.ReadOffset = params.offset + seen + // BidiReadObject can take multiple ranges, but we just request one in this case. + readRange := &storagepb.ReadRange{ + ReadOffset: params.offset + seen, + ReadId: 1, + } - // Only set a ReadLimit if length is greater than zero, because <= 0 means + // Only set a ReadLength if length is greater than zero, because <= 0 means // to read it all. if params.length > 0 { - req.ReadLimit = params.length - seen + readRange.ReadLength = params.length - seen } - if err := applyCondsProto("gRPCReader.reopen", params.gen, params.conds, req); err != nil { - cancel() - return nil, nil, err - } + req.ReadRanges = []*storagepb.ReadRange{readRange} - var stream storagepb.Storage_ReadObjectClient + var stream storagepb.Storage_BidiReadObjectClient var err error var decoder *readResponseDecoder err = run(cc, func(ctx context.Context) error { - stream, err = c.raw.ReadObject(ctx, req, s.gax...) + stream, err = c.raw.BidiReadObject(ctx, s.gax...) if err != nil { return err } + if err := stream.Send(req); err != nil { + return err + } + // Oneshot reads can close the client->server side immediately. + if err := stream.CloseSend(); err != nil { + return err + } // Receive the message into databuf as a wire-encoded message so we can // use a custom decoder to avoid an extra copy at the protobuf layer. databufs := mem.BufferSlice{} err := stream.RecvMsg(&databufs) - // These types of errors show up on the Recv call, rather than the - // initialization of the stream via ReadObject above. + // These types of errors show up on the RecvMsg call, rather than the + // initialization of the stream via BidiReadObject above. if s, ok := status.FromError(err); ok && s.Code() == codes.NotFound { return ErrObjectNotExist } @@ -1146,18 +1598,21 @@ func (c *grpcStorageClient) NewRangeReader(ctx context.Context, params *newRange return nil, nil, err } - return &readStreamResponse{stream, decoder}, cancel, nil + return &readStreamResponse{ + stream: stream, + decoder: decoder, + }, cancel, nil } res, cancel, err := reopen(0) if err != nil { return nil, err } - // The first message was Recv'd on stream open, use it to populate the - // object metadata. + // object metadata and read handle. msg := res.decoder.msg obj := msg.GetMetadata() + handle := ReadHandle(msg.GetReadHandle().GetHandle()) // This is the size of the entire object, even if only a range was requested. size := obj.GetSize() @@ -1166,17 +1621,33 @@ func (c *grpcStorageClient) NewRangeReader(ctx context.Context, params *newRange wantCRC uint32 checkCRC bool ) - if checksums := msg.GetObjectChecksums(); checksums != nil && checksums.Crc32C != nil { + if checksums := obj.GetChecksums(); checksums != nil && checksums.Crc32C != nil { if params.offset == 0 && params.length < 0 { checkCRC = true } wantCRC = checksums.GetCrc32C() } + startOffset := params.offset + if params.offset < 0 { + startOffset = size + params.offset + } + + // The remaining bytes are the lesser of the requested range and all bytes + // after params.offset. + length := params.length + if params.length > size || params.length < 0 { + // if params.length < 0 (or larger than object size), + // all remaining bytes were requested. + length = size + } + remain := length - startOffset + metadata := obj.GetMetadata() r = &Reader{ Attrs: ReaderObjectAttrs{ Size: size, + StartOffset: startOffset, ContentType: obj.GetContentType(), ContentEncoding: obj.GetContentEncoding(), CacheControl: obj.GetCacheControl(), @@ -1199,14 +1670,8 @@ func (c *grpcStorageClient) NewRangeReader(ctx context.Context, params *newRange checkCRC: checkCRC, }, checkCRC: checkCRC, - } - - cr := msg.GetContentRange() - if cr != nil { - r.Attrs.StartOffset = cr.GetStart() - r.remain = cr.GetEnd() - cr.GetStart() - } else { - r.remain = size + handle: &handle, + remain: remain, } // For a zero-length request, explicitly close the stream and set remaining @@ -1220,87 +1685,66 @@ func (c *grpcStorageClient) NewRangeReader(ctx context.Context, params *newRange } func (c *grpcStorageClient) OpenWriter(params *openWriterParams, opts ...storageOption) (*io.PipeWriter, error) { - s := callSettings(c.settings, opts...) - var offset int64 errorf := params.setError - progress := params.progress setObj := params.setObj - pr, pw := io.Pipe() - gw := newGRPCWriter(c, params, pr) - gw.settings = s - if s.userProject != "" { - gw.ctx = setUserProjectMetadata(gw.ctx, s.userProject) - } + + s := callSettings(c.settings, opts...) // This function reads the data sent to the pipe and sends sets of messages // on the gRPC client-stream as the buffer is filled. go func() { - defer close(params.donec) + err := func() error { + // Unless the user told us the content type, we have to determine it from + // the first read. + var r io.Reader = pr + if params.attrs.ContentType == "" && !params.forceEmptyContentType { + r, params.attrs.ContentType = gax.DetermineContentType(r) + } - // Loop until there is an error or the Object has been finalized. - for { - // Note: This blocks until either the buffer is full or EOF is read. - recvd, doneReading, err := gw.read() + var gw *gRPCWriter + gw, err := newGRPCWriter(c, s, params, r) if err != nil { - err = checkCanceled(err) - errorf(err) - pr.CloseWithError(err) - return + return err } - if params.attrs.Retention != nil { - // TO-DO: remove once ObjectRetention is available - see b/308194853 - err = status.Errorf(codes.Unimplemented, "storage: object retention is not supported in gRPC") - errorf(err) - pr.CloseWithError(err) - return - } - // The chunk buffer is full, but there is no end in sight. This - // means that either: - // 1. A resumable upload will need to be used to send - // multiple chunks, until we are done reading data. Start a - // resumable upload if it has not already been started. - // 2. ChunkSize of zero may also have a full buffer, but a resumable - // session should not be initiated in this case. - if !doneReading && gw.upid == "" && params.chunkSize != 0 { - err = gw.startResumableUpload() + // Loop until there is an error or the Object has been finalized. + for { + // Note: This blocks until either the buffer is full or EOF is read. + recvd, doneReading, err := gw.read() if err != nil { - err = checkCanceled(err) - errorf(err) - pr.CloseWithError(err) - return + return err } - } - o, off, err := gw.uploadBuffer(recvd, offset, doneReading, newUploadBufferRetryConfig(gw.settings)) - if err != nil { - err = checkCanceled(err) - errorf(err) - pr.CloseWithError(err) - return - } + var o *storagepb.Object + uploadBuff := func(ctx context.Context) error { + obj, err := gw.uploadBuffer(recvd, offset, doneReading) + o = obj + return err + } - // At this point, the current buffer has been uploaded. For resumable - // uploads and chunkSize = 0, capture the committed offset here in case - // the upload was not finalized and another chunk is to be uploaded. Call - // the progress function for resumable uploads only. - if gw.upid != "" || gw.chunkSize == 0 { - offset = off - } - if gw.upid != "" { - progress(offset) + err = run(gw.ctx, uploadBuff, gw.settings.retry, s.idempotent) + if err != nil { + return err + } + offset += int64(recvd) + + // When we are done reading data without errors, set the object and + // finish. + if doneReading { + // Build Object from server's response. + setObj(newObjectFromProto(o)) + return nil + } } + }() - // When we are done reading data without errors, set the object and - // finish. - if doneReading { - // Build Object from server's response. - setObj(newObjectFromProto(o)) - return - } - } + // These calls are still valid if err is nil + err = checkCanceled(err) + errorf(err) + pr.CloseWithError(err) + close(params.donec) }() return pw, nil @@ -1420,14 +1864,43 @@ func setUserProjectMetadata(ctx context.Context, project string) context.Context } type readStreamResponse struct { - stream storagepb.Storage_ReadObjectClient + stream storagepb.Storage_BidiReadObjectClient decoder *readResponseDecoder } +type bidiReadStreamResponse struct { + stream storagepb.Storage_BidiReadObjectClient + response *storagepb.BidiReadObjectResponse +} + +type gRPCBidiReader struct { + stream storagepb.Storage_BidiReadObjectClient + cancel context.CancelFunc + settings *settings + readHandle ReadHandle + readID int64 + reopen func() (*bidiReadStreamResponse, context.CancelFunc, error) + readSpec *storagepb.BidiReadObjectSpec + data chan []rangeSpec + ctx context.Context + closeReceiver chan bool + closeManager chan bool + managerRetry chan bool + receiverRetry chan bool + mu sync.Mutex // protects all vars in gRPCBidiReader from concurrent access + mp map[int64]rangeSpec // always use the mutex when accessing the map + done bool // always use the mutex when accessing this variable + activeTask int64 // always use the mutex when accessing this variable + objectSize int64 // always use the mutex when accessing this variable + retrier func(error, string) + streamRecreation bool // This helps us identify if stream recreation is in progress or not. If stream recreation gets called from two goroutine then this will stop second one. +} + +// gRPCReader is used by storage.Reader if the experimental option WithGRPCBidiReads is passed. type gRPCReader struct { seen, size int64 zeroRange bool - stream storagepb.Storage_ReadObjectClient + stream storagepb.Storage_BidiReadObjectClient reopen func(seen int64) (*readStreamResponse, context.CancelFunc, error) leftovers []byte currMsg *readResponseDecoder // decoder for the current message @@ -1581,7 +2054,6 @@ func (r *gRPCReader) Close() error { if r.cancel != nil { r.cancel() } - r.stream = nil r.currMsg = nil return nil } @@ -1597,10 +2069,10 @@ func (r *gRPCReader) Close() error { // // The last error received is the one that is returned, which could be from // an attempt to reopen the stream. + func (r *gRPCReader) recv() error { databufs := mem.BufferSlice{} err := r.stream.RecvMsg(&databufs) - var shouldRetry = ShouldRetry if r.settings.retry != nil && r.settings.retry.shouldRetry != nil { shouldRetry = r.settings.retry.shouldRetry @@ -1623,12 +2095,17 @@ func (r *gRPCReader) recv() error { // ReadObjectResponse field and subfield numbers. const ( - checksummedDataField = protowire.Number(1) + // Top level fields. + metadataField = protowire.Number(4) + objectRangeDataField = protowire.Number(6) + readHandleField = protowire.Number(7) + // Nested in ObjectRangeData + checksummedDataField = protowire.Number(1) + readRangeField = protowire.Number(2) + rangeEndField = protowire.Number(3) + // Nested in ObjectRangeData.ChecksummedData checksummedDataContentField = protowire.Number(1) checksummedDataCRC32CField = protowire.Number(2) - objectChecksumsField = protowire.Number(2) - contentRangeField = protowire.Number(3) - metadataField = protowire.Number(4) ) // readResponseDecoder is a wrapper on the raw message, used to decode one message @@ -1641,9 +2118,9 @@ type readResponseDecoder struct { currBuf int // index of the current buffer being processed currOff uint64 // offset in the current buffer // Processed data - msg *storagepb.ReadObjectResponse // processed response message with all fields other than object data populated - dataOffsets bufferSliceOffsets // offsets of the object data in the message. - done bool // true if the data has been completely read. + msg *storagepb.BidiReadObjectResponse // processed response message with all fields other than object data populated + dataOffsets bufferSliceOffsets // offsets of the object data in the message. + done bool // true if the data has been completely read. } type bufferSliceOffsets struct { @@ -1924,15 +2401,15 @@ func (d *readResponseDecoder) consumeBytesCopy() ([]byte, error) { return b, nil } -// readFullObjectResponse returns the ReadObjectResponse that is encoded in the +// readFullObjectResponse returns the BidiReadObjectResponse that is encoded in the // wire-encoded message buffer b, or an error if the message is invalid. // This must be used on the first recv of an object as it may contain all fields -// of ReadObjectResponse, and we use or pass on those fields to the user. +// of BidiReadObjectResponse, and we use or pass on those fields to the user. // This function is essentially identical to proto.Unmarshal, except it aliases // the data in the input []byte. If the proto library adds a feature to // Unmarshal that does that, this function can be dropped. func (d *readResponseDecoder) readFullObjectResponse() error { - msg := &storagepb.ReadObjectResponse{} + msg := &storagepb.BidiReadObjectResponse{} // Loop over the entire message, extracting fields as we go. This does not // handle field concatenation, in which the contents of a single field @@ -1946,82 +2423,105 @@ func (d *readResponseDecoder) readFullObjectResponse() error { // Unmarshal the field according to its type. Only fields that are not // nil will be present. switch { - case fieldNum == checksummedDataField && fieldType == protowire.BytesType: - // The ChecksummedData field was found. Initialize the struct. - msg.ChecksummedData = &storagepb.ChecksummedData{} - + // This is a repeated field, so it can occur more than once. But, for now + // we can just take the first range per message since Reader only requests + // a single range. + // See https://protobuf.dev/programming-guides/encoding/#optional + // TODO: support multiple ranges once integrated with MultiRangeDownloader. + case fieldNum == objectRangeDataField && fieldType == protowire.BytesType: + // The object data field was found. Initialize the data ranges assuming + // exactly one range in the message. + msg.ObjectDataRanges = []*storagepb.ObjectRangeData{{ChecksummedData: &storagepb.ChecksummedData{}, ReadRange: &storagepb.ReadRange{}}} bytesFieldLen, err := d.consumeVarint() if err != nil { return fmt.Errorf("consuming bytes: %v", err) } - var contentEndOff = d.off + bytesFieldLen for d.off < contentEndOff { gotNum, gotTyp, err := d.consumeTag() if err != nil { - return fmt.Errorf("consuming checksummedData tag: %w", err) + return fmt.Errorf("consuming objectRangeData tag: %w", err) } switch { - case gotNum == checksummedDataContentField && gotTyp == protowire.BytesType: - // Get the offsets of the content bytes. - d.dataOffsets, err = d.consumeBytes() + case gotNum == checksummedDataField && gotTyp == protowire.BytesType: + checksummedDataFieldLen, err := d.consumeVarint() if err != nil { - return fmt.Errorf("invalid ReadObjectResponse.ChecksummedData.Content: %w", err) + return fmt.Errorf("consuming bytes: %v", err) + } + var checksummedDataEndOff = d.off + checksummedDataFieldLen + for d.off < checksummedDataEndOff { + gotNum, gotTyp, err := d.consumeTag() + if err != nil { + return fmt.Errorf("consuming checksummedData tag: %w", err) + } + switch { + case gotNum == checksummedDataContentField && gotTyp == protowire.BytesType: + // Get the offsets of the content bytes. + d.dataOffsets, err = d.consumeBytes() + if err != nil { + return fmt.Errorf("invalid BidiReadObjectResponse.ChecksummedData.Content: %w", err) + } + case gotNum == checksummedDataCRC32CField && gotTyp == protowire.Fixed32Type: + v, err := d.consumeFixed32() + if err != nil { + return fmt.Errorf("invalid BidiReadObjectResponse.ChecksummedData.Crc32C: %w", err) + } + msg.ObjectDataRanges[0].ChecksummedData.Crc32C = &v + default: + err := d.consumeFieldValue(gotNum, gotTyp) + if err != nil { + return fmt.Errorf("invalid field in BidiReadObjectResponse.ChecksummedData: %w", err) + } + } } - case gotNum == checksummedDataCRC32CField && gotTyp == protowire.Fixed32Type: - v, err := d.consumeFixed32() + case gotNum == readRangeField && gotTyp == protowire.BytesType: + buf, err := d.consumeBytesCopy() if err != nil { - return fmt.Errorf("invalid ReadObjectResponse.ChecksummedData.Crc32C: %w", err) + return fmt.Errorf("invalid ObjectDataRange.ReadRange: %v", err) + } + + if err := proto.Unmarshal(buf, msg.ObjectDataRanges[0].ReadRange); err != nil { + return err } - msg.ChecksummedData.Crc32C = &v - default: - err := d.consumeFieldValue(gotNum, gotTyp) + case gotNum == rangeEndField && gotTyp == protowire.VarintType: // proto encodes bool as int32 + b, err := d.consumeVarint() if err != nil { - return fmt.Errorf("invalid field in ReadObjectResponse.ChecksummedData: %w", err) + return fmt.Errorf("invalid ObjectDataRange.RangeEnd: %w", err) } + msg.ObjectDataRanges[0].RangeEnd = protowire.DecodeBool(b) } + } - case fieldNum == objectChecksumsField && fieldType == protowire.BytesType: - // The field was found. Initialize the struct. - msg.ObjectChecksums = &storagepb.ObjectChecksums{} - // Consume the bytes and copy them into a single buffer if they are split across buffers. - buf, err := d.consumeBytesCopy() - if err != nil { - return fmt.Errorf("invalid ReadObjectResponse.ObjectChecksums: %v", err) - } - // Unmarshal. - if err := proto.Unmarshal(buf, msg.ObjectChecksums); err != nil { - return err - } - case fieldNum == contentRangeField && fieldType == protowire.BytesType: - msg.ContentRange = &storagepb.ContentRange{} + case fieldNum == metadataField && fieldType == protowire.BytesType: + msg.Metadata = &storagepb.Object{} buf, err := d.consumeBytesCopy() if err != nil { - return fmt.Errorf("invalid ReadObjectResponse.ContentRange: %v", err) + return fmt.Errorf("invalid BidiReadObjectResponse.Metadata: %v", err) } - if err := proto.Unmarshal(buf, msg.ContentRange); err != nil { + + if err := proto.Unmarshal(buf, msg.Metadata); err != nil { return err } - case fieldNum == metadataField && fieldType == protowire.BytesType: - msg.Metadata = &storagepb.Object{} - + case fieldNum == readHandleField && fieldType == protowire.BytesType: + msg.ReadHandle = &storagepb.BidiReadHandle{} buf, err := d.consumeBytesCopy() if err != nil { - return fmt.Errorf("invalid ReadObjectResponse.Metadata: %v", err) + return fmt.Errorf("invalid BidiReadObjectResponse.ReadHandle: %v", err) } - if err := proto.Unmarshal(buf, msg.Metadata); err != nil { + if err := proto.Unmarshal(buf, msg.ReadHandle); err != nil { return err } default: err := d.consumeFieldValue(fieldNum, fieldType) if err != nil { - return fmt.Errorf("invalid field in ReadObjectResponse: %w", err) + return fmt.Errorf("invalid field in BidiReadObjectResponse: %w", err) } } } d.msg = msg + return nil } @@ -2041,19 +2541,36 @@ func (r *gRPCReader) reopenStream() error { return nil } -func newGRPCWriter(c *grpcStorageClient, params *openWriterParams, r io.Reader) *gRPCWriter { - size := params.chunkSize +func newGRPCWriter(c *grpcStorageClient, s *settings, params *openWriterParams, r io.Reader) (*gRPCWriter, error) { + if params.attrs.Retention != nil { + // TO-DO: remove once ObjectRetention is available - see b/308194853 + return nil, status.Errorf(codes.Unimplemented, "storage: object retention is not supported in gRPC") + } + + size := googleapi.MinUploadChunkSize + // A completely bufferless upload (params.chunkSize <= 0) is not possible in + // gRPC because the buffer must be provided to the message. Use the minimum + // size possible. + if params.chunkSize > 0 { + size = params.chunkSize + } // Round up chunksize to nearest 256KiB if size%googleapi.MinUploadChunkSize != 0 { size += googleapi.MinUploadChunkSize - (size % googleapi.MinUploadChunkSize) } - // A completely bufferless upload is not possible as it is in JSON because - // the buffer must be provided to the message. However use the minimum size - // possible in this case. - if params.chunkSize == 0 { - size = googleapi.MinUploadChunkSize + if s.userProject != "" { + params.ctx = setUserProjectMetadata(params.ctx, s.userProject) + } + + spec := &storagepb.WriteObjectSpec{ + Resource: params.attrs.toProtoObject(params.bucket), + Appendable: proto.Bool(params.append), + } + // WriteObject doesn't support the generation condition, so use default. + if err := applyCondsProto("WriteObject", defaultGen, params.conds, spec); err != nil { + return nil, err } return &gRPCWriter{ @@ -2064,11 +2581,15 @@ func newGRPCWriter(c *grpcStorageClient, params *openWriterParams, r io.Reader) bucket: params.bucket, attrs: params.attrs, conds: params.conds, + spec: spec, encryptionKey: params.encryptionKey, + settings: s, + progress: params.progress, sendCRC32C: params.sendCRC32C, - chunkSize: params.chunkSize, + forceOneShot: params.chunkSize <= 0, forceEmptyContentType: params.forceEmptyContentType, - } + append: params.append, + }, nil } // gRPCWriter is a wrapper around the the gRPC client-stream API that manages @@ -2083,328 +2604,327 @@ type gRPCWriter struct { bucket string attrs *ObjectAttrs conds *Conditions + spec *storagepb.WriteObjectSpec encryptionKey []byte settings *settings + progress func(int64) sendCRC32C bool - chunkSize int + forceOneShot bool forceEmptyContentType bool + append bool - // The gRPC client-stream used for sending buffers. - stream storagepb.Storage_BidiWriteObjectClient + streamSender gRPCBidiWriteBufferSender +} - // The Resumable Upload ID started by a gRPC-based Writer. - upid string +func bucketContext(ctx context.Context, bucket string) context.Context { + hds := []string{"x-goog-request-params", fmt.Sprintf("bucket=projects/_/buckets/%s", url.QueryEscape(bucket))} + return gax.InsertMetadataIntoOutgoingContext(ctx, hds...) } -// startResumableUpload initializes a Resumable Upload with gRPC and sets the -// upload ID on the Writer. -func (w *gRPCWriter) startResumableUpload() error { - spec, err := w.writeObjectSpec() - if err != nil { - return err +// drainInboundStream calls stream.Recv() repeatedly until an error is returned. +// It returns the last Resource received on the stream, or nil if no Resource +// was returned. drainInboundStream always returns a non-nil error. io.EOF +// indicates all messages were successfully read. +func drainInboundStream(stream storagepb.Storage_BidiWriteObjectClient) (object *storagepb.Object, err error) { + for err == nil { + var resp *storagepb.BidiWriteObjectResponse + resp, err = stream.Recv() + // GetResource() returns nil on a nil response + if resp.GetResource() != nil { + object = resp.GetResource() + } } + return object, err +} + +func bidiWriteObjectRequest(buf []byte, offset int64, flush, finishWrite bool) *storagepb.BidiWriteObjectRequest { + return &storagepb.BidiWriteObjectRequest{ + Data: &storagepb.BidiWriteObjectRequest_ChecksummedData{ + ChecksummedData: &storagepb.ChecksummedData{ + Content: buf, + }, + }, + WriteOffset: offset, + FinishWrite: finishWrite, + Flush: flush, + StateLookup: flush, + } +} + +type gRPCBidiWriteBufferSender interface { + // sendBuffer implementations should upload buf, respecting flush and + // finishWrite. Callers must guarantee that buf is not too long to fit in a + // gRPC message. + // + // If flush is true, implementations must not return until the data in buf is + // stable. If finishWrite is true, implementations must return the object on + // success. + sendBuffer(buf []byte, offset int64, flush, finishWrite bool) (*storagepb.Object, error) +} + +type gRPCOneshotBidiWriteBufferSender struct { + ctx context.Context + firstMessage *storagepb.BidiWriteObjectRequest + raw *gapic.Client + stream storagepb.Storage_BidiWriteObjectClient + settings *settings +} + +func (w *gRPCWriter) newGRPCOneshotBidiWriteBufferSender() (*gRPCOneshotBidiWriteBufferSender, error) { + firstMessage := &storagepb.BidiWriteObjectRequest{ + FirstMessage: &storagepb.BidiWriteObjectRequest_WriteObjectSpec{ + WriteObjectSpec: w.spec, + }, + CommonObjectRequestParams: toProtoCommonObjectRequestParams(w.encryptionKey), + // For a non-resumable upload, checksums must be sent in this message. + // TODO: Currently the checksums are only sent on the first message + // of the stream, but in the future, we must also support sending it + // on the *last* message of the stream (instead of the first). + ObjectChecksums: toProtoChecksums(w.sendCRC32C, w.attrs), + } + + return &gRPCOneshotBidiWriteBufferSender{ + ctx: bucketContext(w.ctx, w.bucket), + firstMessage: firstMessage, + raw: w.c.raw, + settings: w.settings, + }, nil +} + +func (s *gRPCOneshotBidiWriteBufferSender) sendBuffer(buf []byte, offset int64, flush, finishWrite bool) (obj *storagepb.Object, err error) { + var firstMessage *storagepb.BidiWriteObjectRequest + if s.stream == nil { + s.stream, err = s.raw.BidiWriteObject(s.ctx, s.settings.gax...) + if err != nil { + return + } + firstMessage = s.firstMessage + } + req := bidiWriteObjectRequest(buf, offset, flush, finishWrite) + if firstMessage != nil { + proto.Merge(req, firstMessage) + } + + sendErr := s.stream.Send(req) + if sendErr != nil { + obj, err = drainInboundStream(s.stream) + s.stream = nil + if sendErr != io.EOF { + err = sendErr + } + return + } + // Oneshot uploads assume all flushes succeed + + if finishWrite { + s.stream.CloseSend() + // Oneshot uploads only read from the response stream on completion or + // failure + obj, err = drainInboundStream(s.stream) + s.stream = nil + if err == io.EOF { + err = nil + } + } + return +} + +type gRPCResumableBidiWriteBufferSender struct { + ctx context.Context + queryRetry *retryConfig + upid string + progress func(int64) + raw *gapic.Client + forceFirstMessage bool + stream storagepb.Storage_BidiWriteObjectClient + flushOffset int64 + settings *settings +} + +func (w *gRPCWriter) newGRPCResumableBidiWriteBufferSender() (*gRPCResumableBidiWriteBufferSender, error) { req := &storagepb.StartResumableWriteRequest{ - WriteObjectSpec: spec, + WriteObjectSpec: w.spec, CommonObjectRequestParams: toProtoCommonObjectRequestParams(w.encryptionKey), + // TODO: Currently the checksums are only sent on the request to initialize + // the upload, but in the future, we must also support sending it + // on the *last* message of the stream. + ObjectChecksums: toProtoChecksums(w.sendCRC32C, w.attrs), } - // TODO: Currently the checksums are only sent on the request to initialize - // the upload, but in the future, we must also support sending it - // on the *last* message of the stream. - req.ObjectChecksums = toProtoChecksums(w.sendCRC32C, w.attrs) - return run(w.ctx, func(ctx context.Context) error { - upres, err := w.c.raw.StartResumableWrite(w.ctx, req) - w.upid = upres.GetUploadId() + + ctx := bucketContext(w.ctx, w.bucket) + var upid string + err := run(ctx, func(ctx context.Context) error { + upres, err := w.c.raw.StartResumableWrite(ctx, req, w.settings.gax...) + upid = upres.GetUploadId() return err }, w.settings.retry, w.settings.idempotent) + if err != nil { + return nil, err + } + + // Set up an initial connection for the 0 offset, so we don't query state + // unnecessarily for the first buffer. If we fail, we'll just retry in the + // normal connect path. + stream, err := w.c.raw.BidiWriteObject(ctx, w.settings.gax...) + if err != nil { + stream = nil + } + + return &gRPCResumableBidiWriteBufferSender{ + ctx: ctx, + queryRetry: w.settings.retry, + upid: upid, + progress: w.progress, + raw: w.c.raw, + forceFirstMessage: true, + stream: stream, + settings: w.settings, + }, nil } // queryProgress is a helper that queries the status of the resumable upload // associated with the given upload ID. -func (w *gRPCWriter) queryProgress() (int64, error) { +func (s *gRPCResumableBidiWriteBufferSender) queryProgress() (int64, error) { var persistedSize int64 - err := run(w.ctx, func(ctx context.Context) error { - q, err := w.c.raw.QueryWriteStatus(w.ctx, &storagepb.QueryWriteStatusRequest{ - UploadId: w.upid, - }) + err := run(s.ctx, func(ctx context.Context) error { + q, err := s.raw.QueryWriteStatus(ctx, &storagepb.QueryWriteStatusRequest{ + UploadId: s.upid, + }, s.settings.gax...) + // q.GetPersistedSize() will return 0 if q is nil. persistedSize = q.GetPersistedSize() return err - }, w.settings.retry, true) + }, s.queryRetry, true) - // q.GetCommittedSize() will return 0 if q is nil. return persistedSize, err } -// uploadBuffer uploads the buffer at the given offset using a bi-directional -// Write stream. It will open a new stream if necessary (on the first call or -// after resuming from failure). The resulting write offset after uploading the -// buffer is returned, as well as well as the final Object if the upload is -// completed. -// -// Returns object, persisted size, and any error that is not retriable. -func (w *gRPCWriter) uploadBuffer(recvd int, start int64, doneReading bool, retryConfig *uploadBufferRetryConfig) (*storagepb.Object, int64, error) { - var err error - var lastWriteOfEntireObject bool - - sent := 0 - writeOffset := start - - toWrite := w.buf[:recvd] - - // Send a request with as many bytes as possible. - // Loop until all bytes are sent. -sendBytes: // label this loop so that we can use a continue statement from a nested block - for { - bytesNotYetSent := recvd - sent - remainingDataFitsInSingleReq := bytesNotYetSent <= maxPerMessageWriteSize - - if remainingDataFitsInSingleReq && doneReading { - lastWriteOfEntireObject = true +func (s *gRPCResumableBidiWriteBufferSender) sendBuffer(buf []byte, offset int64, flush, finishWrite bool) (obj *storagepb.Object, err error) { + reconnected := false + if s.stream == nil { + // Determine offset and reconnect + s.flushOffset, err = s.queryProgress() + if err != nil { + return } - - // Send the maximum amount of bytes we can, unless we don't have that many. - bytesToSendInCurrReq := maxPerMessageWriteSize - if remainingDataFitsInSingleReq { - bytesToSendInCurrReq = bytesNotYetSent + s.stream, err = s.raw.BidiWriteObject(s.ctx, s.settings.gax...) + if err != nil { + return } + reconnected = true + } - // Prepare chunk section for upload. - data := toWrite[sent : sent+bytesToSendInCurrReq] - - req := &storagepb.BidiWriteObjectRequest{ - Data: &storagepb.BidiWriteObjectRequest_ChecksummedData{ - ChecksummedData: &storagepb.ChecksummedData{ - Content: data, - }, - }, - WriteOffset: writeOffset, - FinishWrite: lastWriteOfEntireObject, - Flush: remainingDataFitsInSingleReq && !lastWriteOfEntireObject, - StateLookup: remainingDataFitsInSingleReq && !lastWriteOfEntireObject, + // clean up buf. We'll still write the message if a flush/finishWrite was + // requested. + if offset < s.flushOffset { + trim := s.flushOffset - offset + if int64(len(buf)) <= trim { + trim = int64(len(buf)) } + buf = buf[trim:] + } + if len(buf) == 0 && !flush && !finishWrite { + // no need to send anything + return nil, nil + } - // Open a new stream if necessary and set the first_message field on - // the request. The first message on the WriteObject stream must either - // be the Object or the Resumable Upload ID. - if w.stream == nil { - hds := []string{"x-goog-request-params", fmt.Sprintf("bucket=projects/_/buckets/%s", url.QueryEscape(w.bucket))} - ctx := gax.InsertMetadataIntoOutgoingContext(w.ctx, hds...) - ctx = setInvocationHeaders(ctx, retryConfig.invocationID, retryConfig.attempts) - - w.stream, err = w.c.raw.BidiWriteObject(ctx) - if err != nil { - return nil, 0, err - } + req := bidiWriteObjectRequest(buf, offset, flush, finishWrite) + if s.forceFirstMessage || reconnected { + req.FirstMessage = &storagepb.BidiWriteObjectRequest_UploadId{UploadId: s.upid} + s.forceFirstMessage = false + } - if w.upid != "" { // resumable upload - req.FirstMessage = &storagepb.BidiWriteObjectRequest_UploadId{UploadId: w.upid} - } else { // non-resumable - spec, err := w.writeObjectSpec() - if err != nil { - return nil, 0, err - } - req.FirstMessage = &storagepb.BidiWriteObjectRequest_WriteObjectSpec{ - WriteObjectSpec: spec, - } - req.CommonObjectRequestParams = toProtoCommonObjectRequestParams(w.encryptionKey) - // For a non-resumable upload, checksums must be sent in this message. - // TODO: Currently the checksums are only sent on the first message - // of the stream, but in the future, we must also support sending it - // on the *last* message of the stream (instead of the first). - req.ObjectChecksums = toProtoChecksums(w.sendCRC32C, w.attrs) - } + sendErr := s.stream.Send(req) + if sendErr != nil { + obj, err = drainInboundStream(s.stream) + s.stream = nil + if err == io.EOF { + // This is unexpected - we got an error on Send(), but not on Recv(). + // Bubble up the sendErr. + err = sendErr } + return + } - err = w.stream.Send(req) + if finishWrite { + s.stream.CloseSend() + obj, err = drainInboundStream(s.stream) + s.stream = nil if err == io.EOF { - // err was io.EOF. The client-side of a stream only gets an EOF on Send - // when the backend closes the stream and wants to return an error - // status. - - // Receive from the stream Recv() until it returns a non-nil error - // to receive the server's status as an error. We may get multiple - // messages before the error due to buffering. err = nil - for err == nil { - _, err = w.stream.Recv() - } - // Drop the stream reference as a new one will need to be created if - // we retry. - w.stream = nil - - // Retriable errors mean we should start over and attempt to - // resend the entire buffer via a new stream. - // If not retriable, falling through will return the error received. - err = retryConfig.retriable(w.ctx, err) - - if err == nil { - retryConfig.doBackOff(w.ctx) - - // TODO: Add test case for failure modes of querying progress. - writeOffset, err = w.determineOffset(start) - if err != nil { - return nil, 0, err - } - sent = int(writeOffset) - int(start) - - // Continue sending requests, opening a new stream and resending - // any bytes not yet persisted as per QueryWriteStatus - continue sendBytes + if obj.GetSize() > s.flushOffset { + s.progress(obj.GetSize()) } } - if err != nil { - return nil, 0, err - } - - // Update the immediate stream's sent total and the upload offset with - // the data sent. - sent += len(data) - writeOffset += int64(len(data)) + return + } - // Not done sending data, do not attempt to commit it yet, loop around - // and send more data. - if recvd-sent > 0 { - continue sendBytes + if flush { + resp, err := s.stream.Recv() + if err != nil { + return nil, err } - - // The buffer has been uploaded and there is still more data to be - // uploaded, but this is not a resumable upload session. Therefore, - // don't check persisted data. - if !lastWriteOfEntireObject && w.chunkSize == 0 { - return nil, writeOffset, nil + persistedOffset := resp.GetPersistedSize() + if persistedOffset > s.flushOffset { + s.flushOffset = persistedOffset + s.progress(s.flushOffset) } - - // Done sending the data in the buffer (remainingDataFitsInSingleReq - // should == true if we reach this code). - // If we are done sending the whole object, close the stream and get the final - // object. Otherwise, receive from the stream to confirm the persisted data. - if !lastWriteOfEntireObject { - resp, err := w.stream.Recv() - - if err != nil { - // Retriable errors mean we should start over and attempt to - // resend the entire buffer via a new stream. - // If not retriable, falling through will return the error received - // from closing the stream. - err = retryConfig.retriable(w.ctx, err) - if err != nil { - return nil, 0, err - } - - retryConfig.doBackOff(w.ctx) - writeOffset, err = w.determineOffset(start) - if err != nil { - return nil, 0, err - } - sent = int(writeOffset) - int(start) - - // Drop the stream reference as a new one will need to be created. - w.stream = nil - - continue sendBytes - } - - if resp.GetPersistedSize() != writeOffset { - // Retry if not all bytes were persisted. - writeOffset = resp.GetPersistedSize() - sent = int(writeOffset) - int(start) - continue sendBytes - } - } else { - // If the object is done uploading, close the send stream to signal - // to the server that we are done sending so that we can receive - // from the stream without blocking. - err = w.stream.CloseSend() - if err != nil { - // CloseSend() retries the send internally. It never returns an - // error in the current implementation, but we check it anyway in - // case that it does in the future. - return nil, 0, err - } - - // Stream receives do not block once send is closed, but we may not - // receive the response with the object right away; loop until we - // receive the object or error out. - var obj *storagepb.Object - for obj == nil { - resp, err := w.stream.Recv() - - if err != nil { - err = retryConfig.retriable(w.ctx, err) - if err != nil { - return nil, 0, err - } - retryConfig.doBackOff(w.ctx) - - writeOffset, err = w.determineOffset(start) - if err != nil { - return nil, 0, err - } - sent = int(writeOffset) - int(start) - w.stream = nil - continue sendBytes - } - - obj = resp.GetResource() - } - - // Even though we received the object response, continue reading - // until we receive a non-nil error, to ensure the stream does not - // leak even if the context isn't cancelled. See: - // https://pkg.go.dev/google.golang.org/grpc#ClientConn.NewStream - for err == nil { - _, err = w.stream.Recv() - } - - return obj, writeOffset, nil - } - - return nil, writeOffset, nil } + return } -// determineOffset either returns the offset given to it in the case of a simple -// upload, or queries the write status in the case a resumable upload is being -// used. -func (w *gRPCWriter) determineOffset(offset int64) (int64, error) { - // For a Resumable Upload, we must start from however much data - // was committed. - if w.upid != "" { - committed, err := w.queryProgress() +// uploadBuffer uploads the buffer at the given offset using a bi-directional +// Write stream. It will open a new stream if necessary (on the first call or +// after resuming from failure) and chunk the buffer per maxPerMessageWriteSize. +// The final Object is returned on success if doneReading is true. +// +// Returns object and any error that is not retriable. +func (w *gRPCWriter) uploadBuffer(recvd int, start int64, doneReading bool) (obj *storagepb.Object, err error) { + if w.streamSender == nil { + if w.append { + // Appendable object semantics + w.streamSender, err = w.newGRPCAppendBidiWriteBufferSender() + } else if doneReading || w.forceOneShot { + // One shot semantics + w.streamSender, err = w.newGRPCOneshotBidiWriteBufferSender() + } else { + // Resumable write semantics + w.streamSender, err = w.newGRPCResumableBidiWriteBufferSender() + } if err != nil { - return 0, err + return } - offset = committed } - return offset, nil -} - -// writeObjectSpec constructs a WriteObjectSpec proto using the Writer's -// ObjectAttrs and applies its Conditions. This is only used for gRPC. -func (w *gRPCWriter) writeObjectSpec() (*storagepb.WriteObjectSpec, error) { - // To avoid modifying the ObjectAttrs embeded in the calling writer, deref - // the ObjectAttrs pointer to make a copy, then assign the desired name to - // the attribute. - attrs := *w.attrs - spec := &storagepb.WriteObjectSpec{ - Resource: attrs.toProtoObject(w.bucket), - } - // WriteObject doesn't support the generation condition, so use default. - if err := applyCondsProto("WriteObject", defaultGen, w.conds, spec); err != nil { - return nil, err + data := w.buf[:recvd] + offset := start + // We want to go through this loop at least once, in case we have to + // finishWrite with an empty buffer. + for { + // Send as much as we can fit into a single gRPC message. Only flush once, + // when sending the very last message. + l := maxPerMessageWriteSize + flush := false + if len(data) <= l { + l = len(data) + flush = true + } + obj, err = w.streamSender.sendBuffer(data[:l], offset, flush, flush && doneReading) + if err != nil { + return nil, err + } + data = data[l:] + offset += int64(l) + if len(data) == 0 { + break + } } - return spec, nil + return } // read copies the data in the reader to the given buffer and reports how much // data was read into the buffer and if there is no more data to read (EOF). -// Furthermore, if the attrs.ContentType is unset, the first bytes of content -// will be sniffed for a matching content type unless forceEmptyContentType is enabled. func (w *gRPCWriter) read() (int, bool, error) { - if w.attrs.ContentType == "" && !w.forceEmptyContentType { - w.reader, w.attrs.ContentType = gax.DetermineContentType(w.reader) - } // Set n to -1 to start the Read loop. var n, recvd int = -1, 0 var err error @@ -2428,89 +2948,3 @@ func checkCanceled(err error) error { return err } - -type uploadBufferRetryConfig struct { - attempts int - invocationID string - config *retryConfig - lastErr error -} - -func newUploadBufferRetryConfig(settings *settings) *uploadBufferRetryConfig { - config := settings.retry - - if config == nil { - config = defaultRetry.clone() - } - - if config.shouldRetry == nil { - config.shouldRetry = ShouldRetry - } - - if config.backoff == nil { - config.backoff = &gaxBackoff{} - } else { - config.backoff.SetMultiplier(settings.retry.backoff.GetMultiplier()) - config.backoff.SetInitial(settings.retry.backoff.GetInitial()) - config.backoff.SetMax(settings.retry.backoff.GetMax()) - } - - return &uploadBufferRetryConfig{ - attempts: 1, - invocationID: uuid.New().String(), - config: config, - } -} - -// retriable determines if a retry is necessary and if so returns a nil error; -// otherwise it returns the error to be surfaced to the user. -func (retry *uploadBufferRetryConfig) retriable(ctx context.Context, err error) error { - if err == nil { - // a nil err does not need to be retried - return nil - } - if err != context.Canceled && err != context.DeadlineExceeded { - retry.lastErr = err - } - - if retry.config.policy == RetryNever { - return err - } - - if retry.config.maxAttempts != nil && retry.attempts >= *retry.config.maxAttempts { - return fmt.Errorf("storage: retry failed after %v attempts; last error: %w", retry.attempts, err) - } - - retry.attempts++ - - // Explicitly check context cancellation so that we can distinguish between a - // DEADLINE_EXCEEDED error from the server and a user-set context deadline. - // Unfortunately gRPC will codes.DeadlineExceeded (which may be retryable if it's - // sent by the server) in both cases. - ctxErr := ctx.Err() - if errors.Is(ctxErr, context.Canceled) || errors.Is(ctxErr, context.DeadlineExceeded) { - if retry.lastErr != nil { - return fmt.Errorf("retry failed with %v; last error: %w", ctxErr, retry.lastErr) - } - return ctxErr - } - - if !retry.config.shouldRetry(err) { - return err - } - return nil -} - -// doBackOff pauses for the appropriate amount of time; it should be called after -// encountering a retriable error. -func (retry *uploadBufferRetryConfig) doBackOff(ctx context.Context) error { - p := retry.config.backoff.Pause() - - if ctxErr := gax.Sleep(ctx, p); ctxErr != nil { - if retry.lastErr != nil { - return fmt.Errorf("retry failed with %v; last error: %w", ctxErr, retry.lastErr) - } - return ctxErr - } - return nil -} diff --git a/vendor/cloud.google.com/go/storage/grpc_reader.go b/vendor/cloud.google.com/go/storage/grpc_reader.go new file mode 100644 index 0000000000000..e1dd397819bba --- /dev/null +++ b/vendor/cloud.google.com/go/storage/grpc_reader.go @@ -0,0 +1,870 @@ +// Copyright 2025 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package storage + +import ( + "context" + "encoding/binary" + "errors" + "fmt" + "hash/crc32" + "io" + + "cloud.google.com/go/internal/trace" + "cloud.google.com/go/storage/internal/apiv2/storagepb" + "github.com/googleapis/gax-go/v2" + "google.golang.org/grpc" + "google.golang.org/grpc/codes" + "google.golang.org/grpc/encoding" + "google.golang.org/grpc/mem" + "google.golang.org/grpc/status" + "google.golang.org/protobuf/encoding/protowire" + "google.golang.org/protobuf/proto" +) + +// Below is the legacy implementation of gRPC downloads using the ReadObject API. +// It's used by gRPC if the experimental option WithGRPCBidiReads was not passed. +// TODO: once BidiReadObject is in GA, remove this implementation. + +// Custom codec to be used for unmarshaling ReadObjectResponse messages. +// This is used to avoid a copy of object data in proto.Unmarshal. +type bytesCodecReadObject struct { +} + +var _ encoding.CodecV2 = bytesCodecReadObject{} + +// Marshal is used to encode messages to send for bytesCodecReadObject. Since we are only +// using this to send ReadObjectRequest messages we don't need to recycle buffers +// here. +func (bytesCodecReadObject) Marshal(v any) (mem.BufferSlice, error) { + vv, ok := v.(proto.Message) + if !ok { + return nil, fmt.Errorf("failed to marshal, message is %T, want proto.Message", v) + } + var data mem.BufferSlice + buf, err := proto.Marshal(vv) + if err != nil { + return nil, err + } + data = append(data, mem.SliceBuffer(buf)) + return data, nil +} + +// Unmarshal is used for data received for ReadObjectResponse. We want to preserve +// the mem.BufferSlice in most cases rather than copying and calling proto.Unmarshal. +func (bytesCodecReadObject) Unmarshal(data mem.BufferSlice, v any) error { + switch v := v.(type) { + case *mem.BufferSlice: + *v = data + // Pick up a reference to the data so that it is not freed while decoding. + data.Ref() + return nil + case proto.Message: + buf := data.MaterializeToBuffer(mem.DefaultBufferPool()) + return proto.Unmarshal(buf.ReadOnlyData(), v) + default: + return fmt.Errorf("cannot unmarshal type %T, want proto.Message or mem.BufferSlice", v) + } +} + +func (bytesCodecReadObject) Name() string { + return "" +} + +func (c *grpcStorageClient) NewRangeReaderReadObject(ctx context.Context, params *newRangeReaderParams, opts ...storageOption) (r *Reader, err error) { + ctx = trace.StartSpan(ctx, "cloud.google.com/go/storage.grpcStorageClient.NewRangeReaderReadObject") + defer func() { trace.EndSpan(ctx, err) }() + + s := callSettings(c.settings, opts...) + + s.gax = append(s.gax, gax.WithGRPCOptions( + grpc.ForceCodecV2(bytesCodecReadObject{}), + )) + + if s.userProject != "" { + ctx = setUserProjectMetadata(ctx, s.userProject) + } + + b := bucketResourceName(globalProjectAlias, params.bucket) + req := &storagepb.ReadObjectRequest{ + Bucket: b, + Object: params.object, + CommonObjectRequestParams: toProtoCommonObjectRequestParams(params.encryptionKey), + } + // The default is a negative value, which means latest. + if params.gen >= 0 { + req.Generation = params.gen + } + + // Define a function that initiates a Read with offset and length, assuming + // we have already read seen bytes. + reopen := func(seen int64) (*readStreamResponseReadObject, context.CancelFunc, error) { + // If the context has already expired, return immediately without making + // we call. + if err := ctx.Err(); err != nil { + return nil, nil, err + } + + cc, cancel := context.WithCancel(ctx) + + req.ReadOffset = params.offset + seen + + // Only set a ReadLimit if length is greater than zero, because <= 0 means + // to read it all. + if params.length > 0 { + req.ReadLimit = params.length - seen + } + + if err := applyCondsProto("gRPCReadObjectReader.reopen", params.gen, params.conds, req); err != nil { + cancel() + return nil, nil, err + } + + var stream storagepb.Storage_ReadObjectClient + var err error + var decoder *readObjectResponseDecoder + + err = run(cc, func(ctx context.Context) error { + stream, err = c.raw.ReadObject(ctx, req, s.gax...) + if err != nil { + return err + } + + // Receive the message into databuf as a wire-encoded message so we can + // use a custom decoder to avoid an extra copy at the protobuf layer. + databufs := mem.BufferSlice{} + err := stream.RecvMsg(&databufs) + // These types of errors show up on the Recv call, rather than the + // initialization of the stream via ReadObject above. + if s, ok := status.FromError(err); ok && s.Code() == codes.NotFound { + return ErrObjectNotExist + } + if err != nil { + return err + } + // Use a custom decoder that uses protobuf unmarshalling for all + // fields except the object data. Object data is handled separately + // to avoid a copy. + decoder = &readObjectResponseDecoder{ + databufs: databufs, + } + err = decoder.readFullObjectResponse() + return err + }, s.retry, s.idempotent) + if err != nil { + // Close the stream context we just created to ensure we don't leak + // resources. + cancel() + // Free any buffers. + if decoder != nil && decoder.databufs != nil { + decoder.databufs.Free() + } + return nil, nil, err + } + + return &readStreamResponseReadObject{stream, decoder}, cancel, nil + } + + res, cancel, err := reopen(0) + if err != nil { + return nil, err + } + + // The first message was Recv'd on stream open, use it to populate the + // object metadata. + msg := res.decoder.msg + obj := msg.GetMetadata() + // This is the size of the entire object, even if only a range was requested. + size := obj.GetSize() + + // Only support checksums when reading an entire object, not a range. + var ( + wantCRC uint32 + checkCRC bool + ) + if checksums := msg.GetObjectChecksums(); checksums != nil && checksums.Crc32C != nil { + if params.offset == 0 && params.length < 0 { + checkCRC = true + } + wantCRC = checksums.GetCrc32C() + } + + metadata := obj.GetMetadata() + r = &Reader{ + Attrs: ReaderObjectAttrs{ + Size: size, + ContentType: obj.GetContentType(), + ContentEncoding: obj.GetContentEncoding(), + CacheControl: obj.GetCacheControl(), + LastModified: obj.GetUpdateTime().AsTime(), + Metageneration: obj.GetMetageneration(), + Generation: obj.GetGeneration(), + CRC32C: wantCRC, + }, + objectMetadata: &metadata, + reader: &gRPCReadObjectReader{ + stream: res.stream, + reopen: reopen, + cancel: cancel, + size: size, + // Preserve the decoder to read out object data when Read/WriteTo is called. + currMsg: res.decoder, + settings: s, + zeroRange: params.length == 0, + wantCRC: wantCRC, + checkCRC: checkCRC, + }, + checkCRC: checkCRC, + } + + cr := msg.GetContentRange() + if cr != nil { + r.Attrs.StartOffset = cr.GetStart() + r.remain = cr.GetEnd() - cr.GetStart() + } else { + r.remain = size + } + + // For a zero-length request, explicitly close the stream and set remaining + // bytes to zero. + if params.length == 0 { + r.remain = 0 + r.reader.Close() + } + + return r, nil +} + +type readStreamResponseReadObject struct { + stream storagepb.Storage_ReadObjectClient + decoder *readObjectResponseDecoder +} + +type gRPCReadObjectReader struct { + seen, size int64 + zeroRange bool + stream storagepb.Storage_ReadObjectClient + reopen func(seen int64) (*readStreamResponseReadObject, context.CancelFunc, error) + leftovers []byte + currMsg *readObjectResponseDecoder // decoder for the current message + cancel context.CancelFunc + settings *settings + checkCRC bool // should we check the CRC? + wantCRC uint32 // the CRC32c value the server sent in the header + gotCRC uint32 // running crc +} + +// Update the running CRC with the data in the slice, if CRC checking was enabled. +func (r *gRPCReadObjectReader) updateCRC(b []byte) { + if r.checkCRC { + r.gotCRC = crc32.Update(r.gotCRC, crc32cTable, b) + } +} + +// Checks whether the CRC matches at the conclusion of a read, if CRC checking was enabled. +func (r *gRPCReadObjectReader) runCRCCheck() error { + if r.checkCRC && r.gotCRC != r.wantCRC { + return fmt.Errorf("storage: bad CRC on read: got %d, want %d", r.gotCRC, r.wantCRC) + } + return nil +} + +// Read reads bytes into the user's buffer from an open gRPC stream. +func (r *gRPCReadObjectReader) Read(p []byte) (int, error) { + // The entire object has been read by this reader, check the checksum if + // necessary and return EOF. + if r.size == r.seen || r.zeroRange { + if err := r.runCRCCheck(); err != nil { + return 0, err + } + return 0, io.EOF + } + + // No stream to read from, either never initialized or Close was called. + // Note: There is a potential concurrency issue if multiple routines are + // using the same reader. One encounters an error and the stream is closed + // and then reopened while the other routine attempts to read from it. + if r.stream == nil { + return 0, fmt.Errorf("storage: reader has been closed") + } + + var n int + + // If there is data remaining in the current message, return what was + // available to conform to the Reader + // interface: https://pkg.go.dev/io#Reader. + if !r.currMsg.done { + n = r.currMsg.readAndUpdateCRC(p, func(b []byte) { + r.updateCRC(b) + }) + r.seen += int64(n) + return n, nil + } + + // Attempt to Recv the next message on the stream. + // This will update r.currMsg with the decoder for the new message. + err := r.recv() + if err != nil { + return 0, err + } + + // TODO: Determine if we need to capture incremental CRC32C for this + // chunk. The Object CRC32C checksum is captured when directed to read + // the entire Object. If directed to read a range, we may need to + // calculate the range's checksum for verification if the checksum is + // present in the response here. + // TODO: Figure out if we need to support decompressive transcoding + // https://cloud.google.com/storage/docs/transcoding. + + n = r.currMsg.readAndUpdateCRC(p, func(b []byte) { + r.updateCRC(b) + }) + r.seen += int64(n) + return n, nil +} + +// WriteTo writes all the data requested by the Reader into w, implementing +// io.WriterTo. +func (r *gRPCReadObjectReader) WriteTo(w io.Writer) (int64, error) { + // The entire object has been read by this reader, check the checksum if + // necessary and return nil. + if r.size == r.seen || r.zeroRange { + if err := r.runCRCCheck(); err != nil { + return 0, err + } + return 0, nil + } + + // No stream to read from, either never initialized or Close was called. + // Note: There is a potential concurrency issue if multiple routines are + // using the same reader. One encounters an error and the stream is closed + // and then reopened while the other routine attempts to read from it. + if r.stream == nil { + return 0, fmt.Errorf("storage: reader has been closed") + } + + // Track bytes written during before call. + var alreadySeen = r.seen + + // Write any already received message to the stream. There will be some leftovers from the + // original NewRangeReaderReadObject call. + if r.currMsg != nil && !r.currMsg.done { + written, err := r.currMsg.writeToAndUpdateCRC(w, func(b []byte) { + r.updateCRC(b) + }) + r.seen += int64(written) + r.currMsg = nil + if err != nil { + return r.seen - alreadySeen, err + } + } + + // Loop and receive additional messages until the entire data is written. + for { + // Attempt to receive the next message on the stream. + // Will terminate with io.EOF once data has all come through. + // recv() handles stream reopening and retry logic so no need for retries here. + err := r.recv() + if err != nil { + if err == io.EOF { + // We are done; check the checksum if necessary and return. + err = r.runCRCCheck() + } + return r.seen - alreadySeen, err + } + + // TODO: Determine if we need to capture incremental CRC32C for this + // chunk. The Object CRC32C checksum is captured when directed to read + // the entire Object. If directed to read a range, we may need to + // calculate the range's checksum for verification if the checksum is + // present in the response here. + // TODO: Figure out if we need to support decompressive transcoding + // https://cloud.google.com/storage/docs/transcoding. + written, err := r.currMsg.writeToAndUpdateCRC(w, func(b []byte) { + r.updateCRC(b) + }) + r.seen += int64(written) + if err != nil { + return r.seen - alreadySeen, err + } + } + +} + +// Close cancels the read stream's context in order for it to be closed and +// collected, and frees any currently in use buffers. +func (r *gRPCReadObjectReader) Close() error { + if r.cancel != nil { + r.cancel() + } + r.stream = nil + r.currMsg = nil + return nil +} + +// recv attempts to Recv the next message on the stream and extract the object +// data that it contains. In the event that a retryable error is encountered, +// the stream will be closed, reopened, and RecvMsg again. +// This will attempt to Recv until one of the following is true: +// +// * Recv is successful +// * A non-retryable error is encountered +// * The Reader's context is canceled +// +// The last error received is the one that is returned, which could be from +// an attempt to reopen the stream. +func (r *gRPCReadObjectReader) recv() error { + databufs := mem.BufferSlice{} + err := r.stream.RecvMsg(&databufs) + + var shouldRetry = ShouldRetry + if r.settings.retry != nil && r.settings.retry.shouldRetry != nil { + shouldRetry = r.settings.retry.shouldRetry + } + if err != nil && shouldRetry(err) { + // This will "close" the existing stream and immediately attempt to + // reopen the stream, but will backoff if further attempts are necessary. + // Reopening the stream Recvs the first message, so if retrying is + // successful, r.currMsg will be updated to include the new data. + return r.reopenStream() + } + + if err != nil { + return err + } + + r.currMsg = &readObjectResponseDecoder{databufs: databufs} + return r.currMsg.readFullObjectResponse() +} + +// ReadObjectResponse field and subfield numbers. +const ( + checksummedDataFieldReadObject = protowire.Number(1) + checksummedDataContentFieldReadObject = protowire.Number(1) + checksummedDataCRC32CFieldReadObject = protowire.Number(2) + objectChecksumsFieldReadObject = protowire.Number(2) + contentRangeFieldReadObject = protowire.Number(3) + metadataFieldReadObject = protowire.Number(4) +) + +// readObjectResponseDecoder is a wrapper on the raw message, used to decode one message +// without copying object data. It also has methods to write out the resulting object +// data to the user application. +type readObjectResponseDecoder struct { + databufs mem.BufferSlice // raw bytes of the message being processed + // Decoding offsets + off uint64 // offset in the messsage relative to the data as a whole + currBuf int // index of the current buffer being processed + currOff uint64 // offset in the current buffer + // Processed data + msg *storagepb.ReadObjectResponse // processed response message with all fields other than object data populated + dataOffsets bufferSliceOffsetsReadObject // offsets of the object data in the message. + done bool // true if the data has been completely read. +} + +type bufferSliceOffsetsReadObject struct { + startBuf, endBuf int // indices of start and end buffers of object data in the msg + startOff, endOff uint64 // offsets within these buffers where the data starts and ends. + currBuf int // index of current buffer being read out to the user application. + currOff uint64 // offset of read in current buffer. +} + +// peek ahead 10 bytes from the current offset in the databufs. This will return a +// slice of the current buffer if the bytes are all in one buffer, but will copy +// the bytes into a new buffer if the distance is split across buffers. Use this +// to allow protowire methods to be used to parse tags & fixed values. +// The max length of a varint tag is 10 bytes, see +// https://protobuf.dev/programming-guides/encoding/#varints . Other int types +// are shorter. +func (d *readObjectResponseDecoder) peek() []byte { + b := d.databufs[d.currBuf].ReadOnlyData() + // Check if the tag will fit in the current buffer. If not, copy the next 10 + // bytes into a new buffer to ensure that we can read the tag correctly + // without it being divided between buffers. + tagBuf := b[d.currOff:] + remainingInBuf := len(tagBuf) + // If we have less than 10 bytes remaining and are not in the final buffer, + // copy up to 10 bytes ahead from the next buffer. + if remainingInBuf < binary.MaxVarintLen64 && d.currBuf != len(d.databufs)-1 { + tagBuf = d.copyNextBytes(10) + } + return tagBuf +} + +// Copies up to next n bytes into a new buffer, or fewer if fewer bytes remain in the +// buffers overall. Does not advance offsets. +func (d *readObjectResponseDecoder) copyNextBytes(n int) []byte { + remaining := n + if r := d.databufs.Len() - int(d.off); r < remaining { + remaining = r + } + currBuf := d.currBuf + currOff := d.currOff + var buf []byte + for remaining > 0 { + b := d.databufs[currBuf].ReadOnlyData() + remainingInCurr := len(b[currOff:]) + if remainingInCurr < remaining { + buf = append(buf, b[currOff:]...) + remaining -= remainingInCurr + currBuf++ + currOff = 0 + } else { + buf = append(buf, b[currOff:currOff+uint64(remaining)]...) + remaining = 0 + } + } + return buf +} + +// Advance current buffer & byte offset in the decoding by n bytes. Returns an error if we +// go past the end of the data. +func (d *readObjectResponseDecoder) advanceOffset(n uint64) error { + remaining := n + for remaining > 0 { + remainingInCurr := uint64(d.databufs[d.currBuf].Len()) - d.currOff + if remainingInCurr <= remaining { + remaining -= remainingInCurr + d.currBuf++ + d.currOff = 0 + } else { + d.currOff += remaining + remaining = 0 + } + } + // If we have advanced past the end of the buffers, something went wrong. + if (d.currBuf == len(d.databufs) && d.currOff > 0) || d.currBuf > len(d.databufs) { + return errors.New("decoding: truncated message, cannot advance offset") + } + d.off += n + return nil + +} + +// This copies object data from the message into the buffer and returns the number of +// bytes copied. The data offsets are incremented in the message. The updateCRC +// function is called on the copied bytes. +func (d *readObjectResponseDecoder) readAndUpdateCRC(p []byte, updateCRC func([]byte)) int { + // For a completely empty message, just return 0 + if len(d.databufs) == 0 { + return 0 + } + databuf := d.databufs[d.dataOffsets.currBuf] + startOff := d.dataOffsets.currOff + var b []byte + if d.dataOffsets.currBuf == d.dataOffsets.endBuf { + b = databuf.ReadOnlyData()[startOff:d.dataOffsets.endOff] + } else { + b = databuf.ReadOnlyData()[startOff:] + } + n := copy(p, b) + updateCRC(b[:n]) + d.dataOffsets.currOff += uint64(n) + + // We've read all the data from this message. Free the underlying buffers. + if d.dataOffsets.currBuf == d.dataOffsets.endBuf && d.dataOffsets.currOff == d.dataOffsets.endOff { + d.done = true + d.databufs.Free() + } + // We are at the end of the current buffer + if d.dataOffsets.currBuf != d.dataOffsets.endBuf && d.dataOffsets.currOff == uint64(databuf.Len()) { + d.dataOffsets.currOff = 0 + d.dataOffsets.currBuf++ + } + return n +} + +func (d *readObjectResponseDecoder) writeToAndUpdateCRC(w io.Writer, updateCRC func([]byte)) (int64, error) { + // For a completely empty message, just return 0 + if len(d.databufs) == 0 { + return 0, nil + } + var written int64 + for !d.done { + databuf := d.databufs[d.dataOffsets.currBuf] + startOff := d.dataOffsets.currOff + var b []byte + if d.dataOffsets.currBuf == d.dataOffsets.endBuf { + b = databuf.ReadOnlyData()[startOff:d.dataOffsets.endOff] + } else { + b = databuf.ReadOnlyData()[startOff:] + } + var n int + // Write all remaining data from the current buffer + n, err := w.Write(b) + written += int64(n) + updateCRC(b) + if err != nil { + return written, err + } + d.dataOffsets.currOff = 0 + // We've read all the data from this message. + if d.dataOffsets.currBuf == d.dataOffsets.endBuf { + d.done = true + d.databufs.Free() + } else { + d.dataOffsets.currBuf++ + } + } + return written, nil +} + +// Consume the next available tag in the input data and return the field number and type. +// Advances the relevant offsets in the data. +func (d *readObjectResponseDecoder) consumeTag() (protowire.Number, protowire.Type, error) { + tagBuf := d.peek() + + // Consume the next tag. This will tell us which field is next in the + // buffer, its type, and how much space it takes up. + fieldNum, fieldType, tagLength := protowire.ConsumeTag(tagBuf) + if tagLength < 0 { + return 0, 0, protowire.ParseError(tagLength) + } + // Update the offsets and current buffer depending on the tag length. + if err := d.advanceOffset(uint64(tagLength)); err != nil { + return 0, 0, fmt.Errorf("consuming tag: %w", err) + } + return fieldNum, fieldType, nil +} + +// Consume a varint that represents the length of a bytes field. Return the length of +// the data, and advance the offsets by the length of the varint. +func (d *readObjectResponseDecoder) consumeVarint() (uint64, error) { + tagBuf := d.peek() + + // Consume the next tag. This will tell us which field is next in the + // buffer, its type, and how much space it takes up. + dataLength, tagLength := protowire.ConsumeVarint(tagBuf) + if tagLength < 0 { + return 0, protowire.ParseError(tagLength) + } + + // Update the offsets and current buffer depending on the tag length. + d.advanceOffset(uint64(tagLength)) + return dataLength, nil +} + +func (d *readObjectResponseDecoder) consumeFixed32() (uint32, error) { + valueBuf := d.peek() + + // Consume the next tag. This will tell us which field is next in the + // buffer, its type, and how much space it takes up. + value, tagLength := protowire.ConsumeFixed32(valueBuf) + if tagLength < 0 { + return 0, protowire.ParseError(tagLength) + } + + // Update the offsets and current buffer depending on the tag length. + d.advanceOffset(uint64(tagLength)) + return value, nil +} + +func (d *readObjectResponseDecoder) consumeFixed64() (uint64, error) { + valueBuf := d.peek() + + // Consume the next tag. This will tell us which field is next in the + // buffer, its type, and how much space it takes up. + value, tagLength := protowire.ConsumeFixed64(valueBuf) + if tagLength < 0 { + return 0, protowire.ParseError(tagLength) + } + + // Update the offsets and current buffer depending on the tag length. + d.advanceOffset(uint64(tagLength)) + return value, nil +} + +// Consume any field values up to the end offset provided and don't return anything. +// This is used to skip any values which are not going to be used. +// msgEndOff is indexed in terms of the overall data across all buffers. +func (d *readObjectResponseDecoder) consumeFieldValue(fieldNum protowire.Number, fieldType protowire.Type) error { + // reimplement protowire.ConsumeFieldValue without the extra case for groups (which + // are are complicted and not a thing in proto3). + var err error + switch fieldType { + case protowire.VarintType: + _, err = d.consumeVarint() + case protowire.Fixed32Type: + _, err = d.consumeFixed32() + case protowire.Fixed64Type: + _, err = d.consumeFixed64() + case protowire.BytesType: + _, err = d.consumeBytes() + default: + return fmt.Errorf("unknown field type %v in field %v", fieldType, fieldNum) + } + if err != nil { + return fmt.Errorf("consuming field %v of type %v: %w", fieldNum, fieldType, err) + } + + return nil +} + +// Consume a bytes field from the input. Returns offsets for the data in the buffer slices +// and an error. +func (d *readObjectResponseDecoder) consumeBytes() (bufferSliceOffsetsReadObject, error) { + // m is the length of the data past the tag. + m, err := d.consumeVarint() + if err != nil { + return bufferSliceOffsetsReadObject{}, fmt.Errorf("consuming bytes field: %w", err) + } + offsets := bufferSliceOffsetsReadObject{ + startBuf: d.currBuf, + startOff: d.currOff, + currBuf: d.currBuf, + currOff: d.currOff, + } + + // Advance offsets to lengths of bytes field and capture where we end. + d.advanceOffset(m) + offsets.endBuf = d.currBuf + offsets.endOff = d.currOff + return offsets, nil +} + +// Consume a bytes field from the input and copy into a new buffer if +// necessary (if the data is split across buffers in databuf). This can be +// used to leverage proto.Unmarshal for small bytes fields (i.e. anything +// except object data). +func (d *readObjectResponseDecoder) consumeBytesCopy() ([]byte, error) { + // m is the length of the bytes data. + m, err := d.consumeVarint() + if err != nil { + return nil, fmt.Errorf("consuming varint: %w", err) + } + // Copy the data into a buffer and advance the offset + b := d.copyNextBytes(int(m)) + if err := d.advanceOffset(m); err != nil { + return nil, fmt.Errorf("advancing offset: %w", err) + } + return b, nil +} + +// readFullObjectResponse returns the ReadObjectResponse that is encoded in the +// wire-encoded message buffer b, or an error if the message is invalid. +// This must be used on the first recv of an object as it may contain all fields +// of ReadObjectResponse, and we use or pass on those fields to the user. +// This function is essentially identical to proto.Unmarshal, except it aliases +// the data in the input []byte. If the proto library adds a feature to +// Unmarshal that does that, this function can be dropped. +func (d *readObjectResponseDecoder) readFullObjectResponse() error { + msg := &storagepb.ReadObjectResponse{} + + // Loop over the entire message, extracting fields as we go. This does not + // handle field concatenation, in which the contents of a single field + // are split across multiple protobuf tags. + for d.off < uint64(d.databufs.Len()) { + fieldNum, fieldType, err := d.consumeTag() + if err != nil { + return fmt.Errorf("consuming next tag: %w", err) + } + + // Unmarshal the field according to its type. Only fields that are not + // nil will be present. + switch { + case fieldNum == checksummedDataFieldReadObject && fieldType == protowire.BytesType: + // The ChecksummedData field was found. Initialize the struct. + msg.ChecksummedData = &storagepb.ChecksummedData{} + + bytesFieldLen, err := d.consumeVarint() + if err != nil { + return fmt.Errorf("consuming bytes: %v", err) + } + + var contentEndOff = d.off + bytesFieldLen + for d.off < contentEndOff { + gotNum, gotTyp, err := d.consumeTag() + if err != nil { + return fmt.Errorf("consuming checksummedData tag: %w", err) + } + + switch { + case gotNum == checksummedDataContentFieldReadObject && gotTyp == protowire.BytesType: + // Get the offsets of the content bytes. + d.dataOffsets, err = d.consumeBytes() + if err != nil { + return fmt.Errorf("invalid ReadObjectResponse.ChecksummedData.Content: %w", err) + } + case gotNum == checksummedDataCRC32CFieldReadObject && gotTyp == protowire.Fixed32Type: + v, err := d.consumeFixed32() + if err != nil { + return fmt.Errorf("invalid ReadObjectResponse.ChecksummedData.Crc32C: %w", err) + } + msg.ChecksummedData.Crc32C = &v + default: + err := d.consumeFieldValue(gotNum, gotTyp) + if err != nil { + return fmt.Errorf("invalid field in ReadObjectResponse.ChecksummedData: %w", err) + } + } + } + case fieldNum == objectChecksumsFieldReadObject && fieldType == protowire.BytesType: + // The field was found. Initialize the struct. + msg.ObjectChecksums = &storagepb.ObjectChecksums{} + // Consume the bytes and copy them into a single buffer if they are split across buffers. + buf, err := d.consumeBytesCopy() + if err != nil { + return fmt.Errorf("invalid ReadObjectResponse.ObjectChecksums: %v", err) + } + // Unmarshal. + if err := proto.Unmarshal(buf, msg.ObjectChecksums); err != nil { + return err + } + case fieldNum == contentRangeFieldReadObject && fieldType == protowire.BytesType: + msg.ContentRange = &storagepb.ContentRange{} + buf, err := d.consumeBytesCopy() + if err != nil { + return fmt.Errorf("invalid ReadObjectResponse.ContentRange: %v", err) + } + if err := proto.Unmarshal(buf, msg.ContentRange); err != nil { + return err + } + case fieldNum == metadataFieldReadObject && fieldType == protowire.BytesType: + msg.Metadata = &storagepb.Object{} + + buf, err := d.consumeBytesCopy() + if err != nil { + return fmt.Errorf("invalid ReadObjectResponse.Metadata: %v", err) + } + + if err := proto.Unmarshal(buf, msg.Metadata); err != nil { + return err + } + default: + err := d.consumeFieldValue(fieldNum, fieldType) + if err != nil { + return fmt.Errorf("invalid field in ReadObjectResponse: %w", err) + } + } + } + d.msg = msg + return nil +} + +// reopenStream "closes" the existing stream and attempts to reopen a stream and +// sets the Reader's stream and cancelStream properties in the process. +func (r *gRPCReadObjectReader) reopenStream() error { + // Close existing stream and initialize new stream with updated offset. + r.Close() + + res, cancel, err := r.reopen(r.seen) + if err != nil { + return err + } + r.stream = res.stream + r.currMsg = res.decoder + r.cancel = cancel + return nil +} diff --git a/vendor/cloud.google.com/go/storage/grpc_writer.go b/vendor/cloud.google.com/go/storage/grpc_writer.go new file mode 100644 index 0000000000000..9c8e8fc30e6a5 --- /dev/null +++ b/vendor/cloud.google.com/go/storage/grpc_writer.go @@ -0,0 +1,305 @@ +// Copyright 2025 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package storage + +import ( + "context" + "errors" + "fmt" + "io" + + gapic "cloud.google.com/go/storage/internal/apiv2" + "cloud.google.com/go/storage/internal/apiv2/storagepb" + gax "github.com/googleapis/gax-go/v2" + "google.golang.org/grpc/codes" + "google.golang.org/grpc/status" + "google.golang.org/protobuf/proto" +) + +type gRPCAppendBidiWriteBufferSender struct { + ctx context.Context + bucket string + routingToken *string + raw *gapic.Client + settings *settings + stream storagepb.Storage_BidiWriteObjectClient + firstMessage *storagepb.BidiWriteObjectRequest + objectChecksums *storagepb.ObjectChecksums + + forceFirstMessage bool + flushOffset int64 + + // Fields used to report responses from the receive side of the stream + // recvs is closed when the current recv goroutine is complete. recvErr is set + // to the result of that stream (including io.EOF to indicate success) + recvs <-chan *storagepb.BidiWriteObjectResponse + recvErr error +} + +func (w *gRPCWriter) newGRPCAppendBidiWriteBufferSender() (*gRPCAppendBidiWriteBufferSender, error) { + s := &gRPCAppendBidiWriteBufferSender{ + ctx: w.ctx, + bucket: w.spec.GetResource().GetBucket(), + raw: w.c.raw, + settings: w.c.settings, + firstMessage: &storagepb.BidiWriteObjectRequest{ + FirstMessage: &storagepb.BidiWriteObjectRequest_WriteObjectSpec{ + WriteObjectSpec: w.spec, + }, + CommonObjectRequestParams: toProtoCommonObjectRequestParams(w.encryptionKey), + }, + objectChecksums: toProtoChecksums(w.sendCRC32C, w.attrs), + forceFirstMessage: true, + } + return s, nil +} + +func (s *gRPCAppendBidiWriteBufferSender) connect() (err error) { + err = func() error { + // If this is a forced first message, we've already determined it's safe to + // send. + if s.forceFirstMessage { + s.forceFirstMessage = false + return nil + } + + // It's always ok to reconnect if there is a handle. This is the common + // case. + if s.firstMessage.GetAppendObjectSpec().GetWriteHandle() != nil { + return nil + } + + // We can also reconnect if the first message has an if_generation_match or + // if_metageneration_match condition. Note that negative conditions like + // if_generation_not_match are not necessarily safe to retry. + aos := s.firstMessage.GetAppendObjectSpec() + wos := s.firstMessage.GetWriteObjectSpec() + + if aos != nil && aos.IfMetagenerationMatch != nil { + return nil + } + + if wos != nil && wos.IfGenerationMatch != nil { + return nil + } + if wos != nil && wos.IfMetagenerationMatch != nil { + return nil + } + + // Otherwise, it is not safe to reconnect. + return errors.New("cannot safely reconnect; no write handle or preconditions") + }() + if err != nil { + return err + } + + return s.startReceiver() +} + +func (s *gRPCAppendBidiWriteBufferSender) withRequestParams(ctx context.Context) context.Context { + param := fmt.Sprintf("appendable=true&bucket=%s", s.bucket) + if s.routingToken != nil { + param = param + fmt.Sprintf("&routing_token=%s", *s.routingToken) + } + return gax.InsertMetadataIntoOutgoingContext(s.ctx, "x-goog-request-params", param) +} + +func (s *gRPCAppendBidiWriteBufferSender) startReceiver() (err error) { + s.stream, err = s.raw.BidiWriteObject(s.withRequestParams(s.ctx), s.settings.gax...) + if err != nil { + return + } + + recvs := make(chan *storagepb.BidiWriteObjectResponse) + s.recvs = recvs + s.recvErr = nil + go s.receiveMessages(recvs) + return +} + +func (s *gRPCAppendBidiWriteBufferSender) ensureFirstMessageAppendObjectSpec() { + if s.firstMessage.GetWriteObjectSpec() != nil { + w := s.firstMessage.GetWriteObjectSpec() + s.firstMessage.FirstMessage = &storagepb.BidiWriteObjectRequest_AppendObjectSpec{ + AppendObjectSpec: &storagepb.AppendObjectSpec{ + Bucket: w.GetResource().GetBucket(), + Object: w.GetResource().GetName(), + IfMetagenerationMatch: w.IfMetagenerationMatch, + IfMetagenerationNotMatch: w.IfMetagenerationNotMatch, + }, + } + } +} + +func (s *gRPCAppendBidiWriteBufferSender) maybeUpdateFirstMessage(resp *storagepb.BidiWriteObjectResponse) { + // Any affirmative response should switch us to an AppendObjectSpec. + s.ensureFirstMessageAppendObjectSpec() + + if r := resp.GetResource(); r != nil { + aos := s.firstMessage.GetAppendObjectSpec() + aos.Bucket = r.GetBucket() + aos.Object = r.GetName() + aos.Generation = r.GetGeneration() + } + + if h := resp.GetWriteHandle(); h != nil { + s.firstMessage.GetAppendObjectSpec().WriteHandle = h + } +} + +type bidiWriteObjectRedirectionError struct{} + +func (e bidiWriteObjectRedirectionError) Error() string { + return "BidiWriteObjectRedirectedError" +} + +func (s *gRPCAppendBidiWriteBufferSender) handleRedirectionError(e *storagepb.BidiWriteObjectRedirectedError) bool { + if e.RoutingToken == nil { + // This shouldn't happen, but we don't want to blindly retry here. Instead, + // surface the error to the caller. + return false + } + + if e.WriteHandle != nil { + // If we get back a write handle, we should use it. We can only use it + // on an append object spec. + s.ensureFirstMessageAppendObjectSpec() + s.firstMessage.GetAppendObjectSpec().WriteHandle = e.WriteHandle + // Generation is meant to only come with the WriteHandle, so ignore it + // otherwise. + if e.Generation != nil { + s.firstMessage.GetAppendObjectSpec().Generation = e.GetGeneration() + } + } + + s.routingToken = e.RoutingToken + return true +} + +func (s *gRPCAppendBidiWriteBufferSender) receiveMessages(resps chan<- *storagepb.BidiWriteObjectResponse) { + resp, err := s.stream.Recv() + for err == nil { + s.maybeUpdateFirstMessage(resp) + + if resp.WriteStatus != nil { + // We only get a WriteStatus if this was a solicited message (either + // state_lookup: true or finish_write: true). Unsolicited messages may + // arrive to update our handle if necessary. We don't want to block on + // this channel write if this was an unsolicited message. + resps <- resp + } + + resp, err = s.stream.Recv() + } + + if st, ok := status.FromError(err); ok && st.Code() == codes.Aborted { + for _, d := range st.Details() { + if e, ok := d.(*storagepb.BidiWriteObjectRedirectedError); ok { + // If we can handle this error, replace it with the sentinel. Otherwise, + // report it to the user. + if ok := s.handleRedirectionError(e); ok { + err = bidiWriteObjectRedirectionError{} + } + } + } + } + + // TODO: automatically reconnect on retriable recv errors, even if there are + // no sends occurring. + s.recvErr = err + close(resps) +} + +func (s *gRPCAppendBidiWriteBufferSender) sendOnConnectedStream(buf []byte, offset int64, flush, finishWrite, sendFirstMessage bool) (obj *storagepb.Object, err error) { + req := bidiWriteObjectRequest(buf, offset, flush, finishWrite) + if finishWrite { + // appendable objects pass checksums on the last message only + req.ObjectChecksums = s.objectChecksums + } + if sendFirstMessage { + proto.Merge(req, s.firstMessage) + } + + if err = s.stream.Send(req); err != nil { + return nil, err + } + + if finishWrite { + s.stream.CloseSend() + for resp := range s.recvs { + if resp.GetResource() != nil { + obj = resp.GetResource() + } + } + if s.recvErr != io.EOF { + return nil, s.recvErr + } + return + } + + if flush { + // We don't necessarily expect multiple responses for a single flush, but + // this allows the server to send multiple responses if it wants to. + for s.flushOffset < offset+int64(len(buf)) { + resp, ok := <-s.recvs + if !ok { + return nil, s.recvErr + } + pSize := resp.GetPersistedSize() + rSize := resp.GetResource().GetSize() + if s.flushOffset < pSize { + s.flushOffset = pSize + } + if s.flushOffset < rSize { + s.flushOffset = rSize + } + } + } + + return +} + +func (s *gRPCAppendBidiWriteBufferSender) sendBuffer(buf []byte, offset int64, flush, finishWrite bool) (obj *storagepb.Object, err error) { + for { + sendFirstMessage := false + if s.stream == nil { + sendFirstMessage = true + if err = s.connect(); err != nil { + return + } + } + + obj, err = s.sendOnConnectedStream(buf, offset, flush, finishWrite, sendFirstMessage) + if err == nil { + return + } + + // await recv stream termination + for range s.recvs { + } + if s.recvErr != io.EOF { + err = s.recvErr + } + s.stream = nil + + // Retry transparently on a redirection error + if _, ok := err.(bidiWriteObjectRedirectionError); ok { + s.forceFirstMessage = true + continue + } + + return + } +} diff --git a/vendor/cloud.google.com/go/storage/http_client.go b/vendor/cloud.google.com/go/storage/http_client.go index 9a2b17b6a0460..61b20555f4492 100644 --- a/vendor/cloud.google.com/go/storage/http_client.go +++ b/vendor/cloud.google.com/go/storage/http_client.go @@ -34,7 +34,6 @@ import ( "cloud.google.com/go/iam/apiv1/iampb" "cloud.google.com/go/internal/optional" "cloud.google.com/go/internal/trace" - "github.com/googleapis/gax-go/v2" "github.com/googleapis/gax-go/v2/callctx" "golang.org/x/oauth2/google" "google.golang.org/api/googleapi" @@ -862,6 +861,11 @@ func (c *httpStorageClient) RewriteObject(ctx context.Context, req *rewriteObjec return r, nil } +// NewMultiRangeDownloader is not supported by http client. +func (c *httpStorageClient) NewMultiRangeDownloader(ctx context.Context, params *newMultiRangeDownloaderParams, opts ...storageOption) (mr *MultiRangeDownloader, err error) { + return nil, errMethodNotSupported +} + func (c *httpStorageClient) NewRangeReader(ctx context.Context, params *newRangeReaderParams, opts ...storageOption) (r *Reader, err error) { ctx = trace.StartSpan(ctx, "cloud.google.com/go/storage.httpStorageClient.NewRangeReader") defer func() { trace.EndSpan(ctx, err) }() @@ -978,6 +982,10 @@ func (c *httpStorageClient) newRangeReaderJSON(ctx context.Context, params *newR } func (c *httpStorageClient) OpenWriter(params *openWriterParams, opts ...storageOption) (*io.PipeWriter, error) { + if params.append { + return nil, errors.New("storage: append not supported on HTTP Client; use gRPC") + } + s := callSettings(c.settings, opts...) errorf := params.setError setObj := params.setObj @@ -1051,13 +1059,7 @@ func (c *httpStorageClient) OpenWriter(params *openWriterParams, opts ...storage } if useRetry { if s.retry != nil { - bo := &gax.Backoff{} - if s.retry.backoff != nil { - bo.Multiplier = s.retry.backoff.GetMultiplier() - bo.Initial = s.retry.backoff.GetInitial() - bo.Max = s.retry.backoff.GetMax() - } - call.WithRetry(bo, s.retry.shouldRetry) + call.WithRetry(s.retry.backoff, s.retry.shouldRetry) } else { call.WithRetry(nil, nil) } diff --git a/vendor/cloud.google.com/go/storage/internal/apiv2/auxiliary.go b/vendor/cloud.google.com/go/storage/internal/apiv2/auxiliary.go index f6af3452d3126..03c3f8c170d24 100644 --- a/vendor/cloud.google.com/go/storage/internal/apiv2/auxiliary.go +++ b/vendor/cloud.google.com/go/storage/internal/apiv2/auxiliary.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/cloud.google.com/go/storage/internal/apiv2/auxiliary_go123.go b/vendor/cloud.google.com/go/storage/internal/apiv2/auxiliary_go123.go index e6cb160d03191..a51532f60f2c5 100644 --- a/vendor/cloud.google.com/go/storage/internal/apiv2/auxiliary_go123.go +++ b/vendor/cloud.google.com/go/storage/internal/apiv2/auxiliary_go123.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/cloud.google.com/go/storage/internal/apiv2/doc.go b/vendor/cloud.google.com/go/storage/internal/apiv2/doc.go index 4640d5bdfd2a1..502fa56786fef 100644 --- a/vendor/cloud.google.com/go/storage/internal/apiv2/doc.go +++ b/vendor/cloud.google.com/go/storage/internal/apiv2/doc.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -64,12 +64,12 @@ // // The following is an example of making an API call with the newly created client, mentioned above. // -// stream, err := c.BidiWriteObject(ctx) +// stream, err := c.BidiReadObject(ctx) // if err != nil { // // TODO: Handle error. // } // go func() { -// reqs := []*storagepb.BidiWriteObjectRequest{ +// reqs := []*storagepb.BidiReadObjectRequest{ // // TODO: Create requests. // } // for _, req := range reqs { diff --git a/vendor/cloud.google.com/go/storage/internal/apiv2/gapic_metadata.json b/vendor/cloud.google.com/go/storage/internal/apiv2/gapic_metadata.json index 69ad43c32691d..7e4d99ec9140e 100644 --- a/vendor/cloud.google.com/go/storage/internal/apiv2/gapic_metadata.json +++ b/vendor/cloud.google.com/go/storage/internal/apiv2/gapic_metadata.json @@ -10,6 +10,11 @@ "grpc": { "libraryClient": "Client", "rpcs": { + "BidiReadObject": { + "methods": [ + "BidiReadObject" + ] + }, "BidiWriteObject": { "methods": [ "BidiWriteObject" diff --git a/vendor/cloud.google.com/go/storage/internal/apiv2/helpers.go b/vendor/cloud.google.com/go/storage/internal/apiv2/helpers.go index 601d5fa2a646f..0de9b31f64180 100644 --- a/vendor/cloud.google.com/go/storage/internal/apiv2/helpers.go +++ b/vendor/cloud.google.com/go/storage/internal/apiv2/helpers.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/cloud.google.com/go/storage/internal/apiv2/storage_client.go b/vendor/cloud.google.com/go/storage/internal/apiv2/storage_client.go index 55c940be39e0a..4a50254d8913e 100644 --- a/vendor/cloud.google.com/go/storage/internal/apiv2/storage_client.go +++ b/vendor/cloud.google.com/go/storage/internal/apiv2/storage_client.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -57,6 +57,7 @@ type CallOptions struct { CancelResumableWrite []gax.CallOption GetObject []gax.CallOption ReadObject []gax.CallOption + BidiReadObject []gax.CallOption UpdateObject []gax.CallOption WriteObject []gax.CallOption BidiWriteObject []gax.CallOption @@ -278,6 +279,18 @@ func defaultCallOptions() *CallOptions { }) }), }, + BidiReadObject: []gax.CallOption{ + gax.WithRetry(func() gax.Retryer { + return gax.OnCodes([]codes.Code{ + codes.DeadlineExceeded, + codes.Unavailable, + }, gax.Backoff{ + Initial: 1000 * time.Millisecond, + Max: 60000 * time.Millisecond, + Multiplier: 2.00, + }) + }), + }, UpdateObject: []gax.CallOption{ gax.WithTimeout(60000 * time.Millisecond), gax.WithRetry(func() gax.Retryer { @@ -403,6 +416,7 @@ type internalClient interface { CancelResumableWrite(context.Context, *storagepb.CancelResumableWriteRequest, ...gax.CallOption) (*storagepb.CancelResumableWriteResponse, error) GetObject(context.Context, *storagepb.GetObjectRequest, ...gax.CallOption) (*storagepb.Object, error) ReadObject(context.Context, *storagepb.ReadObjectRequest, ...gax.CallOption) (storagepb.Storage_ReadObjectClient, error) + BidiReadObject(context.Context, ...gax.CallOption) (storagepb.Storage_BidiReadObjectClient, error) UpdateObject(context.Context, *storagepb.UpdateObjectRequest, ...gax.CallOption) (*storagepb.Object, error) WriteObject(context.Context, ...gax.CallOption) (storagepb.Storage_WriteObjectClient, error) BidiWriteObject(context.Context, ...gax.CallOption) (storagepb.Storage_BidiWriteObjectClient, error) @@ -530,12 +544,26 @@ func (c *Client) ComposeObject(ctx context.Context, req *storagepb.ComposeObject return c.internalClient.ComposeObject(ctx, req, opts...) } -// DeleteObject deletes an object and its metadata. +// DeleteObject deletes an object and its metadata. Deletions are permanent if versioning +// is not enabled for the bucket, or if the generation parameter is used, or +// if soft delete (at https://cloud.google.com/storage/docs/soft-delete) is not +// enabled for the bucket. +// When this API is used to delete an object from a bucket that has soft +// delete policy enabled, the object becomes soft deleted, and the +// softDeleteTime and hardDeleteTime properties are set on the object. +// This API cannot be used to permanently delete soft-deleted objects. +// Soft-deleted objects are permanently deleted according to their +// hardDeleteTime. // -// Deletions are normally permanent when versioning is disabled or whenever -// the generation parameter is used. However, if soft delete is enabled for -// the bucket, deleted objects can be restored using RestoreObject until the -// soft delete retention period has passed. +// You can use the [RestoreObject][google.storage.v2.Storage.RestoreObject] +// API to restore soft-deleted objects until the soft delete retention period +// has passed. +// +// IAM Permissions: +// +// Requires storage.objects.delete +// IAM permission (at https://cloud.google.com/iam/docs/overview#permissions) on +// the bucket. func (c *Client) DeleteObject(ctx context.Context, req *storagepb.DeleteObjectRequest, opts ...gax.CallOption) error { return c.internalClient.DeleteObject(ctx, req, opts...) } @@ -557,16 +585,52 @@ func (c *Client) CancelResumableWrite(ctx context.Context, req *storagepb.Cancel return c.internalClient.CancelResumableWrite(ctx, req, opts...) } -// GetObject retrieves an object’s metadata. +// GetObject retrieves object metadata. +// +// IAM Permissions: +// +// Requires storage.objects.get +// IAM permission (at https://cloud.google.com/iam/docs/overview#permissions) on +// the bucket. To return object ACLs, the authenticated user must also have +// the storage.objects.getIamPolicy permission. func (c *Client) GetObject(ctx context.Context, req *storagepb.GetObjectRequest, opts ...gax.CallOption) (*storagepb.Object, error) { return c.internalClient.GetObject(ctx, req, opts...) } -// ReadObject reads an object’s data. +// ReadObject retrieves object data. +// +// IAM Permissions: +// +// Requires storage.objects.get +// IAM permission (at https://cloud.google.com/iam/docs/overview#permissions) on +// the bucket. func (c *Client) ReadObject(ctx context.Context, req *storagepb.ReadObjectRequest, opts ...gax.CallOption) (storagepb.Storage_ReadObjectClient, error) { return c.internalClient.ReadObject(ctx, req, opts...) } +// BidiReadObject reads an object’s data. +// +// This is a bi-directional API with the added support for reading multiple +// ranges within one stream both within and across multiple messages. +// If the server encountered an error for any of the inputs, the stream will +// be closed with the relevant error code. +// Because the API allows for multiple outstanding requests, when the stream +// is closed the error response will contain a BidiReadObjectRangesError proto +// in the error extension describing the error for each outstanding read_id. +// +// IAM Permissions: +// +// # Requires storage.objects.get +// +// IAM permission (at https://cloud.google.com/iam/docs/overview#permissions) on +// the bucket. +// +// This API is currently in preview and is not yet available for general +// use. +func (c *Client) BidiReadObject(ctx context.Context, opts ...gax.CallOption) (storagepb.Storage_BidiReadObjectClient, error) { + return c.internalClient.BidiReadObject(ctx, opts...) +} + // UpdateObject updates an object’s metadata. // Equivalent to JSON API’s storage.objects.patch. func (c *Client) UpdateObject(ctx context.Context, req *storagepb.UpdateObjectRequest, opts ...gax.CallOption) (*storagepb.Object, error) { @@ -636,6 +700,12 @@ func (c *Client) UpdateObject(ctx context.Context, req *storagepb.UpdateObjectRe // Alternatively, the BidiWriteObject operation may be used to write an // object with controls over flushing and the ability to fetch the ability to // determine the current persisted size. +// +// IAM Permissions: +// +// Requires storage.objects.create +// IAM permission (at https://cloud.google.com/iam/docs/overview#permissions) on +// the bucket. func (c *Client) WriteObject(ctx context.Context, opts ...gax.CallOption) (storagepb.Storage_WriteObjectClient, error) { return c.internalClient.WriteObject(ctx, opts...) } @@ -660,6 +730,13 @@ func (c *Client) BidiWriteObject(ctx context.Context, opts ...gax.CallOption) (s } // ListObjects retrieves a list of objects matching the criteria. +// +// IAM Permissions: +// +// The authenticated user requires storage.objects.list +// IAM permission (at https://cloud.google.com/iam/docs/overview#permissions) +// to use this method. To return object ACLs, the authenticated user must also +// have the storage.objects.getIamPolicy permission. func (c *Client) ListObjects(ctx context.Context, req *storagepb.ListObjectsRequest, opts ...gax.CallOption) *ObjectIterator { return c.internalClient.ListObjects(ctx, req, opts...) } @@ -670,25 +747,39 @@ func (c *Client) RewriteObject(ctx context.Context, req *storagepb.RewriteObject return c.internalClient.RewriteObject(ctx, req, opts...) } -// StartResumableWrite starts a resumable write. How long the write operation remains valid, and -// what happens when the write operation becomes invalid, are -// service-dependent. +// StartResumableWrite starts a resumable write operation. This +// method is part of the Resumable +// upload (at https://cloud.google.com/storage/docs/resumable-uploads) feature. +// This allows you to upload large objects in multiple chunks, which is more +// resilient to network interruptions than a single upload. The validity +// duration of the write operation, and the consequences of it becoming +// invalid, are service-dependent. +// +// IAM Permissions: +// +// Requires storage.objects.create +// IAM permission (at https://cloud.google.com/iam/docs/overview#permissions) on +// the bucket. func (c *Client) StartResumableWrite(ctx context.Context, req *storagepb.StartResumableWriteRequest, opts ...gax.CallOption) (*storagepb.StartResumableWriteResponse, error) { return c.internalClient.StartResumableWrite(ctx, req, opts...) } -// QueryWriteStatus determines the persisted_size for an object that is being written, which -// can then be used as the write_offset for the next Write() call. +// QueryWriteStatus determines the persisted_size of an object that is being written. This +// method is part of the resumable +// upload (at https://cloud.google.com/storage/docs/resumable-uploads) feature. +// The returned value is the size of the object that has been persisted so +// far. The value can be used as the write_offset for the next Write() +// call. // -// If the object does not exist (i.e., the object has been deleted, or the -// first Write() has not yet reached the service), this method returns the +// If the object does not exist, meaning if it was deleted, or the +// first Write() has not yet reached the service, this method returns the // error NOT_FOUND. // -// The client may call QueryWriteStatus() at any time to determine how -// much data has been processed for this object. This is useful if the -// client is buffering data and needs to know which data can be safely -// evicted. For any sequence of QueryWriteStatus() calls for a given -// object name, the sequence of returned persisted_size values will be +// This method is useful for clients that buffer data and need to know which +// data can be safely evicted. The client can call QueryWriteStatus() at any +// time to determine how much data has been logged for this object. +// For any sequence of QueryWriteStatus() calls for a given +// object name, the sequence of returned persisted_size values are // non-decreasing. func (c *Client) QueryWriteStatus(ctx context.Context, req *storagepb.QueryWriteStatusRequest, opts ...gax.CallOption) (*storagepb.QueryWriteStatusResponse, error) { return c.internalClient.QueryWriteStatus(ctx, req, opts...) @@ -1233,6 +1324,23 @@ func (c *gRPCClient) ReadObject(ctx context.Context, req *storagepb.ReadObjectRe return resp, nil } +func (c *gRPCClient) BidiReadObject(ctx context.Context, opts ...gax.CallOption) (storagepb.Storage_BidiReadObjectClient, error) { + ctx = gax.InsertMetadataIntoOutgoingContext(ctx, c.xGoogHeaders...) + var resp storagepb.Storage_BidiReadObjectClient + opts = append((*c.CallOptions).BidiReadObject[0:len((*c.CallOptions).BidiReadObject):len((*c.CallOptions).BidiReadObject)], opts...) + err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { + var err error + c.logger.DebugContext(ctx, "api streaming client request", "serviceName", serviceName, "rpcName", "BidiReadObject") + resp, err = c.client.BidiReadObject(ctx, settings.GRPC...) + c.logger.DebugContext(ctx, "api streaming client response", "serviceName", serviceName, "rpcName", "BidiReadObject") + return err + }, opts...) + if err != nil { + return nil, err + } + return resp, nil +} + func (c *gRPCClient) UpdateObject(ctx context.Context, req *storagepb.UpdateObjectRequest, opts ...gax.CallOption) (*storagepb.Object, error) { routingHeaders := "" routingHeadersMap := make(map[string]string) diff --git a/vendor/cloud.google.com/go/storage/internal/apiv2/storagepb/storage.pb.go b/vendor/cloud.google.com/go/storage/internal/apiv2/storagepb/storage.pb.go index 63350b0f8a5b1..7f286f3549e10 100644 --- a/vendor/cloud.google.com/go/storage/internal/apiv2/storagepb/storage.pb.go +++ b/vendor/cloud.google.com/go/storage/internal/apiv2/storagepb/storage.pb.go @@ -27,10 +27,11 @@ import ( iampb "cloud.google.com/go/iam/apiv1/iampb" _ "google.golang.org/genproto/googleapis/api/annotations" + status "google.golang.org/genproto/googleapis/rpc/status" date "google.golang.org/genproto/googleapis/type/date" grpc "google.golang.org/grpc" codes "google.golang.org/grpc/codes" - status "google.golang.org/grpc/status" + status1 "google.golang.org/grpc/status" protoreflect "google.golang.org/protobuf/reflect/protoreflect" protoimpl "google.golang.org/protobuf/runtime/protoimpl" durationpb "google.golang.org/protobuf/types/known/durationpb" @@ -177,7 +178,7 @@ func (x ServiceConstants_Values) Number() protoreflect.EnumNumber { // Deprecated: Use ServiceConstants_Values.Descriptor instead. func (ServiceConstants_Values) EnumDescriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{30, 0} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{42, 0} } // Request message for DeleteBucket. @@ -1595,6 +1596,782 @@ func (x *ReadObjectResponse) GetMetadata() *Object { return nil } +// Describes the object to read in a BidiReadObject request. +type BidiReadObjectSpec struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The name of the bucket containing the object to read. + Bucket string `protobuf:"bytes,1,opt,name=bucket,proto3" json:"bucket,omitempty"` + // Required. The name of the object to read. + Object string `protobuf:"bytes,2,opt,name=object,proto3" json:"object,omitempty"` + // If present, selects a specific revision of this object (as opposed + // to the latest version, the default). + Generation int64 `protobuf:"varint,3,opt,name=generation,proto3" json:"generation,omitempty"` + // Makes the operation conditional on whether the object's current generation + // matches the given value. Setting to 0 makes the operation succeed only if + // there are no live versions of the object. + IfGenerationMatch *int64 `protobuf:"varint,4,opt,name=if_generation_match,json=ifGenerationMatch,proto3,oneof" json:"if_generation_match,omitempty"` + // Makes the operation conditional on whether the object's live generation + // does not match the given value. If no live object exists, the precondition + // fails. Setting to 0 makes the operation succeed only if there is a live + // version of the object. + IfGenerationNotMatch *int64 `protobuf:"varint,5,opt,name=if_generation_not_match,json=ifGenerationNotMatch,proto3,oneof" json:"if_generation_not_match,omitempty"` + // Makes the operation conditional on whether the object's current + // metageneration matches the given value. + IfMetagenerationMatch *int64 `protobuf:"varint,6,opt,name=if_metageneration_match,json=ifMetagenerationMatch,proto3,oneof" json:"if_metageneration_match,omitempty"` + // Makes the operation conditional on whether the object's current + // metageneration does not match the given value. + IfMetagenerationNotMatch *int64 `protobuf:"varint,7,opt,name=if_metageneration_not_match,json=ifMetagenerationNotMatch,proto3,oneof" json:"if_metageneration_not_match,omitempty"` + // A set of parameters common to Storage API requests concerning an object. + CommonObjectRequestParams *CommonObjectRequestParams `protobuf:"bytes,8,opt,name=common_object_request_params,json=commonObjectRequestParams,proto3" json:"common_object_request_params,omitempty"` + // Mask specifying which fields to read. + // The checksummed_data field and its children will always be present. + // If no mask is specified, will default to all fields except metadata.owner + // and metadata.acl. + // * may be used to mean "all fields". + // As per https://google.aip.dev/161, this field is deprecated. + // As an alternative, grpc metadata can be used: + // https://cloud.google.com/apis/docs/system-parameters#definitions + // + // Deprecated: Marked as deprecated in google/storage/v2/storage.proto. + ReadMask *fieldmaskpb.FieldMask `protobuf:"bytes,12,opt,name=read_mask,json=readMask,proto3,oneof" json:"read_mask,omitempty"` + // The client can optionally set this field. The read handle is an optimized + // way of creating new streams. Read handles are generated and periodically + // refreshed from prior reads. + ReadHandle *BidiReadHandle `protobuf:"bytes,13,opt,name=read_handle,json=readHandle,proto3,oneof" json:"read_handle,omitempty"` + // The routing token that influences request routing for the stream. Must be + // provided if a BidiReadObjectRedirectedError is returned. + RoutingToken *string `protobuf:"bytes,14,opt,name=routing_token,json=routingToken,proto3,oneof" json:"routing_token,omitempty"` +} + +func (x *BidiReadObjectSpec) Reset() { + *x = BidiReadObjectSpec{} + mi := &file_google_storage_v2_storage_proto_msgTypes[15] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *BidiReadObjectSpec) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*BidiReadObjectSpec) ProtoMessage() {} + +func (x *BidiReadObjectSpec) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[15] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use BidiReadObjectSpec.ProtoReflect.Descriptor instead. +func (*BidiReadObjectSpec) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{15} +} + +func (x *BidiReadObjectSpec) GetBucket() string { + if x != nil { + return x.Bucket + } + return "" +} + +func (x *BidiReadObjectSpec) GetObject() string { + if x != nil { + return x.Object + } + return "" +} + +func (x *BidiReadObjectSpec) GetGeneration() int64 { + if x != nil { + return x.Generation + } + return 0 +} + +func (x *BidiReadObjectSpec) GetIfGenerationMatch() int64 { + if x != nil && x.IfGenerationMatch != nil { + return *x.IfGenerationMatch + } + return 0 +} + +func (x *BidiReadObjectSpec) GetIfGenerationNotMatch() int64 { + if x != nil && x.IfGenerationNotMatch != nil { + return *x.IfGenerationNotMatch + } + return 0 +} + +func (x *BidiReadObjectSpec) GetIfMetagenerationMatch() int64 { + if x != nil && x.IfMetagenerationMatch != nil { + return *x.IfMetagenerationMatch + } + return 0 +} + +func (x *BidiReadObjectSpec) GetIfMetagenerationNotMatch() int64 { + if x != nil && x.IfMetagenerationNotMatch != nil { + return *x.IfMetagenerationNotMatch + } + return 0 +} + +func (x *BidiReadObjectSpec) GetCommonObjectRequestParams() *CommonObjectRequestParams { + if x != nil { + return x.CommonObjectRequestParams + } + return nil +} + +// Deprecated: Marked as deprecated in google/storage/v2/storage.proto. +func (x *BidiReadObjectSpec) GetReadMask() *fieldmaskpb.FieldMask { + if x != nil { + return x.ReadMask + } + return nil +} + +func (x *BidiReadObjectSpec) GetReadHandle() *BidiReadHandle { + if x != nil { + return x.ReadHandle + } + return nil +} + +func (x *BidiReadObjectSpec) GetRoutingToken() string { + if x != nil && x.RoutingToken != nil { + return *x.RoutingToken + } + return "" +} + +// Request message for BidiReadObject. +type BidiReadObjectRequest struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // The first message of each stream should set this field. If this is not + // the first message, an error will be returned. Describes the object to read. + ReadObjectSpec *BidiReadObjectSpec `protobuf:"bytes,1,opt,name=read_object_spec,json=readObjectSpec,proto3" json:"read_object_spec,omitempty"` + // Provides a list of 0 or more (up to 100) ranges to read. If a single range + // is large enough to require multiple responses, they are guaranteed to be + // delivered in increasing offset order. There are no ordering guarantees + // across ranges. When no ranges are provided, the response message will not + // include ObjectRangeData. For full object downloads, the offset and size can + // be set to 0. + ReadRanges []*ReadRange `protobuf:"bytes,8,rep,name=read_ranges,json=readRanges,proto3" json:"read_ranges,omitempty"` +} + +func (x *BidiReadObjectRequest) Reset() { + *x = BidiReadObjectRequest{} + mi := &file_google_storage_v2_storage_proto_msgTypes[16] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *BidiReadObjectRequest) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*BidiReadObjectRequest) ProtoMessage() {} + +func (x *BidiReadObjectRequest) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[16] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use BidiReadObjectRequest.ProtoReflect.Descriptor instead. +func (*BidiReadObjectRequest) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{16} +} + +func (x *BidiReadObjectRequest) GetReadObjectSpec() *BidiReadObjectSpec { + if x != nil { + return x.ReadObjectSpec + } + return nil +} + +func (x *BidiReadObjectRequest) GetReadRanges() []*ReadRange { + if x != nil { + return x.ReadRanges + } + return nil +} + +// Response message for BidiReadObject. +type BidiReadObjectResponse struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // A portion of the object's data. The service **may** leave data + // empty for any given ReadResponse. This enables the service to inform the + // client that the request is still live while it is running an operation to + // generate more data. + // The service **may** pipeline multiple responses belonging to different read + // requests. Each ObjectRangeData entry will have a read_id + // set to the same value as the corresponding source read request. + ObjectDataRanges []*ObjectRangeData `protobuf:"bytes,6,rep,name=object_data_ranges,json=objectDataRanges,proto3" json:"object_data_ranges,omitempty"` + // Metadata of the object whose media is being returned. + // Only populated in the first response in the stream and not populated when + // the stream is opened with a read handle. + Metadata *Object `protobuf:"bytes,4,opt,name=metadata,proto3" json:"metadata,omitempty"` + // This field will be periodically refreshed, however it may not be set in + // every response. It allows the client to more efficiently open subsequent + // bidirectional streams to the same object. + ReadHandle *BidiReadHandle `protobuf:"bytes,7,opt,name=read_handle,json=readHandle,proto3" json:"read_handle,omitempty"` +} + +func (x *BidiReadObjectResponse) Reset() { + *x = BidiReadObjectResponse{} + mi := &file_google_storage_v2_storage_proto_msgTypes[17] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *BidiReadObjectResponse) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*BidiReadObjectResponse) ProtoMessage() {} + +func (x *BidiReadObjectResponse) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[17] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use BidiReadObjectResponse.ProtoReflect.Descriptor instead. +func (*BidiReadObjectResponse) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{17} +} + +func (x *BidiReadObjectResponse) GetObjectDataRanges() []*ObjectRangeData { + if x != nil { + return x.ObjectDataRanges + } + return nil +} + +func (x *BidiReadObjectResponse) GetMetadata() *Object { + if x != nil { + return x.Metadata + } + return nil +} + +func (x *BidiReadObjectResponse) GetReadHandle() *BidiReadHandle { + if x != nil { + return x.ReadHandle + } + return nil +} + +// Error proto containing details for a redirected read. This error is only +// returned on initial open in case of a redirect. +type BidiReadObjectRedirectedError struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // The read handle for the redirected read. The client can use this for the + // subsequent open. + ReadHandle *BidiReadHandle `protobuf:"bytes,1,opt,name=read_handle,json=readHandle,proto3" json:"read_handle,omitempty"` + // The routing token that should be used when reopening the read stream. + RoutingToken *string `protobuf:"bytes,2,opt,name=routing_token,json=routingToken,proto3,oneof" json:"routing_token,omitempty"` +} + +func (x *BidiReadObjectRedirectedError) Reset() { + *x = BidiReadObjectRedirectedError{} + mi := &file_google_storage_v2_storage_proto_msgTypes[18] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *BidiReadObjectRedirectedError) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*BidiReadObjectRedirectedError) ProtoMessage() {} + +func (x *BidiReadObjectRedirectedError) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[18] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use BidiReadObjectRedirectedError.ProtoReflect.Descriptor instead. +func (*BidiReadObjectRedirectedError) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{18} +} + +func (x *BidiReadObjectRedirectedError) GetReadHandle() *BidiReadHandle { + if x != nil { + return x.ReadHandle + } + return nil +} + +func (x *BidiReadObjectRedirectedError) GetRoutingToken() string { + if x != nil && x.RoutingToken != nil { + return *x.RoutingToken + } + return "" +} + +// Error proto containing details for a redirected write. This error is only +// returned on initial open in case of a redirect. +type BidiWriteObjectRedirectedError struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // The routing token that should be used when reopening the write stream. + RoutingToken *string `protobuf:"bytes,1,opt,name=routing_token,json=routingToken,proto3,oneof" json:"routing_token,omitempty"` + // Opaque value describing a previous write. + WriteHandle *BidiWriteHandle `protobuf:"bytes,2,opt,name=write_handle,json=writeHandle,proto3,oneof" json:"write_handle,omitempty"` + // The generation of the object that triggered the redirect. + // Note that if this error was returned as part of an appendable object + // create, this object generation is now successfully created and + // append_object_spec should be used when reconnecting. + Generation *int64 `protobuf:"varint,3,opt,name=generation,proto3,oneof" json:"generation,omitempty"` +} + +func (x *BidiWriteObjectRedirectedError) Reset() { + *x = BidiWriteObjectRedirectedError{} + mi := &file_google_storage_v2_storage_proto_msgTypes[19] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *BidiWriteObjectRedirectedError) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*BidiWriteObjectRedirectedError) ProtoMessage() {} + +func (x *BidiWriteObjectRedirectedError) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[19] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use BidiWriteObjectRedirectedError.ProtoReflect.Descriptor instead. +func (*BidiWriteObjectRedirectedError) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{19} +} + +func (x *BidiWriteObjectRedirectedError) GetRoutingToken() string { + if x != nil && x.RoutingToken != nil { + return *x.RoutingToken + } + return "" +} + +func (x *BidiWriteObjectRedirectedError) GetWriteHandle() *BidiWriteHandle { + if x != nil { + return x.WriteHandle + } + return nil +} + +func (x *BidiWriteObjectRedirectedError) GetGeneration() int64 { + if x != nil && x.Generation != nil { + return *x.Generation + } + return 0 +} + +// Error extension proto containing details for all outstanding reads on the +// failed stream +type BidiReadObjectError struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // The error code for each outstanding read_range + ReadRangeErrors []*ReadRangeError `protobuf:"bytes,1,rep,name=read_range_errors,json=readRangeErrors,proto3" json:"read_range_errors,omitempty"` +} + +func (x *BidiReadObjectError) Reset() { + *x = BidiReadObjectError{} + mi := &file_google_storage_v2_storage_proto_msgTypes[20] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *BidiReadObjectError) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*BidiReadObjectError) ProtoMessage() {} + +func (x *BidiReadObjectError) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[20] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use BidiReadObjectError.ProtoReflect.Descriptor instead. +func (*BidiReadObjectError) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{20} +} + +func (x *BidiReadObjectError) GetReadRangeErrors() []*ReadRangeError { + if x != nil { + return x.ReadRangeErrors + } + return nil +} + +// Error extension proto containing details for a single range read +type ReadRangeError struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // The id of the corresponding read_range + ReadId int64 `protobuf:"varint,1,opt,name=read_id,json=readId,proto3" json:"read_id,omitempty"` + // The status which should be an enum value of [google.rpc.Code]. + Status *status.Status `protobuf:"bytes,2,opt,name=status,proto3" json:"status,omitempty"` +} + +func (x *ReadRangeError) Reset() { + *x = ReadRangeError{} + mi := &file_google_storage_v2_storage_proto_msgTypes[21] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *ReadRangeError) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*ReadRangeError) ProtoMessage() {} + +func (x *ReadRangeError) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[21] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use ReadRangeError.ProtoReflect.Descriptor instead. +func (*ReadRangeError) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{21} +} + +func (x *ReadRangeError) GetReadId() int64 { + if x != nil { + return x.ReadId + } + return 0 +} + +func (x *ReadRangeError) GetStatus() *status.Status { + if x != nil { + return x.Status + } + return nil +} + +// Describes a range of bytes to read in a BidiReadObjectRanges request. +type ReadRange struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The offset for the first byte to return in the read, relative to + // the start of the object. + // + // A negative read_offset value will be interpreted as the number of bytes + // back from the end of the object to be returned. For example, if an object's + // length is 15 bytes, a ReadObjectRequest with read_offset = -5 and + // read_length = 3 would return bytes 10 through 12 of the object. Requesting + // a negative offset with magnitude larger than the size of the object will + // return the entire object. A read_offset larger than the size of the object + // will result in an OutOfRange error. + ReadOffset int64 `protobuf:"varint,1,opt,name=read_offset,json=readOffset,proto3" json:"read_offset,omitempty"` + // Optional. The maximum number of data bytes the server is allowed to return + // across all response messages with the same read_id. A read_length of zero + // indicates to read until the resource end, and a negative read_length will + // cause an error. If the stream returns fewer bytes than allowed by the + // read_length and no error occurred, the stream includes all data from the + // read_offset to the resource end. + ReadLength int64 `protobuf:"varint,2,opt,name=read_length,json=readLength,proto3" json:"read_length,omitempty"` + // Required. Read identifier provided by the client. When the client issues + // more than one outstanding ReadRange on the same stream, responses can be + // mapped back to their corresponding requests using this value. Clients must + // ensure that all outstanding requests have different read_id values. The + // server may close the stream with an error if this condition is not met. + ReadId int64 `protobuf:"varint,3,opt,name=read_id,json=readId,proto3" json:"read_id,omitempty"` +} + +func (x *ReadRange) Reset() { + *x = ReadRange{} + mi := &file_google_storage_v2_storage_proto_msgTypes[22] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *ReadRange) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*ReadRange) ProtoMessage() {} + +func (x *ReadRange) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[22] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use ReadRange.ProtoReflect.Descriptor instead. +func (*ReadRange) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{22} +} + +func (x *ReadRange) GetReadOffset() int64 { + if x != nil { + return x.ReadOffset + } + return 0 +} + +func (x *ReadRange) GetReadLength() int64 { + if x != nil { + return x.ReadLength + } + return 0 +} + +func (x *ReadRange) GetReadId() int64 { + if x != nil { + return x.ReadId + } + return 0 +} + +// Contains data and metadata for a range of an object. +type ObjectRangeData struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // A portion of the data for the object. + ChecksummedData *ChecksummedData `protobuf:"bytes,1,opt,name=checksummed_data,json=checksummedData,proto3" json:"checksummed_data,omitempty"` + // The ReadRange describes the content being returned with read_id set to the + // corresponding ReadObjectRequest in the stream. Multiple ObjectRangeData + // messages may have the same read_id but increasing offsets. + // ReadObjectResponse messages with the same read_id are guaranteed to be + // delivered in increasing offset order. + ReadRange *ReadRange `protobuf:"bytes,2,opt,name=read_range,json=readRange,proto3" json:"read_range,omitempty"` + // If set, indicates there are no more bytes to read for the given ReadRange. + RangeEnd bool `protobuf:"varint,3,opt,name=range_end,json=rangeEnd,proto3" json:"range_end,omitempty"` +} + +func (x *ObjectRangeData) Reset() { + *x = ObjectRangeData{} + mi := &file_google_storage_v2_storage_proto_msgTypes[23] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *ObjectRangeData) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*ObjectRangeData) ProtoMessage() {} + +func (x *ObjectRangeData) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[23] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use ObjectRangeData.ProtoReflect.Descriptor instead. +func (*ObjectRangeData) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{23} +} + +func (x *ObjectRangeData) GetChecksummedData() *ChecksummedData { + if x != nil { + return x.ChecksummedData + } + return nil +} + +func (x *ObjectRangeData) GetReadRange() *ReadRange { + if x != nil { + return x.ReadRange + } + return nil +} + +func (x *ObjectRangeData) GetRangeEnd() bool { + if x != nil { + return x.RangeEnd + } + return false +} + +// BidiReadHandle contains a handle from a previous BiDiReadObject +// invocation. The client can use this instead of BidiReadObjectSpec as an +// optimized way of opening subsequent bidirectional streams to the same object. +type BidiReadHandle struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. Opaque value describing a previous read. + Handle []byte `protobuf:"bytes,1,opt,name=handle,proto3" json:"handle,omitempty"` +} + +func (x *BidiReadHandle) Reset() { + *x = BidiReadHandle{} + mi := &file_google_storage_v2_storage_proto_msgTypes[24] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *BidiReadHandle) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*BidiReadHandle) ProtoMessage() {} + +func (x *BidiReadHandle) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[24] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use BidiReadHandle.ProtoReflect.Descriptor instead. +func (*BidiReadHandle) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{24} +} + +func (x *BidiReadHandle) GetHandle() []byte { + if x != nil { + return x.Handle + } + return nil +} + +// BidiWriteHandle contains a handle from a previous BidiWriteObject +// invocation. The client can use this as an optimized way of opening subsequent +// bidirectional streams to the same object. +type BidiWriteHandle struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. Opaque value describing a previous write. + Handle []byte `protobuf:"bytes,1,opt,name=handle,proto3" json:"handle,omitempty"` +} + +func (x *BidiWriteHandle) Reset() { + *x = BidiWriteHandle{} + mi := &file_google_storage_v2_storage_proto_msgTypes[25] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *BidiWriteHandle) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*BidiWriteHandle) ProtoMessage() {} + +func (x *BidiWriteHandle) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[25] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use BidiWriteHandle.ProtoReflect.Descriptor instead. +func (*BidiWriteHandle) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{25} +} + +func (x *BidiWriteHandle) GetHandle() []byte { + if x != nil { + return x.Handle + } + return nil +} + // Describes an attempt to insert an object, possibly over multiple requests. type WriteObjectSpec struct { state protoimpl.MessageState @@ -1630,11 +2407,14 @@ type WriteObjectSpec struct { // you must start the upload over from scratch, this time sending the correct // number of bytes. ObjectSize *int64 `protobuf:"varint,8,opt,name=object_size,json=objectSize,proto3,oneof" json:"object_size,omitempty"` + // If true, the object will be created in appendable mode. + // This field may only be set when using BidiWriteObject. + Appendable *bool `protobuf:"varint,9,opt,name=appendable,proto3,oneof" json:"appendable,omitempty"` } func (x *WriteObjectSpec) Reset() { *x = WriteObjectSpec{} - mi := &file_google_storage_v2_storage_proto_msgTypes[15] + mi := &file_google_storage_v2_storage_proto_msgTypes[26] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1646,7 +2426,7 @@ func (x *WriteObjectSpec) String() string { func (*WriteObjectSpec) ProtoMessage() {} func (x *WriteObjectSpec) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[15] + mi := &file_google_storage_v2_storage_proto_msgTypes[26] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1659,7 +2439,7 @@ func (x *WriteObjectSpec) ProtoReflect() protoreflect.Message { // Deprecated: Use WriteObjectSpec.ProtoReflect.Descriptor instead. func (*WriteObjectSpec) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{15} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{26} } func (x *WriteObjectSpec) GetResource() *Object { @@ -1711,6 +2491,13 @@ func (x *WriteObjectSpec) GetObjectSize() int64 { return 0 } +func (x *WriteObjectSpec) GetAppendable() bool { + if x != nil && x.Appendable != nil { + return *x.Appendable + } + return false +} + // Request message for WriteObject. type WriteObjectRequest struct { state protoimpl.MessageState @@ -1762,7 +2549,7 @@ type WriteObjectRequest struct { func (x *WriteObjectRequest) Reset() { *x = WriteObjectRequest{} - mi := &file_google_storage_v2_storage_proto_msgTypes[16] + mi := &file_google_storage_v2_storage_proto_msgTypes[27] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1774,7 +2561,7 @@ func (x *WriteObjectRequest) String() string { func (*WriteObjectRequest) ProtoMessage() {} func (x *WriteObjectRequest) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[16] + mi := &file_google_storage_v2_storage_proto_msgTypes[27] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1787,7 +2574,7 @@ func (x *WriteObjectRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use WriteObjectRequest.ProtoReflect.Descriptor instead. func (*WriteObjectRequest) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{16} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{27} } func (m *WriteObjectRequest) GetFirstMessage() isWriteObjectRequest_FirstMessage { @@ -1900,21 +2687,118 @@ type WriteObjectResponse struct { WriteStatus isWriteObjectResponse_WriteStatus `protobuf_oneof:"write_status"` } -func (x *WriteObjectResponse) Reset() { - *x = WriteObjectResponse{} - mi := &file_google_storage_v2_storage_proto_msgTypes[17] +func (x *WriteObjectResponse) Reset() { + *x = WriteObjectResponse{} + mi := &file_google_storage_v2_storage_proto_msgTypes[28] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *WriteObjectResponse) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*WriteObjectResponse) ProtoMessage() {} + +func (x *WriteObjectResponse) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[28] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use WriteObjectResponse.ProtoReflect.Descriptor instead. +func (*WriteObjectResponse) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{28} +} + +func (m *WriteObjectResponse) GetWriteStatus() isWriteObjectResponse_WriteStatus { + if m != nil { + return m.WriteStatus + } + return nil +} + +func (x *WriteObjectResponse) GetPersistedSize() int64 { + if x, ok := x.GetWriteStatus().(*WriteObjectResponse_PersistedSize); ok { + return x.PersistedSize + } + return 0 +} + +func (x *WriteObjectResponse) GetResource() *Object { + if x, ok := x.GetWriteStatus().(*WriteObjectResponse_Resource); ok { + return x.Resource + } + return nil +} + +type isWriteObjectResponse_WriteStatus interface { + isWriteObjectResponse_WriteStatus() +} + +type WriteObjectResponse_PersistedSize struct { + // The total number of bytes that have been processed for the given object + // from all `WriteObject` calls. Only set if the upload has not finalized. + PersistedSize int64 `protobuf:"varint,1,opt,name=persisted_size,json=persistedSize,proto3,oneof"` +} + +type WriteObjectResponse_Resource struct { + // A resource containing the metadata for the uploaded object. Only set if + // the upload has finalized. + Resource *Object `protobuf:"bytes,2,opt,name=resource,proto3,oneof"` +} + +func (*WriteObjectResponse_PersistedSize) isWriteObjectResponse_WriteStatus() {} + +func (*WriteObjectResponse_Resource) isWriteObjectResponse_WriteStatus() {} + +// Describes an attempt to append to an object, possibly over multiple requests. +type AppendObjectSpec struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The name of the bucket containing the object to write. + Bucket string `protobuf:"bytes,1,opt,name=bucket,proto3" json:"bucket,omitempty"` + // Required. The name of the object to open for writing. + Object string `protobuf:"bytes,2,opt,name=object,proto3" json:"object,omitempty"` + // Required. The generation number of the object to open for writing. + Generation int64 `protobuf:"varint,3,opt,name=generation,proto3" json:"generation,omitempty"` + // Makes the operation conditional on whether the object's current + // metageneration matches the given value. + IfMetagenerationMatch *int64 `protobuf:"varint,4,opt,name=if_metageneration_match,json=ifMetagenerationMatch,proto3,oneof" json:"if_metageneration_match,omitempty"` + // Makes the operation conditional on whether the object's current + // metageneration does not match the given value. + IfMetagenerationNotMatch *int64 `protobuf:"varint,5,opt,name=if_metageneration_not_match,json=ifMetagenerationNotMatch,proto3,oneof" json:"if_metageneration_not_match,omitempty"` + // An optional routing token that influences request routing for the stream. + // Must be provided if a BidiWriteObjectRedirectedError is returned. + RoutingToken *string `protobuf:"bytes,6,opt,name=routing_token,json=routingToken,proto3,oneof" json:"routing_token,omitempty"` + // An optional write handle returned from a previous BidiWriteObjectResponse + // message or a BidiWriteObjectRedirectedError error. + WriteHandle *BidiWriteHandle `protobuf:"bytes,7,opt,name=write_handle,json=writeHandle,proto3,oneof" json:"write_handle,omitempty"` +} + +func (x *AppendObjectSpec) Reset() { + *x = AppendObjectSpec{} + mi := &file_google_storage_v2_storage_proto_msgTypes[29] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } -func (x *WriteObjectResponse) String() string { +func (x *AppendObjectSpec) String() string { return protoimpl.X.MessageStringOf(x) } -func (*WriteObjectResponse) ProtoMessage() {} +func (*AppendObjectSpec) ProtoMessage() {} -func (x *WriteObjectResponse) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[17] +func (x *AppendObjectSpec) ProtoReflect() protoreflect.Message { + mi := &file_google_storage_v2_storage_proto_msgTypes[29] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1925,51 +2809,59 @@ func (x *WriteObjectResponse) ProtoReflect() protoreflect.Message { return mi.MessageOf(x) } -// Deprecated: Use WriteObjectResponse.ProtoReflect.Descriptor instead. -func (*WriteObjectResponse) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{17} +// Deprecated: Use AppendObjectSpec.ProtoReflect.Descriptor instead. +func (*AppendObjectSpec) Descriptor() ([]byte, []int) { + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{29} } -func (m *WriteObjectResponse) GetWriteStatus() isWriteObjectResponse_WriteStatus { - if m != nil { - return m.WriteStatus +func (x *AppendObjectSpec) GetBucket() string { + if x != nil { + return x.Bucket } - return nil + return "" } -func (x *WriteObjectResponse) GetPersistedSize() int64 { - if x, ok := x.GetWriteStatus().(*WriteObjectResponse_PersistedSize); ok { - return x.PersistedSize +func (x *AppendObjectSpec) GetObject() string { + if x != nil { + return x.Object } - return 0 + return "" } -func (x *WriteObjectResponse) GetResource() *Object { - if x, ok := x.GetWriteStatus().(*WriteObjectResponse_Resource); ok { - return x.Resource +func (x *AppendObjectSpec) GetGeneration() int64 { + if x != nil { + return x.Generation } - return nil + return 0 } -type isWriteObjectResponse_WriteStatus interface { - isWriteObjectResponse_WriteStatus() +func (x *AppendObjectSpec) GetIfMetagenerationMatch() int64 { + if x != nil && x.IfMetagenerationMatch != nil { + return *x.IfMetagenerationMatch + } + return 0 } -type WriteObjectResponse_PersistedSize struct { - // The total number of bytes that have been processed for the given object - // from all `WriteObject` calls. Only set if the upload has not finalized. - PersistedSize int64 `protobuf:"varint,1,opt,name=persisted_size,json=persistedSize,proto3,oneof"` +func (x *AppendObjectSpec) GetIfMetagenerationNotMatch() int64 { + if x != nil && x.IfMetagenerationNotMatch != nil { + return *x.IfMetagenerationNotMatch + } + return 0 } -type WriteObjectResponse_Resource struct { - // A resource containing the metadata for the uploaded object. Only set if - // the upload has finalized. - Resource *Object `protobuf:"bytes,2,opt,name=resource,proto3,oneof"` +func (x *AppendObjectSpec) GetRoutingToken() string { + if x != nil && x.RoutingToken != nil { + return *x.RoutingToken + } + return "" } -func (*WriteObjectResponse_PersistedSize) isWriteObjectResponse_WriteStatus() {} - -func (*WriteObjectResponse_Resource) isWriteObjectResponse_WriteStatus() {} +func (x *AppendObjectSpec) GetWriteHandle() *BidiWriteHandle { + if x != nil { + return x.WriteHandle + } + return nil +} // Request message for BidiWriteObject. type BidiWriteObjectRequest struct { @@ -1983,6 +2875,7 @@ type BidiWriteObjectRequest struct { // // *BidiWriteObjectRequest_UploadId // *BidiWriteObjectRequest_WriteObjectSpec + // *BidiWriteObjectRequest_AppendObjectSpec FirstMessage isBidiWriteObjectRequest_FirstMessage `protobuf_oneof:"first_message"` // Required. The offset from the beginning of the object at which the data // should be written. @@ -2038,7 +2931,7 @@ type BidiWriteObjectRequest struct { func (x *BidiWriteObjectRequest) Reset() { *x = BidiWriteObjectRequest{} - mi := &file_google_storage_v2_storage_proto_msgTypes[18] + mi := &file_google_storage_v2_storage_proto_msgTypes[30] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2050,7 +2943,7 @@ func (x *BidiWriteObjectRequest) String() string { func (*BidiWriteObjectRequest) ProtoMessage() {} func (x *BidiWriteObjectRequest) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[18] + mi := &file_google_storage_v2_storage_proto_msgTypes[30] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2063,7 +2956,7 @@ func (x *BidiWriteObjectRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use BidiWriteObjectRequest.ProtoReflect.Descriptor instead. func (*BidiWriteObjectRequest) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{18} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{30} } func (m *BidiWriteObjectRequest) GetFirstMessage() isBidiWriteObjectRequest_FirstMessage { @@ -2087,6 +2980,13 @@ func (x *BidiWriteObjectRequest) GetWriteObjectSpec() *WriteObjectSpec { return nil } +func (x *BidiWriteObjectRequest) GetAppendObjectSpec() *AppendObjectSpec { + if x, ok := x.GetFirstMessage().(*BidiWriteObjectRequest_AppendObjectSpec); ok { + return x.AppendObjectSpec + } + return nil +} + func (x *BidiWriteObjectRequest) GetWriteOffset() int64 { if x != nil { return x.WriteOffset @@ -2159,10 +3059,17 @@ type BidiWriteObjectRequest_WriteObjectSpec struct { WriteObjectSpec *WriteObjectSpec `protobuf:"bytes,2,opt,name=write_object_spec,json=writeObjectSpec,proto3,oneof"` } +type BidiWriteObjectRequest_AppendObjectSpec struct { + // For appendable uploads. Describes the object to append to. + AppendObjectSpec *AppendObjectSpec `protobuf:"bytes,11,opt,name=append_object_spec,json=appendObjectSpec,proto3,oneof"` +} + func (*BidiWriteObjectRequest_UploadId) isBidiWriteObjectRequest_FirstMessage() {} func (*BidiWriteObjectRequest_WriteObjectSpec) isBidiWriteObjectRequest_FirstMessage() {} +func (*BidiWriteObjectRequest_AppendObjectSpec) isBidiWriteObjectRequest_FirstMessage() {} + type isBidiWriteObjectRequest_Data interface { isBidiWriteObjectRequest_Data() } @@ -2188,11 +3095,15 @@ type BidiWriteObjectResponse struct { // *BidiWriteObjectResponse_PersistedSize // *BidiWriteObjectResponse_Resource WriteStatus isBidiWriteObjectResponse_WriteStatus `protobuf_oneof:"write_status"` + // An optional write handle that will periodically be present in response + // messages. Clients should save it for later use in establishing a new stream + // if a connection is interrupted. + WriteHandle *BidiWriteHandle `protobuf:"bytes,3,opt,name=write_handle,json=writeHandle,proto3,oneof" json:"write_handle,omitempty"` } func (x *BidiWriteObjectResponse) Reset() { *x = BidiWriteObjectResponse{} - mi := &file_google_storage_v2_storage_proto_msgTypes[19] + mi := &file_google_storage_v2_storage_proto_msgTypes[31] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2204,7 +3115,7 @@ func (x *BidiWriteObjectResponse) String() string { func (*BidiWriteObjectResponse) ProtoMessage() {} func (x *BidiWriteObjectResponse) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[19] + mi := &file_google_storage_v2_storage_proto_msgTypes[31] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2217,7 +3128,7 @@ func (x *BidiWriteObjectResponse) ProtoReflect() protoreflect.Message { // Deprecated: Use BidiWriteObjectResponse.ProtoReflect.Descriptor instead. func (*BidiWriteObjectResponse) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{19} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31} } func (m *BidiWriteObjectResponse) GetWriteStatus() isBidiWriteObjectResponse_WriteStatus { @@ -2241,6 +3152,13 @@ func (x *BidiWriteObjectResponse) GetResource() *Object { return nil } +func (x *BidiWriteObjectResponse) GetWriteHandle() *BidiWriteHandle { + if x != nil { + return x.WriteHandle + } + return nil +} + type isBidiWriteObjectResponse_WriteStatus interface { isBidiWriteObjectResponse_WriteStatus() } @@ -2325,7 +3243,7 @@ type ListObjectsRequest struct { func (x *ListObjectsRequest) Reset() { *x = ListObjectsRequest{} - mi := &file_google_storage_v2_storage_proto_msgTypes[20] + mi := &file_google_storage_v2_storage_proto_msgTypes[32] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2337,7 +3255,7 @@ func (x *ListObjectsRequest) String() string { func (*ListObjectsRequest) ProtoMessage() {} func (x *ListObjectsRequest) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[20] + mi := &file_google_storage_v2_storage_proto_msgTypes[32] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2350,7 +3268,7 @@ func (x *ListObjectsRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use ListObjectsRequest.ProtoReflect.Descriptor instead. func (*ListObjectsRequest) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{20} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{32} } func (x *ListObjectsRequest) GetParent() string { @@ -2459,7 +3377,7 @@ type QueryWriteStatusRequest struct { func (x *QueryWriteStatusRequest) Reset() { *x = QueryWriteStatusRequest{} - mi := &file_google_storage_v2_storage_proto_msgTypes[21] + mi := &file_google_storage_v2_storage_proto_msgTypes[33] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2471,7 +3389,7 @@ func (x *QueryWriteStatusRequest) String() string { func (*QueryWriteStatusRequest) ProtoMessage() {} func (x *QueryWriteStatusRequest) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[21] + mi := &file_google_storage_v2_storage_proto_msgTypes[33] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2484,7 +3402,7 @@ func (x *QueryWriteStatusRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use QueryWriteStatusRequest.ProtoReflect.Descriptor instead. func (*QueryWriteStatusRequest) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{21} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{33} } func (x *QueryWriteStatusRequest) GetUploadId() string { @@ -2518,7 +3436,7 @@ type QueryWriteStatusResponse struct { func (x *QueryWriteStatusResponse) Reset() { *x = QueryWriteStatusResponse{} - mi := &file_google_storage_v2_storage_proto_msgTypes[22] + mi := &file_google_storage_v2_storage_proto_msgTypes[34] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2530,7 +3448,7 @@ func (x *QueryWriteStatusResponse) String() string { func (*QueryWriteStatusResponse) ProtoMessage() {} func (x *QueryWriteStatusResponse) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[22] + mi := &file_google_storage_v2_storage_proto_msgTypes[34] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2543,7 +3461,7 @@ func (x *QueryWriteStatusResponse) ProtoReflect() protoreflect.Message { // Deprecated: Use QueryWriteStatusResponse.ProtoReflect.Descriptor instead. func (*QueryWriteStatusResponse) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{22} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{34} } func (m *QueryWriteStatusResponse) GetWriteStatus() isQueryWriteStatusResponse_WriteStatus { @@ -2700,7 +3618,7 @@ type RewriteObjectRequest struct { func (x *RewriteObjectRequest) Reset() { *x = RewriteObjectRequest{} - mi := &file_google_storage_v2_storage_proto_msgTypes[23] + mi := &file_google_storage_v2_storage_proto_msgTypes[35] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2712,7 +3630,7 @@ func (x *RewriteObjectRequest) String() string { func (*RewriteObjectRequest) ProtoMessage() {} func (x *RewriteObjectRequest) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[23] + mi := &file_google_storage_v2_storage_proto_msgTypes[35] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2725,7 +3643,7 @@ func (x *RewriteObjectRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use RewriteObjectRequest.ProtoReflect.Descriptor instead. func (*RewriteObjectRequest) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{23} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{35} } func (x *RewriteObjectRequest) GetDestinationName() string { @@ -2914,7 +3832,7 @@ type RewriteResponse struct { func (x *RewriteResponse) Reset() { *x = RewriteResponse{} - mi := &file_google_storage_v2_storage_proto_msgTypes[24] + mi := &file_google_storage_v2_storage_proto_msgTypes[36] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2926,7 +3844,7 @@ func (x *RewriteResponse) String() string { func (*RewriteResponse) ProtoMessage() {} func (x *RewriteResponse) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[24] + mi := &file_google_storage_v2_storage_proto_msgTypes[36] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2939,7 +3857,7 @@ func (x *RewriteResponse) ProtoReflect() protoreflect.Message { // Deprecated: Use RewriteResponse.ProtoReflect.Descriptor instead. func (*RewriteResponse) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{24} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{36} } func (x *RewriteResponse) GetTotalBytesRewritten() int64 { @@ -3041,7 +3959,7 @@ type MoveObjectRequest struct { func (x *MoveObjectRequest) Reset() { *x = MoveObjectRequest{} - mi := &file_google_storage_v2_storage_proto_msgTypes[25] + mi := &file_google_storage_v2_storage_proto_msgTypes[37] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3053,7 +3971,7 @@ func (x *MoveObjectRequest) String() string { func (*MoveObjectRequest) ProtoMessage() {} func (x *MoveObjectRequest) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[25] + mi := &file_google_storage_v2_storage_proto_msgTypes[37] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3066,7 +3984,7 @@ func (x *MoveObjectRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use MoveObjectRequest.ProtoReflect.Descriptor instead. func (*MoveObjectRequest) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{25} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{37} } func (x *MoveObjectRequest) GetBucket() string { @@ -3152,21 +4070,21 @@ type StartResumableWriteRequest struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Required. The destination bucket, object, and metadata, as well as any - // preconditions. + // Required. Contains the information necessary to start a resumable write. WriteObjectSpec *WriteObjectSpec `protobuf:"bytes,1,opt,name=write_object_spec,json=writeObjectSpec,proto3" json:"write_object_spec,omitempty"` - // A set of parameters common to Storage API requests concerning an object. + // A set of parameters common to Storage API requests related to an object. CommonObjectRequestParams *CommonObjectRequestParams `protobuf:"bytes,3,opt,name=common_object_request_params,json=commonObjectRequestParams,proto3" json:"common_object_request_params,omitempty"` - // The checksums of the complete object. This will be used to validate the - // uploaded object. For each upload, object_checksums can be provided with - // either StartResumableWriteRequest or the WriteObjectRequest with - // finish_write set to `true`. + // The checksums of the complete object. This is used to validate the + // uploaded object. For each upload, `object_checksums` can be provided when + // initiating a resumable upload with`StartResumableWriteRequest` or when + // completing a write with `WriteObjectRequest` with + // `finish_write` set to `true`. ObjectChecksums *ObjectChecksums `protobuf:"bytes,5,opt,name=object_checksums,json=objectChecksums,proto3" json:"object_checksums,omitempty"` } func (x *StartResumableWriteRequest) Reset() { *x = StartResumableWriteRequest{} - mi := &file_google_storage_v2_storage_proto_msgTypes[26] + mi := &file_google_storage_v2_storage_proto_msgTypes[38] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3178,7 +4096,7 @@ func (x *StartResumableWriteRequest) String() string { func (*StartResumableWriteRequest) ProtoMessage() {} func (x *StartResumableWriteRequest) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[26] + mi := &file_google_storage_v2_storage_proto_msgTypes[38] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3191,7 +4109,7 @@ func (x *StartResumableWriteRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use StartResumableWriteRequest.ProtoReflect.Descriptor instead. func (*StartResumableWriteRequest) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{26} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{38} } func (x *StartResumableWriteRequest) GetWriteObjectSpec() *WriteObjectSpec { @@ -3221,14 +4139,17 @@ type StartResumableWriteResponse struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // The upload_id of the newly started resumable write operation. This - // value should be copied into the `WriteObjectRequest.upload_id` field. + // A unique identifier for the initiated resumable write operation. + // As the ID grants write access, you should keep it confidential during + // the upload to prevent unauthorized access and data tampering during your + // upload. This ID should be included in subsequent `WriteObject` requests to + // upload the object data. UploadId string `protobuf:"bytes,1,opt,name=upload_id,json=uploadId,proto3" json:"upload_id,omitempty"` } func (x *StartResumableWriteResponse) Reset() { *x = StartResumableWriteResponse{} - mi := &file_google_storage_v2_storage_proto_msgTypes[27] + mi := &file_google_storage_v2_storage_proto_msgTypes[39] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3240,7 +4161,7 @@ func (x *StartResumableWriteResponse) String() string { func (*StartResumableWriteResponse) ProtoMessage() {} func (x *StartResumableWriteResponse) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[27] + mi := &file_google_storage_v2_storage_proto_msgTypes[39] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3253,7 +4174,7 @@ func (x *StartResumableWriteResponse) ProtoReflect() protoreflect.Message { // Deprecated: Use StartResumableWriteResponse.ProtoReflect.Descriptor instead. func (*StartResumableWriteResponse) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{27} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{39} } func (x *StartResumableWriteResponse) GetUploadId() string { @@ -3309,7 +4230,7 @@ type UpdateObjectRequest struct { func (x *UpdateObjectRequest) Reset() { *x = UpdateObjectRequest{} - mi := &file_google_storage_v2_storage_proto_msgTypes[28] + mi := &file_google_storage_v2_storage_proto_msgTypes[40] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3321,7 +4242,7 @@ func (x *UpdateObjectRequest) String() string { func (*UpdateObjectRequest) ProtoMessage() {} func (x *UpdateObjectRequest) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[28] + mi := &file_google_storage_v2_storage_proto_msgTypes[40] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3334,7 +4255,7 @@ func (x *UpdateObjectRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use UpdateObjectRequest.ProtoReflect.Descriptor instead. func (*UpdateObjectRequest) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{28} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{40} } func (x *UpdateObjectRequest) GetObject() *Object { @@ -3412,7 +4333,7 @@ type CommonObjectRequestParams struct { func (x *CommonObjectRequestParams) Reset() { *x = CommonObjectRequestParams{} - mi := &file_google_storage_v2_storage_proto_msgTypes[29] + mi := &file_google_storage_v2_storage_proto_msgTypes[41] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3424,7 +4345,7 @@ func (x *CommonObjectRequestParams) String() string { func (*CommonObjectRequestParams) ProtoMessage() {} func (x *CommonObjectRequestParams) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[29] + mi := &file_google_storage_v2_storage_proto_msgTypes[41] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3437,7 +4358,7 @@ func (x *CommonObjectRequestParams) ProtoReflect() protoreflect.Message { // Deprecated: Use CommonObjectRequestParams.ProtoReflect.Descriptor instead. func (*CommonObjectRequestParams) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{29} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{41} } func (x *CommonObjectRequestParams) GetEncryptionAlgorithm() string { @@ -3470,7 +4391,7 @@ type ServiceConstants struct { func (x *ServiceConstants) Reset() { *x = ServiceConstants{} - mi := &file_google_storage_v2_storage_proto_msgTypes[30] + mi := &file_google_storage_v2_storage_proto_msgTypes[42] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3482,7 +4403,7 @@ func (x *ServiceConstants) String() string { func (*ServiceConstants) ProtoMessage() {} func (x *ServiceConstants) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[30] + mi := &file_google_storage_v2_storage_proto_msgTypes[42] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3495,7 +4416,7 @@ func (x *ServiceConstants) ProtoReflect() protoreflect.Message { // Deprecated: Use ServiceConstants.ProtoReflect.Descriptor instead. func (*ServiceConstants) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{30} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{42} } // A bucket. @@ -3629,7 +4550,7 @@ type Bucket struct { func (x *Bucket) Reset() { *x = Bucket{} - mi := &file_google_storage_v2_storage_proto_msgTypes[31] + mi := &file_google_storage_v2_storage_proto_msgTypes[43] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3641,7 +4562,7 @@ func (x *Bucket) String() string { func (*Bucket) ProtoMessage() {} func (x *Bucket) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[31] + mi := &file_google_storage_v2_storage_proto_msgTypes[43] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3654,7 +4575,7 @@ func (x *Bucket) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket.ProtoReflect.Descriptor instead. func (*Bucket) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43} } func (x *Bucket) GetName() string { @@ -3916,7 +4837,7 @@ type BucketAccessControl struct { func (x *BucketAccessControl) Reset() { *x = BucketAccessControl{} - mi := &file_google_storage_v2_storage_proto_msgTypes[32] + mi := &file_google_storage_v2_storage_proto_msgTypes[44] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3928,7 +4849,7 @@ func (x *BucketAccessControl) String() string { func (*BucketAccessControl) ProtoMessage() {} func (x *BucketAccessControl) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[32] + mi := &file_google_storage_v2_storage_proto_msgTypes[44] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3941,7 +4862,7 @@ func (x *BucketAccessControl) ProtoReflect() protoreflect.Message { // Deprecated: Use BucketAccessControl.ProtoReflect.Descriptor instead. func (*BucketAccessControl) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{32} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{44} } func (x *BucketAccessControl) GetRole() string { @@ -4022,7 +4943,7 @@ type ChecksummedData struct { func (x *ChecksummedData) Reset() { *x = ChecksummedData{} - mi := &file_google_storage_v2_storage_proto_msgTypes[33] + mi := &file_google_storage_v2_storage_proto_msgTypes[45] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4034,7 +4955,7 @@ func (x *ChecksummedData) String() string { func (*ChecksummedData) ProtoMessage() {} func (x *ChecksummedData) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[33] + mi := &file_google_storage_v2_storage_proto_msgTypes[45] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4047,7 +4968,7 @@ func (x *ChecksummedData) ProtoReflect() protoreflect.Message { // Deprecated: Use ChecksummedData.ProtoReflect.Descriptor instead. func (*ChecksummedData) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{33} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{45} } func (x *ChecksummedData) GetContent() []byte { @@ -4087,7 +5008,7 @@ type ObjectChecksums struct { func (x *ObjectChecksums) Reset() { *x = ObjectChecksums{} - mi := &file_google_storage_v2_storage_proto_msgTypes[34] + mi := &file_google_storage_v2_storage_proto_msgTypes[46] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4099,7 +5020,7 @@ func (x *ObjectChecksums) String() string { func (*ObjectChecksums) ProtoMessage() {} func (x *ObjectChecksums) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[34] + mi := &file_google_storage_v2_storage_proto_msgTypes[46] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4112,7 +5033,7 @@ func (x *ObjectChecksums) ProtoReflect() protoreflect.Message { // Deprecated: Use ObjectChecksums.ProtoReflect.Descriptor instead. func (*ObjectChecksums) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{34} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{46} } func (x *ObjectChecksums) GetCrc32C() uint32 { @@ -4145,7 +5066,7 @@ type CustomerEncryption struct { func (x *CustomerEncryption) Reset() { *x = CustomerEncryption{} - mi := &file_google_storage_v2_storage_proto_msgTypes[35] + mi := &file_google_storage_v2_storage_proto_msgTypes[47] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4157,7 +5078,7 @@ func (x *CustomerEncryption) String() string { func (*CustomerEncryption) ProtoMessage() {} func (x *CustomerEncryption) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[35] + mi := &file_google_storage_v2_storage_proto_msgTypes[47] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4170,7 +5091,7 @@ func (x *CustomerEncryption) ProtoReflect() protoreflect.Message { // Deprecated: Use CustomerEncryption.ProtoReflect.Descriptor instead. func (*CustomerEncryption) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{35} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{47} } func (x *CustomerEncryption) GetEncryptionAlgorithm() string { @@ -4327,7 +5248,7 @@ type Object struct { func (x *Object) Reset() { *x = Object{} - mi := &file_google_storage_v2_storage_proto_msgTypes[36] + mi := &file_google_storage_v2_storage_proto_msgTypes[48] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4339,7 +5260,7 @@ func (x *Object) String() string { func (*Object) ProtoMessage() {} func (x *Object) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[36] + mi := &file_google_storage_v2_storage_proto_msgTypes[48] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4352,7 +5273,7 @@ func (x *Object) ProtoReflect() protoreflect.Message { // Deprecated: Use Object.ProtoReflect.Descriptor instead. func (*Object) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{36} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{48} } func (x *Object) GetName() string { @@ -4624,7 +5545,7 @@ type ObjectAccessControl struct { func (x *ObjectAccessControl) Reset() { *x = ObjectAccessControl{} - mi := &file_google_storage_v2_storage_proto_msgTypes[37] + mi := &file_google_storage_v2_storage_proto_msgTypes[49] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4636,7 +5557,7 @@ func (x *ObjectAccessControl) String() string { func (*ObjectAccessControl) ProtoMessage() {} func (x *ObjectAccessControl) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[37] + mi := &file_google_storage_v2_storage_proto_msgTypes[49] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4649,7 +5570,7 @@ func (x *ObjectAccessControl) ProtoReflect() protoreflect.Message { // Deprecated: Use ObjectAccessControl.ProtoReflect.Descriptor instead. func (*ObjectAccessControl) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{37} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{49} } func (x *ObjectAccessControl) GetRole() string { @@ -4733,7 +5654,7 @@ type ListObjectsResponse struct { func (x *ListObjectsResponse) Reset() { *x = ListObjectsResponse{} - mi := &file_google_storage_v2_storage_proto_msgTypes[38] + mi := &file_google_storage_v2_storage_proto_msgTypes[50] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4745,7 +5666,7 @@ func (x *ListObjectsResponse) String() string { func (*ListObjectsResponse) ProtoMessage() {} func (x *ListObjectsResponse) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[38] + mi := &file_google_storage_v2_storage_proto_msgTypes[50] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4758,7 +5679,7 @@ func (x *ListObjectsResponse) ProtoReflect() protoreflect.Message { // Deprecated: Use ListObjectsResponse.ProtoReflect.Descriptor instead. func (*ListObjectsResponse) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{38} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{50} } func (x *ListObjectsResponse) GetObjects() []*Object { @@ -4796,7 +5717,7 @@ type ProjectTeam struct { func (x *ProjectTeam) Reset() { *x = ProjectTeam{} - mi := &file_google_storage_v2_storage_proto_msgTypes[39] + mi := &file_google_storage_v2_storage_proto_msgTypes[51] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4808,7 +5729,7 @@ func (x *ProjectTeam) String() string { func (*ProjectTeam) ProtoMessage() {} func (x *ProjectTeam) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[39] + mi := &file_google_storage_v2_storage_proto_msgTypes[51] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4821,7 +5742,7 @@ func (x *ProjectTeam) ProtoReflect() protoreflect.Message { // Deprecated: Use ProjectTeam.ProtoReflect.Descriptor instead. func (*ProjectTeam) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{39} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{51} } func (x *ProjectTeam) GetProjectNumber() string { @@ -4852,7 +5773,7 @@ type Owner struct { func (x *Owner) Reset() { *x = Owner{} - mi := &file_google_storage_v2_storage_proto_msgTypes[40] + mi := &file_google_storage_v2_storage_proto_msgTypes[52] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4864,7 +5785,7 @@ func (x *Owner) String() string { func (*Owner) ProtoMessage() {} func (x *Owner) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[40] + mi := &file_google_storage_v2_storage_proto_msgTypes[52] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4877,7 +5798,7 @@ func (x *Owner) ProtoReflect() protoreflect.Message { // Deprecated: Use Owner.ProtoReflect.Descriptor instead. func (*Owner) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{40} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{52} } func (x *Owner) GetEntity() string { @@ -4910,7 +5831,7 @@ type ContentRange struct { func (x *ContentRange) Reset() { *x = ContentRange{} - mi := &file_google_storage_v2_storage_proto_msgTypes[41] + mi := &file_google_storage_v2_storage_proto_msgTypes[53] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4922,7 +5843,7 @@ func (x *ContentRange) String() string { func (*ContentRange) ProtoMessage() {} func (x *ContentRange) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[41] + mi := &file_google_storage_v2_storage_proto_msgTypes[53] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4935,7 +5856,7 @@ func (x *ContentRange) ProtoReflect() protoreflect.Message { // Deprecated: Use ContentRange.ProtoReflect.Descriptor instead. func (*ContentRange) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{41} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{53} } func (x *ContentRange) GetStart() int64 { @@ -4976,7 +5897,7 @@ type ComposeObjectRequest_SourceObject struct { func (x *ComposeObjectRequest_SourceObject) Reset() { *x = ComposeObjectRequest_SourceObject{} - mi := &file_google_storage_v2_storage_proto_msgTypes[42] + mi := &file_google_storage_v2_storage_proto_msgTypes[54] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4988,7 +5909,7 @@ func (x *ComposeObjectRequest_SourceObject) String() string { func (*ComposeObjectRequest_SourceObject) ProtoMessage() {} func (x *ComposeObjectRequest_SourceObject) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[42] + mi := &file_google_storage_v2_storage_proto_msgTypes[54] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5039,7 +5960,7 @@ type ComposeObjectRequest_SourceObject_ObjectPreconditions struct { func (x *ComposeObjectRequest_SourceObject_ObjectPreconditions) Reset() { *x = ComposeObjectRequest_SourceObject_ObjectPreconditions{} - mi := &file_google_storage_v2_storage_proto_msgTypes[43] + mi := &file_google_storage_v2_storage_proto_msgTypes[55] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5051,7 +5972,7 @@ func (x *ComposeObjectRequest_SourceObject_ObjectPreconditions) String() string func (*ComposeObjectRequest_SourceObject_ObjectPreconditions) ProtoMessage() {} func (x *ComposeObjectRequest_SourceObject_ObjectPreconditions) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[43] + mi := &file_google_storage_v2_storage_proto_msgTypes[55] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5086,7 +6007,7 @@ type Bucket_Billing struct { func (x *Bucket_Billing) Reset() { *x = Bucket_Billing{} - mi := &file_google_storage_v2_storage_proto_msgTypes[44] + mi := &file_google_storage_v2_storage_proto_msgTypes[56] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5098,7 +6019,7 @@ func (x *Bucket_Billing) String() string { func (*Bucket_Billing) ProtoMessage() {} func (x *Bucket_Billing) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[44] + mi := &file_google_storage_v2_storage_proto_msgTypes[56] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5111,7 +6032,7 @@ func (x *Bucket_Billing) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Billing.ProtoReflect.Descriptor instead. func (*Bucket_Billing) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 0} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 0} } func (x *Bucket_Billing) GetRequesterPays() bool { @@ -5150,7 +6071,7 @@ type Bucket_Cors struct { func (x *Bucket_Cors) Reset() { *x = Bucket_Cors{} - mi := &file_google_storage_v2_storage_proto_msgTypes[45] + mi := &file_google_storage_v2_storage_proto_msgTypes[57] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5162,7 +6083,7 @@ func (x *Bucket_Cors) String() string { func (*Bucket_Cors) ProtoMessage() {} func (x *Bucket_Cors) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[45] + mi := &file_google_storage_v2_storage_proto_msgTypes[57] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5175,7 +6096,7 @@ func (x *Bucket_Cors) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Cors.ProtoReflect.Descriptor instead. func (*Bucket_Cors) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 1} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 1} } func (x *Bucket_Cors) GetOrigin() []string { @@ -5219,7 +6140,7 @@ type Bucket_Encryption struct { func (x *Bucket_Encryption) Reset() { *x = Bucket_Encryption{} - mi := &file_google_storage_v2_storage_proto_msgTypes[46] + mi := &file_google_storage_v2_storage_proto_msgTypes[58] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5231,7 +6152,7 @@ func (x *Bucket_Encryption) String() string { func (*Bucket_Encryption) ProtoMessage() {} func (x *Bucket_Encryption) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[46] + mi := &file_google_storage_v2_storage_proto_msgTypes[58] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5244,7 +6165,7 @@ func (x *Bucket_Encryption) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Encryption.ProtoReflect.Descriptor instead. func (*Bucket_Encryption) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 2} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 2} } func (x *Bucket_Encryption) GetDefaultKmsKey() string { @@ -5269,7 +6190,7 @@ type Bucket_IamConfig struct { func (x *Bucket_IamConfig) Reset() { *x = Bucket_IamConfig{} - mi := &file_google_storage_v2_storage_proto_msgTypes[47] + mi := &file_google_storage_v2_storage_proto_msgTypes[59] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5281,7 +6202,7 @@ func (x *Bucket_IamConfig) String() string { func (*Bucket_IamConfig) ProtoMessage() {} func (x *Bucket_IamConfig) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[47] + mi := &file_google_storage_v2_storage_proto_msgTypes[59] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5294,7 +6215,7 @@ func (x *Bucket_IamConfig) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_IamConfig.ProtoReflect.Descriptor instead. func (*Bucket_IamConfig) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 3} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 3} } func (x *Bucket_IamConfig) GetUniformBucketLevelAccess() *Bucket_IamConfig_UniformBucketLevelAccess { @@ -5325,7 +6246,7 @@ type Bucket_Lifecycle struct { func (x *Bucket_Lifecycle) Reset() { *x = Bucket_Lifecycle{} - mi := &file_google_storage_v2_storage_proto_msgTypes[48] + mi := &file_google_storage_v2_storage_proto_msgTypes[60] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5337,7 +6258,7 @@ func (x *Bucket_Lifecycle) String() string { func (*Bucket_Lifecycle) ProtoMessage() {} func (x *Bucket_Lifecycle) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[48] + mi := &file_google_storage_v2_storage_proto_msgTypes[60] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5350,7 +6271,7 @@ func (x *Bucket_Lifecycle) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Lifecycle.ProtoReflect.Descriptor instead. func (*Bucket_Lifecycle) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 4} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 4} } func (x *Bucket_Lifecycle) GetRule() []*Bucket_Lifecycle_Rule { @@ -5375,7 +6296,7 @@ type Bucket_Logging struct { func (x *Bucket_Logging) Reset() { *x = Bucket_Logging{} - mi := &file_google_storage_v2_storage_proto_msgTypes[49] + mi := &file_google_storage_v2_storage_proto_msgTypes[61] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5387,7 +6308,7 @@ func (x *Bucket_Logging) String() string { func (*Bucket_Logging) ProtoMessage() {} func (x *Bucket_Logging) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[49] + mi := &file_google_storage_v2_storage_proto_msgTypes[61] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5400,7 +6321,7 @@ func (x *Bucket_Logging) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Logging.ProtoReflect.Descriptor instead. func (*Bucket_Logging) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 5} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 5} } func (x *Bucket_Logging) GetLogBucket() string { @@ -5438,7 +6359,7 @@ type Bucket_RetentionPolicy struct { func (x *Bucket_RetentionPolicy) Reset() { *x = Bucket_RetentionPolicy{} - mi := &file_google_storage_v2_storage_proto_msgTypes[50] + mi := &file_google_storage_v2_storage_proto_msgTypes[62] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5450,7 +6371,7 @@ func (x *Bucket_RetentionPolicy) String() string { func (*Bucket_RetentionPolicy) ProtoMessage() {} func (x *Bucket_RetentionPolicy) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[50] + mi := &file_google_storage_v2_storage_proto_msgTypes[62] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5463,7 +6384,7 @@ func (x *Bucket_RetentionPolicy) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_RetentionPolicy.ProtoReflect.Descriptor instead. func (*Bucket_RetentionPolicy) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 6} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 6} } func (x *Bucket_RetentionPolicy) GetEffectiveTime() *timestamppb.Timestamp { @@ -5503,7 +6424,7 @@ type Bucket_SoftDeletePolicy struct { func (x *Bucket_SoftDeletePolicy) Reset() { *x = Bucket_SoftDeletePolicy{} - mi := &file_google_storage_v2_storage_proto_msgTypes[51] + mi := &file_google_storage_v2_storage_proto_msgTypes[63] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5515,7 +6436,7 @@ func (x *Bucket_SoftDeletePolicy) String() string { func (*Bucket_SoftDeletePolicy) ProtoMessage() {} func (x *Bucket_SoftDeletePolicy) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[51] + mi := &file_google_storage_v2_storage_proto_msgTypes[63] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5528,7 +6449,7 @@ func (x *Bucket_SoftDeletePolicy) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_SoftDeletePolicy.ProtoReflect.Descriptor instead. func (*Bucket_SoftDeletePolicy) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 7} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 7} } func (x *Bucket_SoftDeletePolicy) GetRetentionDuration() *durationpb.Duration { @@ -5559,7 +6480,7 @@ type Bucket_Versioning struct { func (x *Bucket_Versioning) Reset() { *x = Bucket_Versioning{} - mi := &file_google_storage_v2_storage_proto_msgTypes[52] + mi := &file_google_storage_v2_storage_proto_msgTypes[64] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5571,7 +6492,7 @@ func (x *Bucket_Versioning) String() string { func (*Bucket_Versioning) ProtoMessage() {} func (x *Bucket_Versioning) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[52] + mi := &file_google_storage_v2_storage_proto_msgTypes[64] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5584,7 +6505,7 @@ func (x *Bucket_Versioning) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Versioning.ProtoReflect.Descriptor instead. func (*Bucket_Versioning) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 8} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 8} } func (x *Bucket_Versioning) GetEnabled() bool { @@ -5617,7 +6538,7 @@ type Bucket_Website struct { func (x *Bucket_Website) Reset() { *x = Bucket_Website{} - mi := &file_google_storage_v2_storage_proto_msgTypes[53] + mi := &file_google_storage_v2_storage_proto_msgTypes[65] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5629,7 +6550,7 @@ func (x *Bucket_Website) String() string { func (*Bucket_Website) ProtoMessage() {} func (x *Bucket_Website) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[53] + mi := &file_google_storage_v2_storage_proto_msgTypes[65] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5642,7 +6563,7 @@ func (x *Bucket_Website) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Website.ProtoReflect.Descriptor instead. func (*Bucket_Website) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 9} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 9} } func (x *Bucket_Website) GetMainPageSuffix() string { @@ -5673,7 +6594,7 @@ type Bucket_CustomPlacementConfig struct { func (x *Bucket_CustomPlacementConfig) Reset() { *x = Bucket_CustomPlacementConfig{} - mi := &file_google_storage_v2_storage_proto_msgTypes[54] + mi := &file_google_storage_v2_storage_proto_msgTypes[66] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5685,7 +6606,7 @@ func (x *Bucket_CustomPlacementConfig) String() string { func (*Bucket_CustomPlacementConfig) ProtoMessage() {} func (x *Bucket_CustomPlacementConfig) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[54] + mi := &file_google_storage_v2_storage_proto_msgTypes[66] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5698,7 +6619,7 @@ func (x *Bucket_CustomPlacementConfig) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_CustomPlacementConfig.ProtoReflect.Descriptor instead. func (*Bucket_CustomPlacementConfig) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 10} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 10} } func (x *Bucket_CustomPlacementConfig) GetDataLocations() []string { @@ -5732,7 +6653,7 @@ type Bucket_Autoclass struct { func (x *Bucket_Autoclass) Reset() { *x = Bucket_Autoclass{} - mi := &file_google_storage_v2_storage_proto_msgTypes[55] + mi := &file_google_storage_v2_storage_proto_msgTypes[67] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5744,7 +6665,7 @@ func (x *Bucket_Autoclass) String() string { func (*Bucket_Autoclass) ProtoMessage() {} func (x *Bucket_Autoclass) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[55] + mi := &file_google_storage_v2_storage_proto_msgTypes[67] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5757,7 +6678,7 @@ func (x *Bucket_Autoclass) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Autoclass.ProtoReflect.Descriptor instead. func (*Bucket_Autoclass) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 11} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 11} } func (x *Bucket_Autoclass) GetEnabled() bool { @@ -5800,7 +6721,7 @@ type Bucket_HierarchicalNamespace struct { func (x *Bucket_HierarchicalNamespace) Reset() { *x = Bucket_HierarchicalNamespace{} - mi := &file_google_storage_v2_storage_proto_msgTypes[56] + mi := &file_google_storage_v2_storage_proto_msgTypes[68] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5812,7 +6733,7 @@ func (x *Bucket_HierarchicalNamespace) String() string { func (*Bucket_HierarchicalNamespace) ProtoMessage() {} func (x *Bucket_HierarchicalNamespace) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[56] + mi := &file_google_storage_v2_storage_proto_msgTypes[68] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5825,7 +6746,7 @@ func (x *Bucket_HierarchicalNamespace) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_HierarchicalNamespace.ProtoReflect.Descriptor instead. func (*Bucket_HierarchicalNamespace) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 12} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 12} } func (x *Bucket_HierarchicalNamespace) GetEnabled() bool { @@ -5853,7 +6774,7 @@ type Bucket_IamConfig_UniformBucketLevelAccess struct { func (x *Bucket_IamConfig_UniformBucketLevelAccess) Reset() { *x = Bucket_IamConfig_UniformBucketLevelAccess{} - mi := &file_google_storage_v2_storage_proto_msgTypes[58] + mi := &file_google_storage_v2_storage_proto_msgTypes[70] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5865,7 +6786,7 @@ func (x *Bucket_IamConfig_UniformBucketLevelAccess) String() string { func (*Bucket_IamConfig_UniformBucketLevelAccess) ProtoMessage() {} func (x *Bucket_IamConfig_UniformBucketLevelAccess) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[58] + mi := &file_google_storage_v2_storage_proto_msgTypes[70] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5878,7 +6799,7 @@ func (x *Bucket_IamConfig_UniformBucketLevelAccess) ProtoReflect() protoreflect. // Deprecated: Use Bucket_IamConfig_UniformBucketLevelAccess.ProtoReflect.Descriptor instead. func (*Bucket_IamConfig_UniformBucketLevelAccess) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 3, 0} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 3, 0} } func (x *Bucket_IamConfig_UniformBucketLevelAccess) GetEnabled() bool { @@ -5910,7 +6831,7 @@ type Bucket_Lifecycle_Rule struct { func (x *Bucket_Lifecycle_Rule) Reset() { *x = Bucket_Lifecycle_Rule{} - mi := &file_google_storage_v2_storage_proto_msgTypes[59] + mi := &file_google_storage_v2_storage_proto_msgTypes[71] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5922,7 +6843,7 @@ func (x *Bucket_Lifecycle_Rule) String() string { func (*Bucket_Lifecycle_Rule) ProtoMessage() {} func (x *Bucket_Lifecycle_Rule) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[59] + mi := &file_google_storage_v2_storage_proto_msgTypes[71] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5935,7 +6856,7 @@ func (x *Bucket_Lifecycle_Rule) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Lifecycle_Rule.ProtoReflect.Descriptor instead. func (*Bucket_Lifecycle_Rule) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 4, 0} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 4, 0} } func (x *Bucket_Lifecycle_Rule) GetAction() *Bucket_Lifecycle_Rule_Action { @@ -5968,7 +6889,7 @@ type Bucket_Lifecycle_Rule_Action struct { func (x *Bucket_Lifecycle_Rule_Action) Reset() { *x = Bucket_Lifecycle_Rule_Action{} - mi := &file_google_storage_v2_storage_proto_msgTypes[60] + mi := &file_google_storage_v2_storage_proto_msgTypes[72] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5980,7 +6901,7 @@ func (x *Bucket_Lifecycle_Rule_Action) String() string { func (*Bucket_Lifecycle_Rule_Action) ProtoMessage() {} func (x *Bucket_Lifecycle_Rule_Action) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[60] + mi := &file_google_storage_v2_storage_proto_msgTypes[72] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5993,7 +6914,7 @@ func (x *Bucket_Lifecycle_Rule_Action) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Lifecycle_Rule_Action.ProtoReflect.Descriptor instead. func (*Bucket_Lifecycle_Rule_Action) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 4, 0, 0} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 4, 0, 0} } func (x *Bucket_Lifecycle_Rule_Action) GetType() string { @@ -6064,7 +6985,7 @@ type Bucket_Lifecycle_Rule_Condition struct { func (x *Bucket_Lifecycle_Rule_Condition) Reset() { *x = Bucket_Lifecycle_Rule_Condition{} - mi := &file_google_storage_v2_storage_proto_msgTypes[61] + mi := &file_google_storage_v2_storage_proto_msgTypes[73] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6076,7 +6997,7 @@ func (x *Bucket_Lifecycle_Rule_Condition) String() string { func (*Bucket_Lifecycle_Rule_Condition) ProtoMessage() {} func (x *Bucket_Lifecycle_Rule_Condition) ProtoReflect() protoreflect.Message { - mi := &file_google_storage_v2_storage_proto_msgTypes[61] + mi := &file_google_storage_v2_storage_proto_msgTypes[73] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6089,7 +7010,7 @@ func (x *Bucket_Lifecycle_Rule_Condition) ProtoReflect() protoreflect.Message { // Deprecated: Use Bucket_Lifecycle_Rule_Condition.ProtoReflect.Descriptor instead. func (*Bucket_Lifecycle_Rule_Condition) Descriptor() ([]byte, []int) { - return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{31, 4, 0, 1} + return file_google_storage_v2_storage_proto_rawDescGZIP(), []int{43, 4, 0, 1} } func (x *Bucket_Lifecycle_Rule_Condition) GetAgeDays() int32 { @@ -6194,13 +7115,103 @@ var file_google_storage_v2_storage_proto_rawDesc = []byte{ 0x65, 0x6c, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, - 0x16, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x2f, 0x64, 0x61, 0x74, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x8d, 0x02, 0x0a, 0x13, 0x44, 0x65, 0x6c, 0x65, - 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, - 0x39, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, - 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, + 0x17, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x72, 0x70, 0x63, 0x2f, 0x73, 0x74, 0x61, 0x74, + 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x16, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2f, 0x74, 0x79, 0x70, 0x65, 0x2f, 0x64, 0x61, 0x74, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x22, 0x8d, 0x02, 0x0a, 0x13, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x39, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, + 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, + 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, + 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, + 0x68, 0x88, 0x01, 0x01, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, + 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x22, 0xd6, 0x02, 0x0a, 0x10, 0x47, 0x65, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x39, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x03, 0x48, 0x00, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, + 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x03, 0x20, 0x01, + 0x28, 0x03, 0x48, 0x01, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, + 0x01, 0x12, 0x3c, 0x0a, 0x09, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x05, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, + 0x48, 0x02, 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x42, + 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, + 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x0c, 0x0a, 0x0a, 0x5f, + 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x22, 0x93, 0x02, 0x0a, 0x13, 0x43, 0x72, + 0x65, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, + 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x12, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, + 0x12, 0x31, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x12, 0x20, 0x0a, 0x09, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x69, 0x64, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x08, 0x62, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x49, 0x64, 0x12, 0x25, 0x0a, 0x0e, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, + 0x6e, 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, + 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, 0x63, 0x6c, 0x12, 0x41, 0x0a, 0x1d, + 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, + 0x6c, 0x74, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x07, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x1a, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x44, + 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x41, 0x63, 0x6c, 0x22, + 0xf3, 0x01, 0x0a, 0x12, 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x12, 0x1d, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, + 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x70, + 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, + 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, + 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, + 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x06, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x3c, 0x0a, 0x09, 0x72, 0x65, 0x61, + 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, + 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x48, 0x00, 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, + 0x4d, 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x42, 0x0c, 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, + 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x22, 0x72, 0x0a, 0x13, 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x33, 0x0a, 0x07, + 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x19, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, + 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x07, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, + 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, + 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0x9e, 0x01, 0x0a, 0x20, 0x4c, 0x6f, + 0x63, 0x6b, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, + 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, + 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, + 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, + 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x3b, 0x0a, + 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, + 0xe0, 0x41, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xb6, 0x03, 0x0a, 0x13, 0x55, + 0x70, 0x64, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x12, 0x36, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x42, 0x03, 0xe0, + 0x41, 0x02, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, @@ -6208,441 +7219,640 @@ var file_google_storage_v2_storage_proto_rawDesc = []byte{ 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x42, 0x1a, 0x0a, 0x18, 0x5f, - 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, - 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, - 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xd6, 0x02, 0x0a, 0x10, 0x47, 0x65, 0x74, 0x42, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x39, 0x0a, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, - 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, - 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, - 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, + 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x25, 0x0a, 0x0e, 0x70, + 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x08, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, + 0x63, 0x6c, 0x12, 0x41, 0x0a, 0x1d, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, + 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, + 0x61, 0x63, 0x6c, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x1a, 0x70, 0x72, 0x65, 0x64, 0x65, + 0x66, 0x69, 0x6e, 0x65, 0x64, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x41, 0x63, 0x6c, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, + 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, + 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x75, 0x70, 0x64, + 0x61, 0x74, 0x65, 0x4d, 0x61, 0x73, 0x6b, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, + 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, + 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, - 0x74, 0x63, 0x68, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x18, 0x69, 0x66, 0x4d, - 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, - 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3c, 0x0a, 0x09, 0x72, 0x65, 0x61, 0x64, - 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x48, 0x02, 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, - 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, - 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x42, 0x0c, 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, - 0x22, 0x93, 0x02, 0x0a, 0x13, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, - 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, - 0x12, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, - 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x31, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, - 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x20, 0x0a, 0x09, 0x62, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, - 0x41, 0x02, 0x52, 0x08, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x49, 0x64, 0x12, 0x25, 0x0a, 0x0e, - 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x06, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, - 0x41, 0x63, 0x6c, 0x12, 0x41, 0x0a, 0x1d, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, - 0x64, 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, - 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x1a, 0x70, 0x72, 0x65, 0x64, - 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x4f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x41, 0x63, 0x6c, 0x22, 0xf3, 0x01, 0x0a, 0x12, 0x4c, 0x69, 0x73, 0x74, 0x42, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, - 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, - 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x12, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x09, - 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, - 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, - 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, - 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x70, 0x72, 0x65, 0x66, - 0x69, 0x78, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, - 0x12, 0x3c, 0x0a, 0x09, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x05, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x48, - 0x00, 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x42, 0x0c, - 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x22, 0x72, 0x0a, 0x13, - 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, - 0x6e, 0x73, 0x65, 0x12, 0x33, 0x0a, 0x07, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x18, 0x01, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, - 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, - 0x07, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, - 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, - 0x22, 0x9e, 0x01, 0x0a, 0x20, 0x4c, 0x6f, 0x63, 0x6b, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, - 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, - 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, - 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, + 0x74, 0x63, 0x68, 0x22, 0xc3, 0x07, 0x0a, 0x14, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x4f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x40, 0x0a, 0x0b, + 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x42, 0x03, 0xe0, 0x41, + 0x02, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x5b, + 0x0a, 0x0e, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, + 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x70, 0x6f, + 0x73, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, + 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x0d, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x12, 0x3c, 0x0a, 0x1a, 0x64, + 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x65, 0x64, 0x65, + 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x18, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x65, 0x64, + 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, 0x63, 0x6c, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, + 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, + 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, + 0x01, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3f, 0x0a, 0x07, 0x6b, + 0x6d, 0x73, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x26, 0xfa, 0x41, + 0x23, 0x0a, 0x21, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x6b, 0x6d, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, + 0x6f, 0x4b, 0x65, 0x79, 0x52, 0x06, 0x6b, 0x6d, 0x73, 0x4b, 0x65, 0x79, 0x12, 0x6d, 0x0a, 0x1c, + 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x07, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, + 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x4d, 0x0a, 0x10, 0x6f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, + 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x1a, 0xa8, 0x02, 0x0a, 0x0c, 0x53, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x17, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, + 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1e, 0x0a, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x7b, 0x0a, 0x14, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x70, + 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x48, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x53, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x50, + 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x13, 0x6f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, + 0x73, 0x1a, 0x62, 0x0a, 0x13, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x50, 0x72, 0x65, 0x63, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, - 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x22, 0xb6, 0x03, 0x0a, 0x13, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, - 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x36, 0x0a, 0x06, 0x62, 0x75, 0x63, - 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x03, 0x48, 0x00, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, - 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, - 0x01, 0x01, 0x12, 0x25, 0x0a, 0x0e, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, - 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, 0x65, 0x64, - 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, 0x63, 0x6c, 0x12, 0x41, 0x0a, 0x1d, 0x70, 0x72, 0x65, - 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, - 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x1a, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x44, 0x65, 0x66, 0x61, - 0x75, 0x6c, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x41, 0x63, 0x6c, 0x12, 0x40, 0x0a, 0x0b, - 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x06, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x42, 0x03, 0xe0, - 0x41, 0x02, 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, 0x61, 0x73, 0x6b, 0x42, 0x1a, - 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, + 0x01, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x42, 0x16, 0x0a, + 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, + 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xe2, 0x04, 0x0a, 0x13, 0x44, 0x65, + 0x6c, 0x65, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, + 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x12, 0x1b, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x1e, 0x0a, + 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x03, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x33, 0x0a, + 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, + 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, + 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, + 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, + 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, + 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, + 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xc3, 0x07, 0x0a, 0x14, 0x43, - 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x12, 0x40, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x5b, 0x0a, 0x0e, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, - 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, - 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x52, 0x0d, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x73, 0x12, 0x3c, 0x0a, 0x1a, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, - 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x18, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, 0x63, 0x6c, - 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, - 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, - 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, - 0x01, 0x01, 0x12, 0x3f, 0x0a, 0x07, 0x6b, 0x6d, 0x73, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x06, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x26, 0xfa, 0x41, 0x23, 0x0a, 0x21, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x6b, - 0x6d, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, - 0x6d, 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x4b, 0x65, 0x79, 0x52, 0x06, 0x6b, 0x6d, 0x73, - 0x4b, 0x65, 0x79, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, - 0x61, 0x6d, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, - 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, - 0x6d, 0x73, 0x12, 0x4d, 0x0a, 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x63, 0x68, 0x65, - 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, - 0x52, 0x0f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, - 0x73, 0x1a, 0xa8, 0x02, 0x0a, 0x0c, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1e, 0x0a, 0x0a, 0x67, - 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, - 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x7b, 0x0a, 0x14, 0x6f, - 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x70, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x48, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, - 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2e, - 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x52, 0x13, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x50, 0x72, 0x65, 0x63, 0x6f, - 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x62, 0x0a, 0x13, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, - 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, - 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x88, 0x01, 0x01, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x16, 0x0a, 0x14, - 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, + 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, + 0x48, 0x03, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, + 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, + 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, + 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, + 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x42, 0x16, + 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, + 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xd3, + 0x05, 0x0a, 0x14, 0x52, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, + 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, + 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x1b, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x12, 0x23, 0x0a, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x28, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x74, + 0x6f, 0x72, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x42, + 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x54, 0x6f, 0x6b, + 0x65, 0x6e, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x48, + 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, + 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, + 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, + 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, + 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, + 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, + 0x68, 0x88, 0x01, 0x01, 0x12, 0x2b, 0x0a, 0x0f, 0x63, 0x6f, 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x09, 0x20, 0x01, 0x28, 0x08, 0x48, 0x04, 0x52, + 0x0d, 0x63, 0x6f, 0x70, 0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x41, 0x63, 0x6c, 0x88, 0x01, + 0x01, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, + 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, + 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, + 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, + 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, + 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x22, 0xe2, 0x04, 0x0a, 0x13, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, - 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, - 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, - 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x1b, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x12, 0x1e, 0x0a, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, - 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, + 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x42, 0x12, 0x0a, 0x10, 0x5f, 0x63, 0x6f, 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x5f, 0x61, 0x63, 0x6c, 0x22, 0x3f, 0x0a, 0x1b, 0x43, 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x52, 0x65, + 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x12, 0x20, 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x08, 0x75, 0x70, 0x6c, + 0x6f, 0x61, 0x64, 0x49, 0x64, 0x22, 0x1e, 0x0a, 0x1c, 0x43, 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x52, + 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x73, + 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0xec, 0x05, 0x0a, 0x11, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, + 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, + 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x1b, 0x0a, 0x06, 0x6f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, + 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x1e, 0x0a, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0a, 0x67, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x0a, 0x0b, 0x72, 0x65, 0x61, 0x64, 0x5f, + 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0a, 0x72, 0x65, + 0x61, 0x64, 0x4f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65, 0x61, 0x64, + 0x5f, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, 0x09, 0x72, 0x65, + 0x61, 0x64, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, + 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, + 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, + 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, + 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, + 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, + 0x74, 0x63, 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, + 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, + 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, - 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, - 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, - 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, - 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, - 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, - 0x61, 0x72, 0x61, 0x6d, 0x73, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, - 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, - 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, - 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xd3, 0x05, 0x0a, 0x14, 0x52, 0x65, 0x73, 0x74, 0x6f, 0x72, - 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, - 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, - 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x1b, 0x0a, - 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, - 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x23, 0x0a, 0x0a, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, - 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, - 0x28, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, - 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0c, 0x72, 0x65, 0x73, - 0x74, 0x6f, 0x72, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, - 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, - 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, - 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, - 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, 0x69, - 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, - 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, + 0x61, 0x74, 0x63, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x18, 0x69, 0x66, + 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, + 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, + 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, + 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x3c, 0x0a, 0x09, 0x72, 0x65, 0x61, 0x64, + 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, + 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x48, 0x04, 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, + 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, + 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, + 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x18, - 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x2b, 0x0a, 0x0f, 0x63, - 0x6f, 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x09, - 0x20, 0x01, 0x28, 0x08, 0x48, 0x04, 0x52, 0x0d, 0x63, 0x6f, 0x70, 0x79, 0x53, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x41, 0x63, 0x6c, 0x88, 0x01, 0x01, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x0c, 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, 0x5f, + 0x6d, 0x61, 0x73, 0x6b, 0x22, 0x8e, 0x06, 0x0a, 0x10, 0x47, 0x65, 0x74, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, + 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x1b, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x6f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x1e, 0x0a, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x26, 0x0a, 0x0c, 0x73, 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, + 0x6c, 0x65, 0x74, 0x65, 0x64, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x0b, 0x73, + 0x6f, 0x66, 0x74, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x64, 0x88, 0x01, 0x01, 0x12, 0x33, 0x0a, + 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, + 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x11, 0x69, 0x66, + 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, + 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, + 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, + 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x48, + 0x03, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, + 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, + 0x48, 0x04, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, + 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, + 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, + 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, + 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x3c, + 0x0a, 0x09, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x48, 0x05, 0x52, + 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x12, 0x28, 0x0a, 0x0d, + 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0c, 0x20, + 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, + 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x42, 0x0f, 0x0a, 0x0d, 0x5f, 0x73, 0x6f, 0x66, 0x74, 0x5f, + 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x64, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, - 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x12, 0x0a, 0x10, 0x5f, 0x63, 0x6f, 0x70, 0x79, - 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x61, 0x63, 0x6c, 0x22, 0x3f, 0x0a, 0x1b, 0x43, - 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, - 0x69, 0x74, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x20, 0x0a, 0x09, 0x75, 0x70, - 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, - 0x41, 0x02, 0x52, 0x08, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x49, 0x64, 0x22, 0x1e, 0x0a, 0x1c, - 0x43, 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, - 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0xec, 0x05, 0x0a, - 0x11, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, - 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, - 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x12, 0x1b, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x1e, - 0x0a, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x03, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1f, - 0x0a, 0x0b, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x18, 0x04, 0x20, - 0x01, 0x28, 0x03, 0x52, 0x0a, 0x72, 0x65, 0x61, 0x64, 0x4f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x12, - 0x1d, 0x0a, 0x0a, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x18, 0x05, 0x20, - 0x01, 0x28, 0x03, 0x52, 0x09, 0x72, 0x65, 0x61, 0x64, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, 0x33, - 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, - 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, - 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, - 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, - 0x48, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, - 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, - 0x03, 0x48, 0x03, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, - 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, - 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, - 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, - 0x3c, 0x0a, 0x09, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x0c, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x48, 0x04, - 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x42, 0x16, 0x0a, - 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, - 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x0c, 0x0a, - 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x22, 0x8e, 0x06, 0x0a, 0x10, - 0x47, 0x65, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, - 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, - 0x1b, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, - 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x1e, 0x0a, 0x0a, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, - 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x26, 0x0a, 0x0c, - 0x73, 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x64, 0x18, 0x0b, 0x20, 0x01, - 0x28, 0x08, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x6f, 0x66, 0x74, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, - 0x64, 0x88, 0x01, 0x01, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x03, 0x48, 0x01, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, + 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x0c, 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, + 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x22, 0xaf, 0x02, 0x0a, 0x12, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x4d, 0x0a, 0x10, + 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x5f, 0x64, 0x61, 0x74, 0x61, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, + 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x52, 0x0f, 0x63, 0x68, 0x65, 0x63, + 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x12, 0x4d, 0x0a, 0x10, 0x6f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x12, 0x44, 0x0a, 0x0d, 0x63, 0x6f, + 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x52, 0x61, 0x6e, + 0x67, 0x65, 0x52, 0x0c, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x52, 0x61, 0x6e, 0x67, 0x65, + 0x12, 0x35, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x04, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x08, 0x6d, + 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x22, 0xc6, 0x06, 0x0a, 0x12, 0x42, 0x69, 0x64, 0x69, + 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, 0x3d, + 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, + 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, + 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x1b, 0x0a, + 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, + 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x1e, 0x0a, 0x0a, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0a, + 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, + 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, + 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, + 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, + 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, + 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, + 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, + 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, + 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, + 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x6d, 0x0a, 0x1c, + 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x08, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, + 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x40, 0x0a, 0x09, 0x72, + 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x42, 0x02, 0x18, 0x01, 0x48, 0x04, + 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x12, 0x47, 0x0a, + 0x0b, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x18, 0x0d, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, 0x64, 0x48, + 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x48, 0x05, 0x52, 0x0a, 0x72, 0x65, 0x61, 0x64, 0x48, 0x61, 0x6e, + 0x64, 0x6c, 0x65, 0x88, 0x01, 0x01, 0x12, 0x28, 0x0a, 0x0d, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, + 0x67, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x09, 0x48, 0x06, 0x52, + 0x0c, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x88, 0x01, 0x01, + 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x14, 0x69, 0x66, - 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, - 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, + 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, - 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, 0x04, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, - 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, - 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, - 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x3c, 0x0a, 0x09, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, - 0x73, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x4d, 0x61, 0x73, 0x6b, 0x48, 0x05, 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, 0x61, 0x73, 0x6b, - 0x88, 0x01, 0x01, 0x12, 0x28, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x5f, 0x74, - 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, - 0x0c, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x42, 0x0f, 0x0a, - 0x0d, 0x5f, 0x73, 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x64, 0x42, 0x16, - 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, - 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x0c, - 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x22, 0xaf, 0x02, 0x0a, - 0x12, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, - 0x6e, 0x73, 0x65, 0x12, 0x4d, 0x0a, 0x10, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, - 0x65, 0x64, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, + 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x42, 0x0c, 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x42, 0x0e, + 0x0a, 0x0c, 0x5f, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x42, 0x10, + 0x0a, 0x0e, 0x5f, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, + 0x22, 0xa7, 0x01, 0x0a, 0x15, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x4f, 0x0a, 0x10, 0x72, 0x65, + 0x61, 0x64, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, + 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x52, 0x0e, 0x72, 0x65, 0x61, + 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, 0x3d, 0x0a, 0x0b, 0x72, + 0x65, 0x61, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x73, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x61, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0a, + 0x72, 0x65, 0x61, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x73, 0x22, 0xe5, 0x01, 0x0a, 0x16, 0x42, + 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, + 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x50, 0x0a, 0x12, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, + 0x64, 0x61, 0x74, 0x61, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, + 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x61, 0x6e, 0x67, + 0x65, 0x44, 0x61, 0x74, 0x61, 0x52, 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x44, 0x61, 0x74, + 0x61, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, + 0x61, 0x74, 0x61, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x42, + 0x0a, 0x0b, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x18, 0x07, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, 0x64, + 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x52, 0x0a, 0x72, 0x65, 0x61, 0x64, 0x48, 0x61, 0x6e, 0x64, + 0x6c, 0x65, 0x22, 0x9f, 0x01, 0x0a, 0x1d, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, 0x64, 0x4f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x65, 0x64, 0x45, + 0x72, 0x72, 0x6f, 0x72, 0x12, 0x42, 0x0a, 0x0b, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x68, 0x61, 0x6e, + 0x64, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, + 0x64, 0x69, 0x52, 0x65, 0x61, 0x64, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x52, 0x0a, 0x72, 0x65, + 0x61, 0x64, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x12, 0x28, 0x0a, 0x0d, 0x72, 0x6f, 0x75, 0x74, + 0x69, 0x6e, 0x67, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x48, + 0x00, 0x52, 0x0c, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x88, + 0x01, 0x01, 0x42, 0x10, 0x0a, 0x0e, 0x5f, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x74, + 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xed, 0x01, 0x0a, 0x1e, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, + 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, + 0x65, 0x64, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x28, 0x0a, 0x0d, 0x72, 0x6f, 0x75, 0x74, 0x69, + 0x6e, 0x67, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, + 0x52, 0x0c, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x88, 0x01, + 0x01, 0x12, 0x4a, 0x0a, 0x0c, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x6c, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, + 0x57, 0x72, 0x69, 0x74, 0x65, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x48, 0x01, 0x52, 0x0b, 0x77, + 0x72, 0x69, 0x74, 0x65, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x88, 0x01, 0x01, 0x12, 0x23, 0x0a, + 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x03, 0x48, 0x02, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x88, + 0x01, 0x01, 0x42, 0x10, 0x0a, 0x0e, 0x5f, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x74, + 0x6f, 0x6b, 0x65, 0x6e, 0x42, 0x0f, 0x0a, 0x0d, 0x5f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x68, + 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x42, 0x0d, 0x0a, 0x0b, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x64, 0x0a, 0x13, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, 0x64, + 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x4d, 0x0a, 0x11, 0x72, + 0x65, 0x61, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, + 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x61, 0x64, 0x52, + 0x61, 0x6e, 0x67, 0x65, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x52, 0x0f, 0x72, 0x65, 0x61, 0x64, 0x52, + 0x61, 0x6e, 0x67, 0x65, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x22, 0x55, 0x0a, 0x0e, 0x52, 0x65, + 0x61, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x17, 0x0a, 0x07, + 0x72, 0x65, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x52, 0x06, 0x72, + 0x65, 0x61, 0x64, 0x49, 0x64, 0x12, 0x2a, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, + 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, + 0x73, 0x22, 0x75, 0x0a, 0x09, 0x52, 0x65, 0x61, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x24, + 0x0a, 0x0b, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x72, 0x65, 0x61, 0x64, 0x4f, 0x66, + 0x66, 0x73, 0x65, 0x74, 0x12, 0x24, 0x0a, 0x0b, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6c, 0x65, 0x6e, + 0x67, 0x74, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0a, + 0x72, 0x65, 0x61, 0x64, 0x4c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x12, 0x1c, 0x0a, 0x07, 0x72, 0x65, + 0x61, 0x64, 0x5f, 0x69, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, + 0x52, 0x06, 0x72, 0x65, 0x61, 0x64, 0x49, 0x64, 0x22, 0xba, 0x01, 0x0a, 0x0f, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x44, 0x61, 0x74, 0x61, 0x12, 0x4d, 0x0a, 0x10, + 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x5f, 0x64, 0x61, 0x74, 0x61, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, + 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x52, 0x0f, 0x63, 0x68, 0x65, 0x63, + 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x12, 0x3b, 0x0a, 0x0a, 0x72, + 0x65, 0x61, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, + 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x61, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x09, 0x72, + 0x65, 0x61, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x1b, 0x0a, 0x09, 0x72, 0x61, 0x6e, 0x67, + 0x65, 0x5f, 0x65, 0x6e, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x61, 0x6e, + 0x67, 0x65, 0x45, 0x6e, 0x64, 0x22, 0x2d, 0x0a, 0x0e, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, + 0x64, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x68, 0x61, 0x6e, 0x64, 0x6c, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x68, 0x61, + 0x6e, 0x64, 0x6c, 0x65, 0x22, 0x2e, 0x0a, 0x0f, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, + 0x65, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x68, 0x61, 0x6e, 0x64, 0x6c, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x68, 0x61, + 0x6e, 0x64, 0x6c, 0x65, 0x22, 0xc0, 0x04, 0x0a, 0x0f, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, 0x3a, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, + 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, + 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, 0x63, 0x6c, 0x12, 0x33, 0x0a, 0x13, 0x69, + 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, + 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x03, 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, + 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, + 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, + 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, + 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, + 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x24, 0x0a, + 0x0b, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x08, 0x20, 0x01, + 0x28, 0x03, 0x48, 0x04, 0x52, 0x0a, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x69, 0x7a, 0x65, + 0x88, 0x01, 0x01, 0x12, 0x23, 0x0a, 0x0a, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x61, 0x62, 0x6c, + 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x08, 0x48, 0x05, 0x52, 0x0a, 0x61, 0x70, 0x70, 0x65, 0x6e, + 0x64, 0x61, 0x62, 0x6c, 0x65, 0x88, 0x01, 0x01, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, + 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, + 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, + 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, + 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x0e, 0x0a, 0x0c, 0x5f, 0x6f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x42, 0x0d, 0x0a, 0x0b, 0x5f, 0x61, 0x70, 0x70, + 0x65, 0x6e, 0x64, 0x61, 0x62, 0x6c, 0x65, 0x22, 0xf8, 0x03, 0x0a, 0x12, 0x57, 0x72, 0x69, 0x74, + 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x1d, + 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x48, 0x00, 0x52, 0x08, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x49, 0x64, 0x12, 0x50, 0x0a, + 0x11, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x70, + 0x65, 0x63, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x57, 0x72, 0x69, + 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x48, 0x00, 0x52, 0x0f, + 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, + 0x26, 0x0a, 0x0c, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x77, 0x72, 0x69, 0x74, + 0x65, 0x4f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x12, 0x4f, 0x0a, 0x10, 0x63, 0x68, 0x65, 0x63, 0x6b, + 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, + 0x64, 0x44, 0x61, 0x74, 0x61, 0x48, 0x01, 0x52, 0x0f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, + 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x12, 0x4d, 0x0a, 0x10, 0x6f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x06, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, + 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, + 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x66, 0x69, 0x6e, 0x69, 0x73, + 0x68, 0x5f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, 0x66, + 0x69, 0x6e, 0x69, 0x73, 0x68, 0x57, 0x72, 0x69, 0x74, 0x65, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, + 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, + 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x42, 0x0f, 0x0a, 0x0d, 0x66, 0x69, 0x72, + 0x73, 0x74, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x42, 0x06, 0x0a, 0x04, 0x64, 0x61, + 0x74, 0x61, 0x22, 0x87, 0x01, 0x0a, 0x13, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x27, 0x0a, 0x0e, 0x70, 0x65, + 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x03, 0x48, 0x00, 0x52, 0x0d, 0x70, 0x65, 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x53, + 0x69, 0x7a, 0x65, 0x12, 0x37, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x48, 0x00, 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x0e, 0x0a, 0x0c, + 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x22, 0xe9, 0x03, 0x0a, + 0x10, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, + 0x63, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x12, 0x1b, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x23, 0x0a, + 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, + 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, + 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, + 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x88, 0x01, 0x01, 0x12, 0x28, 0x0a, 0x0d, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x74, + 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x48, 0x02, 0x52, 0x0c, 0x72, 0x6f, + 0x75, 0x74, 0x69, 0x6e, 0x67, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x88, 0x01, 0x01, 0x12, 0x4a, 0x0a, + 0x0c, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x18, 0x07, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, + 0x65, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x48, 0x03, 0x52, 0x0b, 0x77, 0x72, 0x69, 0x74, 0x65, + 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x88, 0x01, 0x01, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, + 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, + 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, + 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x10, 0x0a, 0x0e, 0x5f, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, + 0x67, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x42, 0x0f, 0x0a, 0x0d, 0x5f, 0x77, 0x72, 0x69, 0x74, + 0x65, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x22, 0x8a, 0x05, 0x0a, 0x16, 0x42, 0x69, 0x64, + 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x12, 0x1d, 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x08, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, + 0x49, 0x64, 0x12, 0x50, 0x0a, 0x11, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, - 0x32, 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, - 0x61, 0x52, 0x0f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, + 0x32, 0x2e, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, + 0x63, 0x48, 0x00, 0x52, 0x0f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x53, 0x70, 0x65, 0x63, 0x12, 0x53, 0x0a, 0x12, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x5f, 0x6f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x53, 0x70, 0x65, 0x63, 0x48, 0x00, 0x52, 0x10, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x4f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, 0x26, 0x0a, 0x0c, 0x77, 0x72, 0x69, + 0x74, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x66, 0x66, 0x73, 0x65, + 0x74, 0x12, 0x4f, 0x0a, 0x10, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, + 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x48, + 0x01, 0x52, 0x0f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x12, 0x4d, 0x0a, 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x63, 0x68, 0x65, - 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, + 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, - 0x73, 0x12, 0x44, 0x0a, 0x0d, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x72, 0x61, 0x6e, - 0x67, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6e, - 0x74, 0x65, 0x6e, 0x74, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0c, 0x63, 0x6f, 0x6e, 0x74, 0x65, - 0x6e, 0x74, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x35, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, - 0x61, 0x74, 0x61, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x22, 0x8c, - 0x04, 0x0a, 0x0f, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, - 0x65, 0x63, 0x12, 0x3a, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, - 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x42, - 0x03, 0xe0, 0x41, 0x02, 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x25, - 0x0a, 0x0e, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, - 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, - 0x65, 0x64, 0x41, 0x63, 0x6c, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, - 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x14, 0x69, - 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, - 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, - 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, - 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, - 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x24, 0x0a, 0x0b, 0x6f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, 0x48, 0x04, 0x52, 0x0a, - 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x69, 0x7a, 0x65, 0x88, 0x01, 0x01, 0x42, 0x16, 0x0a, - 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, - 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x0e, 0x0a, - 0x0c, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x22, 0xf8, 0x03, - 0x0a, 0x12, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x12, 0x1d, 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, - 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x08, 0x75, 0x70, 0x6c, 0x6f, 0x61, - 0x64, 0x49, 0x64, 0x12, 0x50, 0x0a, 0x11, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x76, 0x32, 0x2e, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, - 0x65, 0x63, 0x48, 0x00, 0x52, 0x0f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, 0x26, 0x0a, 0x0c, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, - 0x66, 0x66, 0x73, 0x65, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, - 0x52, 0x0b, 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x12, 0x4f, 0x0a, - 0x10, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x5f, 0x64, 0x61, 0x74, - 0x61, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x48, 0x01, 0x52, 0x0f, 0x63, - 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x12, 0x4d, - 0x0a, 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, - 0x6d, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x12, 0x21, 0x0a, - 0x0c, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x5f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x18, 0x07, 0x20, - 0x01, 0x28, 0x08, 0x52, 0x0b, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x57, 0x72, 0x69, 0x74, 0x65, - 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, - 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, - 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x42, - 0x0f, 0x0a, 0x0d, 0x66, 0x69, 0x72, 0x73, 0x74, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, - 0x42, 0x06, 0x0a, 0x04, 0x64, 0x61, 0x74, 0x61, 0x22, 0x87, 0x01, 0x0a, 0x13, 0x57, 0x72, 0x69, - 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, + 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x74, 0x61, 0x74, 0x65, 0x5f, 0x6c, 0x6f, 0x6f, 0x6b, 0x75, + 0x70, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x65, 0x4c, 0x6f, + 0x6f, 0x6b, 0x75, 0x70, 0x12, 0x14, 0x0a, 0x05, 0x66, 0x6c, 0x75, 0x73, 0x68, 0x18, 0x08, 0x20, + 0x01, 0x28, 0x08, 0x52, 0x05, 0x66, 0x6c, 0x75, 0x73, 0x68, 0x12, 0x21, 0x0a, 0x0c, 0x66, 0x69, + 0x6e, 0x69, 0x73, 0x68, 0x5f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x08, + 0x52, 0x0b, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x57, 0x72, 0x69, 0x74, 0x65, 0x12, 0x6d, 0x0a, + 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x0a, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, + 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x42, 0x0f, 0x0a, 0x0d, + 0x66, 0x69, 0x72, 0x73, 0x74, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x42, 0x06, 0x0a, + 0x04, 0x64, 0x61, 0x74, 0x61, 0x22, 0xe8, 0x01, 0x0a, 0x17, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, + 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, + 0x65, 0x12, 0x27, 0x0a, 0x0e, 0x70, 0x65, 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x73, + 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x0d, 0x70, 0x65, 0x72, + 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x37, 0x0a, 0x08, 0x72, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, + 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x48, 0x00, 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x12, 0x4a, 0x0a, 0x0c, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x68, 0x61, 0x6e, + 0x64, 0x6c, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, + 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x48, 0x01, 0x52, + 0x0b, 0x77, 0x72, 0x69, 0x74, 0x65, 0x48, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x88, 0x01, 0x01, 0x42, + 0x0e, 0x0a, 0x0c, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x42, + 0x0f, 0x0a, 0x0d, 0x5f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, + 0x22, 0xe3, 0x04, 0x0a, 0x12, 0x4c, 0x69, 0x73, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, + 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, + 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, + 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, + 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, + 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, + 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, + 0x65, 0x6e, 0x12, 0x1c, 0x0a, 0x09, 0x64, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x72, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x64, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x72, + 0x12, 0x3c, 0x0a, 0x1a, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x5f, 0x74, 0x72, 0x61, 0x69, + 0x6c, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x72, 0x18, 0x05, + 0x20, 0x01, 0x28, 0x08, 0x52, 0x18, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x54, 0x72, 0x61, + 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x44, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x72, 0x12, 0x16, + 0x0a, 0x06, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, + 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x1a, 0x0a, 0x08, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, + 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, + 0x6e, 0x73, 0x12, 0x3c, 0x0a, 0x09, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, + 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, + 0x6b, 0x48, 0x00, 0x52, 0x08, 0x72, 0x65, 0x61, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, + 0x12, 0x34, 0x0a, 0x13, 0x6c, 0x65, 0x78, 0x69, 0x63, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, + 0x63, 0x5f, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, + 0x41, 0x01, 0x52, 0x12, 0x6c, 0x65, 0x78, 0x69, 0x63, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, + 0x63, 0x53, 0x74, 0x61, 0x72, 0x74, 0x12, 0x30, 0x0a, 0x11, 0x6c, 0x65, 0x78, 0x69, 0x63, 0x6f, + 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x5f, 0x65, 0x6e, 0x64, 0x18, 0x0b, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x10, 0x6c, 0x65, 0x78, 0x69, 0x63, 0x6f, 0x67, 0x72, + 0x61, 0x70, 0x68, 0x69, 0x63, 0x45, 0x6e, 0x64, 0x12, 0x26, 0x0a, 0x0c, 0x73, 0x6f, 0x66, 0x74, + 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x64, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x08, 0x42, 0x03, + 0xe0, 0x41, 0x01, 0x52, 0x0b, 0x73, 0x6f, 0x66, 0x74, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x64, + 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x5f, 0x66, 0x6f, 0x6c, 0x64, + 0x65, 0x72, 0x73, 0x5f, 0x61, 0x73, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x65, 0x73, 0x18, + 0x0d, 0x20, 0x01, 0x28, 0x08, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x18, 0x69, 0x6e, 0x63, 0x6c, + 0x75, 0x64, 0x65, 0x46, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x41, 0x73, 0x50, 0x72, 0x65, 0x66, + 0x69, 0x78, 0x65, 0x73, 0x12, 0x22, 0x0a, 0x0a, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x5f, 0x67, 0x6c, + 0x6f, 0x62, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x6d, + 0x61, 0x74, 0x63, 0x68, 0x47, 0x6c, 0x6f, 0x62, 0x42, 0x0c, 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, + 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x22, 0xaa, 0x01, 0x0a, 0x17, 0x51, 0x75, 0x65, 0x72, 0x79, + 0x57, 0x72, 0x69, 0x74, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x12, 0x20, 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x08, 0x75, 0x70, 0x6c, 0x6f, + 0x61, 0x64, 0x49, 0x64, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, + 0x72, 0x61, 0x6d, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, + 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, + 0x61, 0x6d, 0x73, 0x22, 0x8c, 0x01, 0x0a, 0x18, 0x51, 0x75, 0x65, 0x72, 0x79, 0x57, 0x72, 0x69, + 0x74, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x27, 0x0a, 0x0e, 0x70, 0x65, 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x0d, 0x70, 0x65, 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x37, 0x0a, 0x08, 0x72, 0x65, 0x73, @@ -6650,216 +7860,183 @@ var file_google_storage_v2_storage_proto_rawDesc = []byte{ 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x48, 0x00, 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x0e, 0x0a, 0x0c, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x22, 0xb5, 0x04, 0x0a, 0x16, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, - 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x1d, 0x0a, - 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x48, 0x00, 0x52, 0x08, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x49, 0x64, 0x12, 0x50, 0x0a, 0x11, - 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x70, 0x65, - 0x63, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x57, 0x72, 0x69, 0x74, - 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x48, 0x00, 0x52, 0x0f, 0x77, - 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, 0x26, - 0x0a, 0x0c, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x77, 0x72, 0x69, 0x74, 0x65, - 0x4f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x12, 0x4f, 0x0a, 0x10, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, - 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, - 0x44, 0x61, 0x74, 0x61, 0x48, 0x01, 0x52, 0x0f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, - 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x12, 0x4d, 0x0a, 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x74, 0x61, 0x74, 0x65, 0x5f, - 0x6c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, 0x73, 0x74, - 0x61, 0x74, 0x65, 0x4c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x12, 0x14, 0x0a, 0x05, 0x66, 0x6c, 0x75, - 0x73, 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x08, 0x52, 0x05, 0x66, 0x6c, 0x75, 0x73, 0x68, 0x12, - 0x21, 0x0a, 0x0c, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x5f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x18, - 0x09, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x57, 0x72, 0x69, - 0x74, 0x65, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, - 0x6d, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, - 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, - 0x73, 0x42, 0x0f, 0x0a, 0x0d, 0x66, 0x69, 0x72, 0x73, 0x74, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, - 0x67, 0x65, 0x42, 0x06, 0x0a, 0x04, 0x64, 0x61, 0x74, 0x61, 0x22, 0x8b, 0x01, 0x0a, 0x17, 0x42, - 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, - 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x27, 0x0a, 0x0e, 0x70, 0x65, 0x72, 0x73, 0x69, 0x73, - 0x74, 0x65, 0x64, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, - 0x52, 0x0d, 0x70, 0x65, 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x53, 0x69, 0x7a, 0x65, 0x12, - 0x37, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x48, 0x00, 0x52, 0x08, - 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x0e, 0x0a, 0x0c, 0x77, 0x72, 0x69, 0x74, - 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x22, 0xe3, 0x04, 0x0a, 0x12, 0x4c, 0x69, 0x73, - 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, - 0x3d, 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, - 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x1b, - 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, - 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1c, 0x0a, 0x09, 0x64, 0x65, - 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x72, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x64, - 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x72, 0x12, 0x3c, 0x0a, 0x1a, 0x69, 0x6e, 0x63, 0x6c, - 0x75, 0x64, 0x65, 0x5f, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x65, 0x6c, - 0x69, 0x6d, 0x69, 0x74, 0x65, 0x72, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x18, 0x69, 0x6e, - 0x63, 0x6c, 0x75, 0x64, 0x65, 0x54, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x44, 0x65, 0x6c, - 0x69, 0x6d, 0x69, 0x74, 0x65, 0x72, 0x12, 0x16, 0x0a, 0x06, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, - 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x1a, - 0x0a, 0x08, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, - 0x52, 0x08, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x3c, 0x0a, 0x09, 0x72, 0x65, - 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x48, 0x00, 0x52, 0x08, 0x72, 0x65, 0x61, - 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x88, 0x01, 0x01, 0x12, 0x34, 0x0a, 0x13, 0x6c, 0x65, 0x78, 0x69, - 0x63, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x5f, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, - 0x0a, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x12, 0x6c, 0x65, 0x78, 0x69, - 0x63, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x53, 0x74, 0x61, 0x72, 0x74, 0x12, 0x30, - 0x0a, 0x11, 0x6c, 0x65, 0x78, 0x69, 0x63, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x5f, - 0x65, 0x6e, 0x64, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x10, - 0x6c, 0x65, 0x78, 0x69, 0x63, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x45, 0x6e, 0x64, - 0x12, 0x26, 0x0a, 0x0c, 0x73, 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x64, - 0x18, 0x0c, 0x20, 0x01, 0x28, 0x08, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0b, 0x73, 0x6f, 0x66, - 0x74, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x64, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x6e, 0x63, 0x6c, - 0x75, 0x64, 0x65, 0x5f, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x5f, 0x61, 0x73, 0x5f, 0x70, - 0x72, 0x65, 0x66, 0x69, 0x78, 0x65, 0x73, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x08, 0x42, 0x03, 0xe0, - 0x41, 0x01, 0x52, 0x18, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x46, 0x6f, 0x6c, 0x64, 0x65, - 0x72, 0x73, 0x41, 0x73, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x65, 0x73, 0x12, 0x22, 0x0a, 0x0a, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x5f, 0x67, 0x6c, 0x6f, 0x62, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x47, 0x6c, 0x6f, 0x62, - 0x42, 0x0c, 0x0a, 0x0a, 0x5f, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x22, 0xaa, - 0x01, 0x0a, 0x17, 0x51, 0x75, 0x65, 0x72, 0x79, 0x57, 0x72, 0x69, 0x74, 0x65, 0x53, 0x74, 0x61, - 0x74, 0x75, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x20, 0x0a, 0x09, 0x75, 0x70, - 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, - 0x41, 0x02, 0x52, 0x08, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x49, 0x64, 0x12, 0x6d, 0x0a, 0x1c, - 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, - 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, - 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x22, 0x8c, 0x01, 0x0a, 0x18, - 0x51, 0x75, 0x65, 0x72, 0x79, 0x57, 0x72, 0x69, 0x74, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, - 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x27, 0x0a, 0x0e, 0x70, 0x65, 0x72, 0x73, - 0x69, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, - 0x48, 0x00, 0x52, 0x0d, 0x70, 0x65, 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x53, 0x69, 0x7a, - 0x65, 0x12, 0x37, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, - 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x48, 0x00, - 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x0e, 0x0a, 0x0c, 0x77, 0x72, - 0x69, 0x74, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x22, 0xb5, 0x0e, 0x0a, 0x14, 0x52, - 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x12, 0x31, 0x0a, 0x10, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x18, 0x20, 0x01, 0x28, 0x09, 0x42, 0x06, 0xe0, - 0x41, 0x02, 0xe0, 0x41, 0x05, 0x52, 0x0f, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x57, 0x0a, 0x12, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x19, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x28, 0xe0, 0x41, 0x02, 0xe0, 0x41, 0x05, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, - 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, - 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x11, 0x64, 0x65, - 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, - 0x56, 0x0a, 0x13, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, - 0x6d, 0x73, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x1b, 0x20, 0x01, 0x28, 0x09, 0x42, 0x26, 0xfa, 0x41, - 0x23, 0x0a, 0x21, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x6b, 0x6d, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, - 0x6f, 0x4b, 0x65, 0x79, 0x52, 0x11, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x4b, 0x6d, 0x73, 0x4b, 0x65, 0x79, 0x12, 0x3b, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x74, 0x69, - 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4a, 0x0a, 0x0d, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x62, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, - 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, - 0x65, 0x74, 0x52, 0x0c, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, - 0x12, 0x28, 0x0a, 0x0d, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0c, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x2b, 0x0a, 0x11, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x77, 0x72, 0x69, - 0x74, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, - 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x3c, 0x0a, 0x1a, - 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x65, 0x64, - 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x1c, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x18, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x65, - 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, 0x63, 0x6c, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, - 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, - 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, - 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, - 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, - 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, - 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, - 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, - 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x40, 0x0a, 0x1a, - 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x03, - 0x48, 0x04, 0x52, 0x17, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x47, - 0x0a, 0x1e, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x18, 0x0c, 0x20, 0x01, 0x28, 0x03, 0x48, 0x05, 0x52, 0x1a, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, - 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x48, 0x0a, 0x1e, 0x69, 0x66, 0x5f, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x03, 0x48, - 0x06, 0x52, 0x1b, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4d, 0x65, 0x74, 0x61, 0x67, - 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, - 0x01, 0x12, 0x4f, 0x0a, 0x22, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, - 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, - 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x03, 0x48, 0x07, 0x52, - 0x1e, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, - 0x01, 0x01, 0x12, 0x3e, 0x0a, 0x1c, 0x6d, 0x61, 0x78, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x5f, - 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x63, 0x61, - 0x6c, 0x6c, 0x18, 0x0f, 0x20, 0x01, 0x28, 0x03, 0x52, 0x18, 0x6d, 0x61, 0x78, 0x42, 0x79, 0x74, - 0x65, 0x73, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x50, 0x65, 0x72, 0x43, 0x61, - 0x6c, 0x6c, 0x12, 0x47, 0x0a, 0x20, 0x63, 0x6f, 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x5f, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, 0x6c, 0x67, - 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x18, 0x10, 0x20, 0x01, 0x28, 0x09, 0x52, 0x1d, 0x63, 0x6f, - 0x70, 0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x41, 0x6c, 0x67, 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x12, 0x46, 0x0a, 0x20, 0x63, - 0x6f, 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x65, 0x6e, 0x63, 0x72, 0x79, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x79, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, - 0x15, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x1c, 0x63, 0x6f, 0x70, 0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x79, 0x42, 0x79, - 0x74, 0x65, 0x73, 0x12, 0x53, 0x0a, 0x27, 0x63, 0x6f, 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, 0x72, + 0x75, 0x73, 0x22, 0xb5, 0x0e, 0x0a, 0x14, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x31, 0x0a, 0x10, 0x64, + 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, + 0x18, 0x20, 0x01, 0x28, 0x09, 0x42, 0x06, 0xe0, 0x41, 0x02, 0xe0, 0x41, 0x05, 0x52, 0x0f, 0x64, + 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x57, + 0x0a, 0x12, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x62, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x18, 0x19, 0x20, 0x01, 0x28, 0x09, 0x42, 0x28, 0xe0, 0x41, 0x02, 0xe0, + 0x41, 0x05, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x52, 0x11, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x56, 0x0a, 0x13, 0x64, 0x65, 0x73, 0x74, 0x69, + 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x6d, 0x73, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x1b, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x26, 0xfa, 0x41, 0x23, 0x0a, 0x21, 0x63, 0x6c, 0x6f, 0x75, 0x64, + 0x6b, 0x6d, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x4b, 0x65, 0x79, 0x52, 0x11, 0x64, 0x65, + 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x6d, 0x73, 0x4b, 0x65, 0x79, 0x12, + 0x3b, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, + 0x0b, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4a, 0x0a, 0x0d, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x0c, 0x73, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x28, 0x0a, 0x0d, 0x73, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0c, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x12, 0x2b, 0x0a, 0x11, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, + 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, + 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x54, + 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x3c, 0x0a, 0x1a, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x61, + 0x63, 0x6c, 0x18, 0x1c, 0x20, 0x01, 0x28, 0x09, 0x52, 0x18, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, + 0x63, 0x6c, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x48, + 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, + 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x09, + 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, + 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, + 0x0a, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, + 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, + 0x68, 0x88, 0x01, 0x01, 0x12, 0x40, 0x0a, 0x1a, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x03, 0x48, 0x04, 0x52, 0x17, 0x69, 0x66, 0x53, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, + 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x47, 0x0a, 0x1e, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, + 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x03, 0x48, 0x05, + 0x52, 0x1a, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, + 0x48, 0x0a, 0x1e, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, 0x65, 0x74, + 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, + 0x68, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x03, 0x48, 0x06, 0x52, 0x1b, 0x69, 0x66, 0x53, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x4f, 0x0a, 0x22, 0x69, 0x66, 0x5f, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, + 0x0e, 0x20, 0x01, 0x28, 0x03, 0x48, 0x07, 0x52, 0x1e, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, + 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3e, 0x0a, 0x1c, 0x6d, 0x61, + 0x78, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x5f, 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, + 0x6e, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x63, 0x61, 0x6c, 0x6c, 0x18, 0x0f, 0x20, 0x01, 0x28, 0x03, + 0x52, 0x18, 0x6d, 0x61, 0x78, 0x42, 0x79, 0x74, 0x65, 0x73, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, + 0x74, 0x65, 0x6e, 0x50, 0x65, 0x72, 0x43, 0x61, 0x6c, 0x6c, 0x12, 0x47, 0x0a, 0x20, 0x63, 0x6f, + 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, 0x6c, 0x67, 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x18, 0x10, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x1d, 0x63, 0x6f, 0x70, 0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x6c, 0x67, 0x6f, 0x72, 0x69, + 0x74, 0x68, 0x6d, 0x12, 0x46, 0x0a, 0x20, 0x63, 0x6f, 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, - 0x79, 0x5f, 0x73, 0x68, 0x61, 0x32, 0x35, 0x36, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x16, - 0x20, 0x01, 0x28, 0x0c, 0x52, 0x22, 0x63, 0x6f, 0x70, 0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, - 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x79, 0x53, 0x68, 0x61, - 0x32, 0x35, 0x36, 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, + 0x79, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x1c, 0x63, + 0x6f, 0x70, 0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x79, 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x53, 0x0a, 0x27, 0x63, + 0x6f, 0x70, 0x79, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x65, 0x6e, 0x63, 0x72, 0x79, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x79, 0x5f, 0x73, 0x68, 0x61, 0x32, 0x35, 0x36, + 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x16, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x22, 0x63, 0x6f, + 0x70, 0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x4b, 0x65, 0x79, 0x53, 0x68, 0x61, 0x32, 0x35, 0x36, 0x42, 0x79, 0x74, 0x65, 0x73, + 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, + 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, + 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, + 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, + 0x4d, 0x0a, 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, + 0x75, 0x6d, 0x73, 0x18, 0x1d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x42, 0x16, + 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, + 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1d, + 0x0a, 0x1b, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x21, 0x0a, + 0x1f, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x42, 0x21, 0x0a, 0x1f, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, + 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, + 0x74, 0x63, 0x68, 0x42, 0x25, 0x0a, 0x23, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xd6, 0x01, 0x0a, 0x0f, 0x52, + 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x32, + 0x0a, 0x15, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x5f, 0x72, 0x65, + 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x52, 0x13, 0x74, + 0x6f, 0x74, 0x61, 0x6c, 0x42, 0x79, 0x74, 0x65, 0x73, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, 0x74, + 0x65, 0x6e, 0x12, 0x1f, 0x0a, 0x0b, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x69, 0x7a, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0a, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, + 0x69, 0x7a, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x64, 0x6f, 0x6e, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x08, 0x52, 0x04, 0x64, 0x6f, 0x6e, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x77, 0x72, 0x69, + 0x74, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, + 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x35, 0x0a, 0x08, + 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x4d, 0x0a, 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x1d, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, - 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, + 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x22, 0xec, 0x07, 0x0a, 0x11, 0x4d, 0x6f, 0x76, 0x65, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, + 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x28, 0x0a, 0x0d, 0x73, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0c, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x12, 0x32, 0x0a, 0x12, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, + 0xe0, 0x41, 0x02, 0x52, 0x11, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x45, 0x0a, 0x1a, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, + 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, + 0x00, 0x52, 0x17, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x4c, 0x0a, + 0x1e, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, + 0x05, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x01, 0x52, 0x1a, 0x69, 0x66, + 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x4d, 0x0a, 0x1e, 0x69, + 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, + 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x02, 0x52, 0x1b, 0x69, 0x66, 0x53, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x54, 0x0a, 0x22, 0x69, 0x66, + 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x03, 0x52, 0x1e, 0x69, + 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, + 0x12, 0x38, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, + 0x41, 0x01, 0x48, 0x04, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3f, 0x0a, 0x17, 0x69, 0x66, + 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, + 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x48, 0x05, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x40, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, - 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1d, 0x0a, 0x1b, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, + 0x01, 0x48, 0x06, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x47, 0x0a, + 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0b, 0x20, 0x01, + 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x07, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, + 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, + 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x42, 0x1d, 0x0a, 0x1b, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x21, 0x0a, 0x1f, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, @@ -6868,935 +8045,875 @@ var file_google_storage_v2_storage_proto_rawDesc = []byte{ 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x25, 0x0a, 0x23, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x22, 0xd6, 0x01, 0x0a, 0x0f, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, - 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x32, 0x0a, 0x15, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, - 0x62, 0x79, 0x74, 0x65, 0x73, 0x5f, 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x03, 0x52, 0x13, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x42, 0x79, 0x74, 0x65, - 0x73, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x12, 0x1f, 0x0a, 0x0b, 0x6f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, - 0x0a, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x64, - 0x6f, 0x6e, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x04, 0x64, 0x6f, 0x6e, 0x65, 0x12, - 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, - 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x54, - 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x35, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, - 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x22, 0xec, 0x07, 0x0a, 0x11, - 0x4d, 0x6f, 0x76, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x25, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, - 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, - 0x12, 0x28, 0x0a, 0x0d, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0c, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x32, 0x0a, 0x12, 0x64, 0x65, - 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x11, 0x64, 0x65, 0x73, - 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x45, - 0x0a, 0x1a, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, - 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x00, 0x52, 0x17, 0x69, 0x66, 0x53, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, - 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x4c, 0x0a, 0x1e, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, - 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, - 0x41, 0x01, 0x48, 0x01, 0x52, 0x1a, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x88, 0x01, 0x01, 0x12, 0x4d, 0x0a, 0x1e, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, - 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, - 0x48, 0x02, 0x52, 0x1b, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4d, 0x65, 0x74, 0x61, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, - 0x01, 0x01, 0x12, 0x54, 0x0a, 0x22, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, - 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, - 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, - 0xe0, 0x41, 0x01, 0x48, 0x03, 0x52, 0x1e, 0x69, 0x66, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4d, - 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, - 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x38, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, - 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, - 0x08, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x04, 0x52, 0x11, 0x69, 0x66, - 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, - 0x01, 0x01, 0x12, 0x3f, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x09, 0x20, - 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x05, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x88, 0x01, 0x01, 0x12, 0x40, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0a, - 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x06, 0x52, 0x15, 0x69, 0x66, 0x4d, - 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, - 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x47, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, - 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, - 0x07, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x42, 0x1d, - 0x0a, 0x1b, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x21, 0x0a, - 0x1f, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x67, 0x65, 0x6e, 0x65, + 0x63, 0x68, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, + 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, + 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x22, 0xaf, 0x02, 0x0a, 0x1a, 0x53, 0x74, 0x61, 0x72, 0x74, 0x52, 0x65, 0x73, 0x75, + 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, + 0x74, 0x12, 0x53, 0x0a, 0x11, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, + 0x2e, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, + 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, + 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, + 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, + 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, + 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, + 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x4d, 0x0a, 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, + 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, + 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, + 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, + 0x73, 0x75, 0x6d, 0x73, 0x22, 0x3a, 0x0a, 0x1b, 0x53, 0x74, 0x61, 0x72, 0x74, 0x52, 0x65, 0x73, + 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x12, 0x1b, 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x49, 0x64, + 0x22, 0x87, 0x05, 0x0a, 0x13, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x36, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, + 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, + 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x42, 0x21, 0x0a, 0x1f, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6d, - 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, - 0x74, 0x63, 0x68, 0x42, 0x25, 0x0a, 0x23, 0x5f, 0x69, 0x66, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, + 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, + 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, + 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, + 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x18, 0x69, 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, + 0x01, 0x01, 0x12, 0x25, 0x0a, 0x0e, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, + 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, 0x65, 0x64, + 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, 0x63, 0x6c, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, 0x64, + 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, + 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, 0x61, 0x73, 0x6b, 0x12, 0x6d, 0x0a, 0x1c, 0x63, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, + 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xaf, 0x02, 0x0a, 0x1a, 0x53, - 0x74, 0x61, 0x72, 0x74, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, - 0x74, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x53, 0x0a, 0x11, 0x77, 0x72, 0x69, - 0x74, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, - 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0f, 0x77, - 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x53, 0x70, 0x65, 0x63, 0x12, 0x6d, - 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, - 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, - 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, - 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, - 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, - 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x4d, 0x0a, - 0x10, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, - 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x52, 0x0f, 0x6f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x22, 0x3a, 0x0a, 0x1b, - 0x53, 0x74, 0x61, 0x72, 0x74, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, - 0x69, 0x74, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x1b, 0x0a, 0x09, 0x75, - 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, - 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x49, 0x64, 0x22, 0x87, 0x05, 0x0a, 0x13, 0x55, 0x70, 0x64, - 0x61, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x12, 0x36, 0x0a, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x42, 0x03, 0xe0, 0x41, 0x02, - 0x52, 0x06, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x33, 0x0a, 0x13, 0x69, 0x66, 0x5f, 0x67, - 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x11, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3a, 0x0a, - 0x17, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, - 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x48, 0x01, - 0x52, 0x14, 0x69, 0x66, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x6f, - 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x3b, 0x0a, 0x17, 0x69, 0x66, 0x5f, - 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x48, 0x02, 0x52, 0x15, 0x69, 0x66, - 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x42, 0x0a, 0x1b, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, - 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x48, 0x03, 0x52, 0x18, 0x69, - 0x66, 0x4d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4e, - 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x88, 0x01, 0x01, 0x12, 0x25, 0x0a, 0x0e, 0x70, 0x72, - 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x0a, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x41, 0x63, - 0x6c, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, - 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, - 0x73, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, - 0x61, 0x73, 0x6b, 0x12, 0x6d, 0x0a, 0x1c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x70, 0x61, 0x72, - 0x61, 0x6d, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, - 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, - 0x6d, 0x73, 0x42, 0x16, 0x0a, 0x14, 0x5f, 0x69, 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, - 0x66, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x42, 0x1a, 0x0a, 0x18, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, - 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x42, 0x1e, 0x0a, 0x1c, 0x5f, 0x69, 0x66, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x22, 0xbf, 0x01, 0x0a, 0x19, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, - 0x12, 0x31, 0x0a, 0x14, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, - 0x6c, 0x67, 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13, - 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x6c, 0x67, 0x6f, 0x72, 0x69, - 0x74, 0x68, 0x6d, 0x12, 0x30, 0x0a, 0x14, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x6b, 0x65, 0x79, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x0c, 0x52, 0x12, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x79, - 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x3d, 0x0a, 0x1b, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x79, 0x5f, 0x73, 0x68, 0x61, 0x32, 0x35, 0x36, 0x5f, 0x62, - 0x79, 0x74, 0x65, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x18, 0x65, 0x6e, 0x63, 0x72, - 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x79, 0x53, 0x68, 0x61, 0x32, 0x35, 0x36, 0x42, - 0x79, 0x74, 0x65, 0x73, 0x22, 0xca, 0x05, 0x0a, 0x10, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, - 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x73, 0x22, 0xb5, 0x05, 0x0a, 0x06, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x73, 0x12, 0x16, 0x0a, 0x12, 0x56, 0x41, 0x4c, 0x55, 0x45, 0x53, 0x5f, 0x55, - 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x1b, 0x0a, 0x14, - 0x4d, 0x41, 0x58, 0x5f, 0x52, 0x45, 0x41, 0x44, 0x5f, 0x43, 0x48, 0x55, 0x4e, 0x4b, 0x5f, 0x42, - 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0x80, 0x80, 0x01, 0x12, 0x1c, 0x0a, 0x15, 0x4d, 0x41, 0x58, - 0x5f, 0x57, 0x52, 0x49, 0x54, 0x45, 0x5f, 0x43, 0x48, 0x55, 0x4e, 0x4b, 0x5f, 0x42, 0x59, 0x54, - 0x45, 0x53, 0x10, 0x80, 0x80, 0x80, 0x01, 0x12, 0x19, 0x0a, 0x12, 0x4d, 0x41, 0x58, 0x5f, 0x4f, - 0x42, 0x4a, 0x45, 0x43, 0x54, 0x5f, 0x53, 0x49, 0x5a, 0x45, 0x5f, 0x4d, 0x42, 0x10, 0x80, 0x80, - 0xc0, 0x02, 0x12, 0x29, 0x0a, 0x24, 0x4d, 0x41, 0x58, 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, - 0x5f, 0x4d, 0x45, 0x54, 0x41, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x5f, - 0x4e, 0x41, 0x4d, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0x08, 0x12, 0x2a, 0x0a, - 0x25, 0x4d, 0x41, 0x58, 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, 0x5f, 0x4d, 0x45, 0x54, 0x41, - 0x44, 0x41, 0x54, 0x41, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x5f, 0x56, 0x41, 0x4c, 0x55, 0x45, - 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0x20, 0x12, 0x29, 0x0a, 0x24, 0x4d, 0x41, 0x58, - 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, 0x5f, 0x4d, 0x45, 0x54, 0x41, 0x44, 0x41, 0x54, 0x41, - 0x5f, 0x54, 0x4f, 0x54, 0x41, 0x4c, 0x5f, 0x53, 0x49, 0x5a, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, - 0x53, 0x10, 0x80, 0x40, 0x12, 0x2a, 0x0a, 0x24, 0x4d, 0x41, 0x58, 0x5f, 0x42, 0x55, 0x43, 0x4b, - 0x45, 0x54, 0x5f, 0x4d, 0x45, 0x54, 0x41, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x54, 0x4f, 0x54, 0x41, - 0x4c, 0x5f, 0x53, 0x49, 0x5a, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0xa0, 0x01, - 0x12, 0x27, 0x0a, 0x23, 0x4d, 0x41, 0x58, 0x5f, 0x4e, 0x4f, 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, - 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x43, 0x4f, 0x4e, 0x46, 0x49, 0x47, 0x53, 0x5f, 0x50, 0x45, 0x52, - 0x5f, 0x42, 0x55, 0x43, 0x4b, 0x45, 0x54, 0x10, 0x64, 0x12, 0x22, 0x0a, 0x1e, 0x4d, 0x41, 0x58, - 0x5f, 0x4c, 0x49, 0x46, 0x45, 0x43, 0x59, 0x43, 0x4c, 0x45, 0x5f, 0x52, 0x55, 0x4c, 0x45, 0x53, - 0x5f, 0x50, 0x45, 0x52, 0x5f, 0x42, 0x55, 0x43, 0x4b, 0x45, 0x54, 0x10, 0x64, 0x12, 0x26, 0x0a, - 0x22, 0x4d, 0x41, 0x58, 0x5f, 0x4e, 0x4f, 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, - 0x4e, 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, 0x5f, 0x41, 0x54, 0x54, 0x52, 0x49, 0x42, 0x55, - 0x54, 0x45, 0x53, 0x10, 0x05, 0x12, 0x31, 0x0a, 0x2c, 0x4d, 0x41, 0x58, 0x5f, 0x4e, 0x4f, 0x54, + 0x5f, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xbf, 0x01, 0x0a, 0x19, 0x43, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x31, 0x0a, 0x14, 0x65, 0x6e, 0x63, 0x72, + 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, 0x6c, 0x67, 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x41, 0x6c, 0x67, 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x12, 0x30, 0x0a, 0x14, 0x65, + 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x79, 0x5f, 0x62, 0x79, + 0x74, 0x65, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x12, 0x65, 0x6e, 0x63, 0x72, 0x79, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x79, 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x3d, 0x0a, + 0x1b, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x79, 0x5f, + 0x73, 0x68, 0x61, 0x32, 0x35, 0x36, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x05, 0x20, 0x01, + 0x28, 0x0c, 0x52, 0x18, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x65, + 0x79, 0x53, 0x68, 0x61, 0x32, 0x35, 0x36, 0x42, 0x79, 0x74, 0x65, 0x73, 0x22, 0xca, 0x05, 0x0a, + 0x10, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, + 0x73, 0x22, 0xb5, 0x05, 0x0a, 0x06, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x16, 0x0a, 0x12, + 0x56, 0x41, 0x4c, 0x55, 0x45, 0x53, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, + 0x45, 0x44, 0x10, 0x00, 0x12, 0x1b, 0x0a, 0x14, 0x4d, 0x41, 0x58, 0x5f, 0x52, 0x45, 0x41, 0x44, + 0x5f, 0x43, 0x48, 0x55, 0x4e, 0x4b, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0x80, 0x80, + 0x01, 0x12, 0x1c, 0x0a, 0x15, 0x4d, 0x41, 0x58, 0x5f, 0x57, 0x52, 0x49, 0x54, 0x45, 0x5f, 0x43, + 0x48, 0x55, 0x4e, 0x4b, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0x80, 0x80, 0x01, 0x12, + 0x19, 0x0a, 0x12, 0x4d, 0x41, 0x58, 0x5f, 0x4f, 0x42, 0x4a, 0x45, 0x43, 0x54, 0x5f, 0x53, 0x49, + 0x5a, 0x45, 0x5f, 0x4d, 0x42, 0x10, 0x80, 0x80, 0xc0, 0x02, 0x12, 0x29, 0x0a, 0x24, 0x4d, 0x41, + 0x58, 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, 0x5f, 0x4d, 0x45, 0x54, 0x41, 0x44, 0x41, 0x54, + 0x41, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x5f, 0x4e, 0x41, 0x4d, 0x45, 0x5f, 0x42, 0x59, 0x54, + 0x45, 0x53, 0x10, 0x80, 0x08, 0x12, 0x2a, 0x0a, 0x25, 0x4d, 0x41, 0x58, 0x5f, 0x43, 0x55, 0x53, + 0x54, 0x4f, 0x4d, 0x5f, 0x4d, 0x45, 0x54, 0x41, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x46, 0x49, 0x45, + 0x4c, 0x44, 0x5f, 0x56, 0x41, 0x4c, 0x55, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, + 0x20, 0x12, 0x29, 0x0a, 0x24, 0x4d, 0x41, 0x58, 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, 0x5f, + 0x4d, 0x45, 0x54, 0x41, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x54, 0x4f, 0x54, 0x41, 0x4c, 0x5f, 0x53, + 0x49, 0x5a, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0x40, 0x12, 0x2a, 0x0a, 0x24, + 0x4d, 0x41, 0x58, 0x5f, 0x42, 0x55, 0x43, 0x4b, 0x45, 0x54, 0x5f, 0x4d, 0x45, 0x54, 0x41, 0x44, + 0x41, 0x54, 0x41, 0x5f, 0x54, 0x4f, 0x54, 0x41, 0x4c, 0x5f, 0x53, 0x49, 0x5a, 0x45, 0x5f, 0x42, + 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0xa0, 0x01, 0x12, 0x27, 0x0a, 0x23, 0x4d, 0x41, 0x58, 0x5f, + 0x4e, 0x4f, 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x43, 0x4f, 0x4e, + 0x46, 0x49, 0x47, 0x53, 0x5f, 0x50, 0x45, 0x52, 0x5f, 0x42, 0x55, 0x43, 0x4b, 0x45, 0x54, 0x10, + 0x64, 0x12, 0x22, 0x0a, 0x1e, 0x4d, 0x41, 0x58, 0x5f, 0x4c, 0x49, 0x46, 0x45, 0x43, 0x59, 0x43, + 0x4c, 0x45, 0x5f, 0x52, 0x55, 0x4c, 0x45, 0x53, 0x5f, 0x50, 0x45, 0x52, 0x5f, 0x42, 0x55, 0x43, + 0x4b, 0x45, 0x54, 0x10, 0x64, 0x12, 0x26, 0x0a, 0x22, 0x4d, 0x41, 0x58, 0x5f, 0x4e, 0x4f, 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, - 0x5f, 0x41, 0x54, 0x54, 0x52, 0x49, 0x42, 0x55, 0x54, 0x45, 0x5f, 0x4b, 0x45, 0x59, 0x5f, 0x4c, - 0x45, 0x4e, 0x47, 0x54, 0x48, 0x10, 0x80, 0x02, 0x12, 0x33, 0x0a, 0x2e, 0x4d, 0x41, 0x58, 0x5f, - 0x4e, 0x4f, 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x43, 0x55, 0x53, - 0x54, 0x4f, 0x4d, 0x5f, 0x41, 0x54, 0x54, 0x52, 0x49, 0x42, 0x55, 0x54, 0x45, 0x5f, 0x56, 0x41, - 0x4c, 0x55, 0x45, 0x5f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x10, 0x80, 0x08, 0x12, 0x1c, 0x0a, - 0x18, 0x4d, 0x41, 0x58, 0x5f, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x53, 0x5f, 0x45, 0x4e, 0x54, 0x52, - 0x49, 0x45, 0x53, 0x5f, 0x43, 0x4f, 0x55, 0x4e, 0x54, 0x10, 0x40, 0x12, 0x1f, 0x0a, 0x1b, 0x4d, - 0x41, 0x58, 0x5f, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x53, 0x5f, 0x4b, 0x45, 0x59, 0x5f, 0x56, 0x41, - 0x4c, 0x55, 0x45, 0x5f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x10, 0x3f, 0x12, 0x1f, 0x0a, 0x1a, - 0x4d, 0x41, 0x58, 0x5f, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x53, 0x5f, 0x4b, 0x45, 0x59, 0x5f, 0x56, - 0x41, 0x4c, 0x55, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x80, 0x01, 0x12, 0x2e, 0x0a, - 0x29, 0x4d, 0x41, 0x58, 0x5f, 0x4f, 0x42, 0x4a, 0x45, 0x43, 0x54, 0x5f, 0x49, 0x44, 0x53, 0x5f, - 0x50, 0x45, 0x52, 0x5f, 0x44, 0x45, 0x4c, 0x45, 0x54, 0x45, 0x5f, 0x4f, 0x42, 0x4a, 0x45, 0x43, - 0x54, 0x53, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x45, 0x53, 0x54, 0x10, 0xe8, 0x07, 0x12, 0x1e, 0x0a, - 0x1a, 0x53, 0x50, 0x4c, 0x49, 0x54, 0x5f, 0x54, 0x4f, 0x4b, 0x45, 0x4e, 0x5f, 0x4d, 0x41, 0x58, - 0x5f, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x5f, 0x44, 0x41, 0x59, 0x53, 0x10, 0x0e, 0x1a, 0x02, 0x10, - 0x01, 0x22, 0x86, 0x24, 0x0a, 0x06, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x17, 0x0a, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x05, 0x52, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x20, 0x0a, 0x09, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x5f, - 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x08, 0x62, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x49, 0x64, 0x12, 0x12, 0x0a, 0x04, 0x65, 0x74, 0x61, 0x67, 0x18, - 0x1d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x65, 0x74, 0x61, 0x67, 0x12, 0x4d, 0x0a, 0x07, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x33, 0xe0, 0x41, - 0x05, 0xfa, 0x41, 0x2d, 0x0a, 0x2b, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x72, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, - 0x74, 0x52, 0x07, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x2b, 0x0a, 0x0e, 0x6d, 0x65, - 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, - 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0e, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x05, 0x52, 0x08, - 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x28, 0x0a, 0x0d, 0x6c, 0x6f, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, - 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0c, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x79, - 0x70, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, - 0x61, 0x73, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x12, 0x10, 0x0a, 0x03, 0x72, 0x70, 0x6f, 0x18, 0x1b, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x72, 0x70, 0x6f, 0x12, 0x38, 0x0a, 0x03, 0x61, 0x63, 0x6c, - 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x5f, 0x41, 0x54, 0x54, 0x52, 0x49, 0x42, 0x55, 0x54, 0x45, 0x53, 0x10, 0x05, 0x12, 0x31, 0x0a, + 0x2c, 0x4d, 0x41, 0x58, 0x5f, 0x4e, 0x4f, 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, + 0x4e, 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, 0x5f, 0x41, 0x54, 0x54, 0x52, 0x49, 0x42, 0x55, + 0x54, 0x45, 0x5f, 0x4b, 0x45, 0x59, 0x5f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x10, 0x80, 0x02, + 0x12, 0x33, 0x0a, 0x2e, 0x4d, 0x41, 0x58, 0x5f, 0x4e, 0x4f, 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, + 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x43, 0x55, 0x53, 0x54, 0x4f, 0x4d, 0x5f, 0x41, 0x54, 0x54, 0x52, + 0x49, 0x42, 0x55, 0x54, 0x45, 0x5f, 0x56, 0x41, 0x4c, 0x55, 0x45, 0x5f, 0x4c, 0x45, 0x4e, 0x47, + 0x54, 0x48, 0x10, 0x80, 0x08, 0x12, 0x1c, 0x0a, 0x18, 0x4d, 0x41, 0x58, 0x5f, 0x4c, 0x41, 0x42, + 0x45, 0x4c, 0x53, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x49, 0x45, 0x53, 0x5f, 0x43, 0x4f, 0x55, 0x4e, + 0x54, 0x10, 0x40, 0x12, 0x1f, 0x0a, 0x1b, 0x4d, 0x41, 0x58, 0x5f, 0x4c, 0x41, 0x42, 0x45, 0x4c, + 0x53, 0x5f, 0x4b, 0x45, 0x59, 0x5f, 0x56, 0x41, 0x4c, 0x55, 0x45, 0x5f, 0x4c, 0x45, 0x4e, 0x47, + 0x54, 0x48, 0x10, 0x3f, 0x12, 0x1f, 0x0a, 0x1a, 0x4d, 0x41, 0x58, 0x5f, 0x4c, 0x41, 0x42, 0x45, + 0x4c, 0x53, 0x5f, 0x4b, 0x45, 0x59, 0x5f, 0x56, 0x41, 0x4c, 0x55, 0x45, 0x5f, 0x42, 0x59, 0x54, + 0x45, 0x53, 0x10, 0x80, 0x01, 0x12, 0x2e, 0x0a, 0x29, 0x4d, 0x41, 0x58, 0x5f, 0x4f, 0x42, 0x4a, + 0x45, 0x43, 0x54, 0x5f, 0x49, 0x44, 0x53, 0x5f, 0x50, 0x45, 0x52, 0x5f, 0x44, 0x45, 0x4c, 0x45, + 0x54, 0x45, 0x5f, 0x4f, 0x42, 0x4a, 0x45, 0x43, 0x54, 0x53, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x45, + 0x53, 0x54, 0x10, 0xe8, 0x07, 0x12, 0x1e, 0x0a, 0x1a, 0x53, 0x50, 0x4c, 0x49, 0x54, 0x5f, 0x54, + 0x4f, 0x4b, 0x45, 0x4e, 0x5f, 0x4d, 0x41, 0x58, 0x5f, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x5f, 0x44, + 0x41, 0x59, 0x53, 0x10, 0x0e, 0x1a, 0x02, 0x10, 0x01, 0x22, 0x86, 0x24, 0x0a, 0x06, 0x42, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x05, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x20, 0x0a, + 0x09, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x08, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x49, 0x64, 0x12, + 0x12, 0x0a, 0x04, 0x65, 0x74, 0x61, 0x67, 0x18, 0x1d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x65, + 0x74, 0x61, 0x67, 0x12, 0x4d, 0x0a, 0x07, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x03, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x33, 0xe0, 0x41, 0x05, 0xfa, 0x41, 0x2d, 0x0a, 0x2b, 0x63, 0x6c, + 0x6f, 0x75, 0x64, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x6d, 0x61, 0x6e, 0x61, 0x67, + 0x65, 0x72, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x07, 0x70, 0x72, 0x6f, 0x6a, 0x65, + 0x63, 0x74, 0x12, 0x2b, 0x0a, 0x0e, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, + 0x0e, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, + 0x1f, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x03, 0xe0, 0x41, 0x05, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x28, 0x0a, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x79, 0x70, + 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0c, 0x6c, 0x6f, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0c, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x12, + 0x10, 0x0a, 0x03, 0x72, 0x70, 0x6f, 0x18, 0x1b, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x72, 0x70, + 0x6f, 0x12, 0x38, 0x0a, 0x03, 0x61, 0x63, 0x6c, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x26, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, + 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x43, + 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x52, 0x03, 0x61, 0x63, 0x6c, 0x12, 0x54, 0x0a, 0x12, 0x64, + 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x61, 0x63, + 0x6c, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x52, + 0x10, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x41, 0x63, + 0x6c, 0x12, 0x41, 0x0a, 0x09, 0x6c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x18, 0x0a, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, + 0x4c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x52, 0x09, 0x6c, 0x69, 0x66, 0x65, 0x63, + 0x79, 0x63, 0x6c, 0x65, 0x12, 0x40, 0x0a, 0x0b, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x5f, 0x74, + 0x69, 0x6d, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, + 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0a, 0x63, 0x72, 0x65, 0x61, + 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x32, 0x0a, 0x04, 0x63, 0x6f, 0x72, 0x73, 0x18, 0x0c, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, + 0x43, 0x6f, 0x72, 0x73, 0x52, 0x04, 0x63, 0x6f, 0x72, 0x73, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, + 0x64, 0x61, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, + 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x18, + 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x5f, 0x62, 0x61, + 0x73, 0x65, 0x64, 0x5f, 0x68, 0x6f, 0x6c, 0x64, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x08, 0x52, 0x15, + 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x42, 0x61, 0x73, 0x65, + 0x64, 0x48, 0x6f, 0x6c, 0x64, 0x12, 0x3d, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, + 0x0f, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x06, 0x6c, 0x61, + 0x62, 0x65, 0x6c, 0x73, 0x12, 0x3b, 0x0a, 0x07, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x18, + 0x10, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x2e, 0x57, 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x52, 0x07, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74, + 0x65, 0x12, 0x44, 0x0a, 0x0a, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x18, + 0x11, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x2e, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x52, 0x0a, 0x76, 0x65, 0x72, + 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x3b, 0x0a, 0x07, 0x6c, 0x6f, 0x67, 0x67, 0x69, + 0x6e, 0x67, 0x18, 0x12, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x2e, 0x4c, 0x6f, 0x67, 0x67, 0x69, 0x6e, 0x67, 0x52, 0x07, 0x6c, 0x6f, 0x67, + 0x67, 0x69, 0x6e, 0x67, 0x12, 0x33, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x13, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x77, 0x6e, 0x65, 0x72, 0x42, 0x03, 0xe0, + 0x41, 0x03, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x44, 0x0a, 0x0a, 0x65, 0x6e, 0x63, + 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x14, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, + 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, + 0x3b, 0x0a, 0x07, 0x62, 0x69, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x42, 0x69, 0x6c, 0x6c, + 0x69, 0x6e, 0x67, 0x52, 0x07, 0x62, 0x69, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x12, 0x54, 0x0a, 0x10, + 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x52, 0x03, - 0x61, 0x63, 0x6c, 0x12, 0x54, 0x0a, 0x12, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x6f, - 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x61, 0x63, 0x6c, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, - 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x52, 0x10, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, - 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x41, 0x63, 0x6c, 0x12, 0x41, 0x0a, 0x09, 0x6c, 0x69, 0x66, - 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x4c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, - 0x65, 0x52, 0x09, 0x6c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x12, 0x40, 0x0a, 0x0b, - 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, - 0x41, 0x03, 0x52, 0x0a, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x32, - 0x0a, 0x04, 0x63, 0x6f, 0x72, 0x73, 0x18, 0x0c, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, + 0x74, 0x2e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, + 0x79, 0x52, 0x0f, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x12, 0x42, 0x0a, 0x0a, 0x69, 0x61, 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x18, 0x17, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x2e, 0x49, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x09, 0x69, 0x61, 0x6d, + 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x23, 0x0a, 0x0d, 0x73, 0x61, 0x74, 0x69, 0x73, 0x66, + 0x69, 0x65, 0x73, 0x5f, 0x70, 0x7a, 0x73, 0x18, 0x19, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0c, 0x73, + 0x61, 0x74, 0x69, 0x73, 0x66, 0x69, 0x65, 0x73, 0x50, 0x7a, 0x73, 0x12, 0x67, 0x0a, 0x17, 0x63, + 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x5f, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x1a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x43, 0x6f, 0x72, 0x73, 0x52, 0x04, 0x63, 0x6f, - 0x72, 0x73, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, - 0x65, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, - 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, - 0x54, 0x69, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x18, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, - 0x65, 0x76, 0x65, 0x6e, 0x74, 0x5f, 0x62, 0x61, 0x73, 0x65, 0x64, 0x5f, 0x68, 0x6f, 0x6c, 0x64, - 0x18, 0x0e, 0x20, 0x01, 0x28, 0x08, 0x52, 0x15, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x45, - 0x76, 0x65, 0x6e, 0x74, 0x42, 0x61, 0x73, 0x65, 0x64, 0x48, 0x6f, 0x6c, 0x64, 0x12, 0x3d, 0x0a, - 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x0f, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, - 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, - 0x6e, 0x74, 0x72, 0x79, 0x52, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x3b, 0x0a, 0x07, - 0x77, 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x18, 0x10, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, - 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x57, 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, - 0x52, 0x07, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x12, 0x44, 0x0a, 0x0a, 0x76, 0x65, 0x72, - 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, + 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x50, 0x6c, + 0x61, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x15, 0x63, + 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x50, 0x6c, 0x61, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x12, 0x41, 0x0a, 0x09, 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6c, 0x61, 0x73, + 0x73, 0x18, 0x1c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x2e, 0x41, 0x75, 0x74, 0x6f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x52, 0x09, 0x61, 0x75, + 0x74, 0x6f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x12, 0x6b, 0x0a, 0x16, 0x68, 0x69, 0x65, 0x72, 0x61, + 0x72, 0x63, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, + 0x65, 0x18, 0x20, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x2e, 0x48, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x4e, + 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x15, 0x68, + 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x73, + 0x70, 0x61, 0x63, 0x65, 0x12, 0x5d, 0x0a, 0x12, 0x73, 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, 0x6c, + 0x65, 0x74, 0x65, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x1f, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x53, 0x6f, 0x66, 0x74, + 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x03, 0xe0, 0x41, + 0x01, 0x52, 0x10, 0x73, 0x6f, 0x66, 0x74, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x1a, 0x30, 0x0a, 0x07, 0x42, 0x69, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x12, 0x25, + 0x0a, 0x0e, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x65, 0x72, 0x5f, 0x70, 0x61, 0x79, 0x73, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x65, + 0x72, 0x50, 0x61, 0x79, 0x73, 0x1a, 0x87, 0x01, 0x0a, 0x04, 0x43, 0x6f, 0x72, 0x73, 0x12, 0x16, + 0x0a, 0x06, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x06, + 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, + 0x18, 0x02, 0x20, 0x03, 0x28, 0x09, 0x52, 0x06, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x27, + 0x0a, 0x0f, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, + 0x72, 0x18, 0x03, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0e, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, + 0x65, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x26, 0x0a, 0x0f, 0x6d, 0x61, 0x78, 0x5f, 0x61, + 0x67, 0x65, 0x5f, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, + 0x52, 0x0d, 0x6d, 0x61, 0x78, 0x41, 0x67, 0x65, 0x53, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73, 0x1a, + 0x5c, 0x0a, 0x0a, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4e, 0x0a, + 0x0f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x6b, 0x6d, 0x73, 0x5f, 0x6b, 0x65, 0x79, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x26, 0xfa, 0x41, 0x23, 0x0a, 0x21, 0x63, 0x6c, 0x6f, + 0x75, 0x64, 0x6b, 0x6d, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, + 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x4b, 0x65, 0x79, 0x52, 0x0d, + 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x4b, 0x6d, 0x73, 0x4b, 0x65, 0x79, 0x1a, 0xb1, 0x02, + 0x0a, 0x09, 0x49, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x7b, 0x0a, 0x1b, 0x75, + 0x6e, 0x69, 0x66, 0x6f, 0x72, 0x6d, 0x5f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6c, 0x65, + 0x76, 0x65, 0x6c, 0x5f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x49, 0x61, 0x6d, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x55, 0x6e, 0x69, 0x66, 0x6f, 0x72, 0x6d, 0x42, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x52, 0x18, + 0x75, 0x6e, 0x69, 0x66, 0x6f, 0x72, 0x6d, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x4c, 0x65, 0x76, + 0x65, 0x6c, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x12, 0x38, 0x0a, 0x18, 0x70, 0x75, 0x62, 0x6c, + 0x69, 0x63, 0x5f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x5f, 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e, + 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x16, 0x70, 0x75, 0x62, 0x6c, + 0x69, 0x63, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x50, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x69, + 0x6f, 0x6e, 0x1a, 0x6d, 0x0a, 0x18, 0x55, 0x6e, 0x69, 0x66, 0x6f, 0x72, 0x6d, 0x42, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x12, 0x18, + 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, + 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x37, 0x0a, 0x09, 0x6c, 0x6f, 0x63, 0x6b, + 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, + 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x6b, 0x54, 0x69, 0x6d, + 0x65, 0x1a, 0xdb, 0x07, 0x0a, 0x09, 0x4c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x12, + 0x3c, 0x0a, 0x04, 0x72, 0x75, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, - 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, - 0x69, 0x6e, 0x67, 0x52, 0x0a, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x12, - 0x3b, 0x0a, 0x07, 0x6c, 0x6f, 0x67, 0x67, 0x69, 0x6e, 0x67, 0x18, 0x12, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x4c, 0x6f, 0x67, 0x67, - 0x69, 0x6e, 0x67, 0x52, 0x07, 0x6c, 0x6f, 0x67, 0x67, 0x69, 0x6e, 0x67, 0x12, 0x33, 0x0a, 0x05, - 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, - 0x4f, 0x77, 0x6e, 0x65, 0x72, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, - 0x72, 0x12, 0x44, 0x0a, 0x0a, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, - 0x14, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, - 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, - 0x2e, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x65, 0x6e, 0x63, - 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3b, 0x0a, 0x07, 0x62, 0x69, 0x6c, 0x6c, 0x69, - 0x6e, 0x67, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, - 0x6b, 0x65, 0x74, 0x2e, 0x42, 0x69, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x52, 0x07, 0x62, 0x69, 0x6c, - 0x6c, 0x69, 0x6e, 0x67, 0x12, 0x54, 0x0a, 0x10, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, - 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x0f, 0x72, 0x65, 0x74, 0x65, 0x6e, - 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x42, 0x0a, 0x0a, 0x69, 0x61, - 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x17, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x49, 0x61, 0x6d, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x52, 0x09, 0x69, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x23, - 0x0a, 0x0d, 0x73, 0x61, 0x74, 0x69, 0x73, 0x66, 0x69, 0x65, 0x73, 0x5f, 0x70, 0x7a, 0x73, 0x18, - 0x19, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0c, 0x73, 0x61, 0x74, 0x69, 0x73, 0x66, 0x69, 0x65, 0x73, - 0x50, 0x7a, 0x73, 0x12, 0x67, 0x0a, 0x17, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x70, 0x6c, - 0x61, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x1a, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, - 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, + 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x4c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, + 0x6c, 0x65, 0x2e, 0x52, 0x75, 0x6c, 0x65, 0x52, 0x04, 0x72, 0x75, 0x6c, 0x65, 0x1a, 0x8f, 0x07, + 0x0a, 0x04, 0x52, 0x75, 0x6c, 0x65, 0x12, 0x47, 0x0a, 0x06, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x2e, 0x4c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x2e, 0x52, 0x75, 0x6c, 0x65, + 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, + 0x50, 0x0a, 0x09, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x4c, 0x69, + 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x2e, 0x52, 0x75, 0x6c, 0x65, 0x2e, 0x43, 0x6f, 0x6e, + 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, + 0x6e, 0x1a, 0x41, 0x0a, 0x06, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x74, + 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, + 0x23, 0x0a, 0x0d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, + 0x6c, 0x61, 0x73, 0x73, 0x1a, 0xa8, 0x05, 0x0a, 0x09, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x12, 0x1e, 0x0a, 0x08, 0x61, 0x67, 0x65, 0x5f, 0x64, 0x61, 0x79, 0x73, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x05, 0x48, 0x00, 0x52, 0x07, 0x61, 0x67, 0x65, 0x44, 0x61, 0x79, 0x73, 0x88, + 0x01, 0x01, 0x12, 0x38, 0x0a, 0x0e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x62, 0x65, + 0x66, 0x6f, 0x72, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x11, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x44, 0x61, 0x74, 0x65, 0x52, 0x0d, 0x63, + 0x72, 0x65, 0x61, 0x74, 0x65, 0x64, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x12, 0x1c, 0x0a, 0x07, + 0x69, 0x73, 0x5f, 0x6c, 0x69, 0x76, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x48, 0x01, 0x52, + 0x06, 0x69, 0x73, 0x4c, 0x69, 0x76, 0x65, 0x88, 0x01, 0x01, 0x12, 0x31, 0x0a, 0x12, 0x6e, 0x75, + 0x6d, 0x5f, 0x6e, 0x65, 0x77, 0x65, 0x72, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, + 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x48, 0x02, 0x52, 0x10, 0x6e, 0x75, 0x6d, 0x4e, 0x65, 0x77, + 0x65, 0x72, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x88, 0x01, 0x01, 0x12, 0x32, 0x0a, + 0x15, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, + 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x52, 0x13, 0x6d, 0x61, + 0x74, 0x63, 0x68, 0x65, 0x73, 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, + 0x73, 0x12, 0x38, 0x0a, 0x16, 0x64, 0x61, 0x79, 0x73, 0x5f, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x5f, + 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, + 0x05, 0x48, 0x03, 0x52, 0x13, 0x64, 0x61, 0x79, 0x73, 0x53, 0x69, 0x6e, 0x63, 0x65, 0x43, 0x75, + 0x73, 0x74, 0x6f, 0x6d, 0x54, 0x69, 0x6d, 0x65, 0x88, 0x01, 0x01, 0x12, 0x3f, 0x0a, 0x12, 0x63, + 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x62, 0x65, 0x66, 0x6f, 0x72, + 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x11, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x44, 0x61, 0x74, 0x65, 0x52, 0x10, 0x63, 0x75, 0x73, 0x74, + 0x6f, 0x6d, 0x54, 0x69, 0x6d, 0x65, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x12, 0x40, 0x0a, 0x1a, + 0x64, 0x61, 0x79, 0x73, 0x5f, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x5f, 0x6e, 0x6f, 0x6e, 0x63, 0x75, + 0x72, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x05, + 0x48, 0x04, 0x52, 0x17, 0x64, 0x61, 0x79, 0x73, 0x53, 0x69, 0x6e, 0x63, 0x65, 0x4e, 0x6f, 0x6e, + 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x88, 0x01, 0x01, 0x12, 0x47, + 0x0a, 0x16, 0x6e, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x69, 0x6d, + 0x65, 0x5f, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x11, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x44, 0x61, 0x74, + 0x65, 0x52, 0x14, 0x6e, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x54, 0x69, 0x6d, + 0x65, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x65, 0x73, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x09, 0x52, + 0x0d, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x25, + 0x0a, 0x0e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x5f, 0x73, 0x75, 0x66, 0x66, 0x69, 0x78, + 0x18, 0x0c, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0d, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x53, + 0x75, 0x66, 0x66, 0x69, 0x78, 0x42, 0x0b, 0x0a, 0x09, 0x5f, 0x61, 0x67, 0x65, 0x5f, 0x64, 0x61, + 0x79, 0x73, 0x42, 0x0a, 0x0a, 0x08, 0x5f, 0x69, 0x73, 0x5f, 0x6c, 0x69, 0x76, 0x65, 0x42, 0x15, + 0x0a, 0x13, 0x5f, 0x6e, 0x75, 0x6d, 0x5f, 0x6e, 0x65, 0x77, 0x65, 0x72, 0x5f, 0x76, 0x65, 0x72, + 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x42, 0x19, 0x0a, 0x17, 0x5f, 0x64, 0x61, 0x79, 0x73, 0x5f, 0x73, + 0x69, 0x6e, 0x63, 0x65, 0x5f, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x74, 0x69, 0x6d, 0x65, + 0x42, 0x1d, 0x0a, 0x1b, 0x5f, 0x64, 0x61, 0x79, 0x73, 0x5f, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x5f, + 0x6e, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x1a, + 0x54, 0x0a, 0x07, 0x4c, 0x6f, 0x67, 0x67, 0x69, 0x6e, 0x67, 0x12, 0x1d, 0x0a, 0x0a, 0x6c, 0x6f, + 0x67, 0x5f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, + 0x6c, 0x6f, 0x67, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x2a, 0x0a, 0x11, 0x6c, 0x6f, 0x67, + 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x6f, 0x67, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x50, + 0x72, 0x65, 0x66, 0x69, 0x78, 0x1a, 0xbb, 0x01, 0x0a, 0x0f, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, + 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x41, 0x0a, 0x0e, 0x65, 0x66, 0x66, + 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0d, 0x65, + 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x09, + 0x69, 0x73, 0x5f, 0x6c, 0x6f, 0x63, 0x6b, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, + 0x08, 0x69, 0x73, 0x4c, 0x6f, 0x63, 0x6b, 0x65, 0x64, 0x12, 0x48, 0x0a, 0x12, 0x72, 0x65, 0x74, + 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x11, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x75, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x1a, 0xd3, 0x01, 0x0a, 0x10, 0x53, 0x6f, 0x66, 0x74, 0x44, 0x65, 0x6c, 0x65, + 0x74, 0x65, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x4d, 0x0a, 0x12, 0x72, 0x65, 0x74, 0x65, + 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x48, + 0x00, 0x52, 0x11, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x75, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x88, 0x01, 0x01, 0x12, 0x46, 0x0a, 0x0e, 0x65, 0x66, 0x66, 0x65, 0x63, + 0x74, 0x69, 0x76, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x48, 0x01, 0x52, 0x0d, 0x65, + 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x88, 0x01, 0x01, 0x42, + 0x15, 0x0a, 0x13, 0x5f, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x75, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x11, 0x0a, 0x0f, 0x5f, 0x65, 0x66, 0x66, 0x65, 0x63, + 0x74, 0x69, 0x76, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x1a, 0x26, 0x0a, 0x0a, 0x56, 0x65, 0x72, + 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x18, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, + 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, + 0x64, 0x1a, 0x59, 0x0a, 0x07, 0x57, 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x12, 0x28, 0x0a, 0x10, + 0x6d, 0x61, 0x69, 0x6e, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x75, 0x66, 0x66, 0x69, 0x78, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x6d, 0x61, 0x69, 0x6e, 0x50, 0x61, 0x67, 0x65, + 0x53, 0x75, 0x66, 0x66, 0x69, 0x78, 0x12, 0x24, 0x0a, 0x0e, 0x6e, 0x6f, 0x74, 0x5f, 0x66, 0x6f, + 0x75, 0x6e, 0x64, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, + 0x6e, 0x6f, 0x74, 0x46, 0x6f, 0x75, 0x6e, 0x64, 0x50, 0x61, 0x67, 0x65, 0x1a, 0x3e, 0x0a, 0x15, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x50, 0x6c, 0x61, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x15, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x50, 0x6c, 0x61, - 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x41, 0x0a, 0x09, - 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x1c, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x41, 0x75, 0x74, 0x6f, 0x63, - 0x6c, 0x61, 0x73, 0x73, 0x52, 0x09, 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x12, - 0x6b, 0x0a, 0x16, 0x68, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x5f, - 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x18, 0x20, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x48, 0x69, 0x65, 0x72, 0x61, - 0x72, 0x63, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, - 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x15, 0x68, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x69, - 0x63, 0x61, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x12, 0x5d, 0x0a, 0x12, - 0x73, 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x5f, 0x70, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x18, 0x1f, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, - 0x6b, 0x65, 0x74, 0x2e, 0x53, 0x6f, 0x66, 0x74, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x10, 0x73, 0x6f, 0x66, 0x74, 0x44, - 0x65, 0x6c, 0x65, 0x74, 0x65, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x1a, 0x30, 0x0a, 0x07, 0x42, - 0x69, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x12, 0x25, 0x0a, 0x0e, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x65, 0x72, 0x5f, 0x70, 0x61, 0x79, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, - 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x65, 0x72, 0x50, 0x61, 0x79, 0x73, 0x1a, 0x87, 0x01, - 0x0a, 0x04, 0x43, 0x6f, 0x72, 0x73, 0x12, 0x16, 0x0a, 0x06, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, - 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x06, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x12, 0x16, - 0x0a, 0x06, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x18, 0x02, 0x20, 0x03, 0x28, 0x09, 0x52, 0x06, - 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x27, 0x0a, 0x0f, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, - 0x73, 0x65, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x03, 0x20, 0x03, 0x28, 0x09, 0x52, - 0x0e, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, - 0x26, 0x0a, 0x0f, 0x6d, 0x61, 0x78, 0x5f, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x65, 0x63, 0x6f, 0x6e, - 0x64, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x0d, 0x6d, 0x61, 0x78, 0x41, 0x67, 0x65, - 0x53, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73, 0x1a, 0x5c, 0x0a, 0x0a, 0x45, 0x6e, 0x63, 0x72, 0x79, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4e, 0x0a, 0x0f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, - 0x5f, 0x6b, 0x6d, 0x73, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x26, - 0xfa, 0x41, 0x23, 0x0a, 0x21, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x6b, 0x6d, 0x73, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x43, 0x72, 0x79, - 0x70, 0x74, 0x6f, 0x4b, 0x65, 0x79, 0x52, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x4b, - 0x6d, 0x73, 0x4b, 0x65, 0x79, 0x1a, 0xb1, 0x02, 0x0a, 0x09, 0x49, 0x61, 0x6d, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x12, 0x7b, 0x0a, 0x1b, 0x75, 0x6e, 0x69, 0x66, 0x6f, 0x72, 0x6d, 0x5f, 0x62, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x5f, 0x61, 0x63, 0x63, 0x65, - 0x73, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, - 0x6b, 0x65, 0x74, 0x2e, 0x49, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x55, 0x6e, - 0x69, 0x66, 0x6f, 0x72, 0x6d, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x4c, 0x65, 0x76, 0x65, 0x6c, - 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x52, 0x18, 0x75, 0x6e, 0x69, 0x66, 0x6f, 0x72, 0x6d, 0x42, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, - 0x12, 0x38, 0x0a, 0x18, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x5f, 0x61, 0x63, 0x63, 0x65, 0x73, - 0x73, 0x5f, 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x16, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, - 0x50, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x6d, 0x0a, 0x18, 0x55, 0x6e, - 0x69, 0x66, 0x6f, 0x72, 0x6d, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x4c, 0x65, 0x76, 0x65, 0x6c, - 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, - 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, - 0x12, 0x37, 0x0a, 0x09, 0x6c, 0x6f, 0x63, 0x6b, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, - 0x08, 0x6c, 0x6f, 0x63, 0x6b, 0x54, 0x69, 0x6d, 0x65, 0x1a, 0xdb, 0x07, 0x0a, 0x09, 0x4c, 0x69, - 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x12, 0x3c, 0x0a, 0x04, 0x72, 0x75, 0x6c, 0x65, 0x18, - 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, - 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, - 0x2e, 0x4c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x2e, 0x52, 0x75, 0x6c, 0x65, 0x52, - 0x04, 0x72, 0x75, 0x6c, 0x65, 0x1a, 0x8f, 0x07, 0x0a, 0x04, 0x52, 0x75, 0x6c, 0x65, 0x12, 0x47, - 0x0a, 0x06, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x4c, 0x69, 0x66, 0x65, 0x63, 0x79, - 0x63, 0x6c, 0x65, 0x2e, 0x52, 0x75, 0x6c, 0x65, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x06, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x50, 0x0a, 0x09, 0x63, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x4c, 0x69, 0x66, 0x65, 0x63, 0x79, 0x63, 0x6c, 0x65, 0x2e, - 0x52, 0x75, 0x6c, 0x65, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, - 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x41, 0x0a, 0x06, 0x41, 0x63, 0x74, - 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x1a, 0xa8, 0x05, 0x0a, - 0x09, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1e, 0x0a, 0x08, 0x61, 0x67, - 0x65, 0x5f, 0x64, 0x61, 0x79, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x48, 0x00, 0x52, 0x07, - 0x61, 0x67, 0x65, 0x44, 0x61, 0x79, 0x73, 0x88, 0x01, 0x01, 0x12, 0x38, 0x0a, 0x0e, 0x63, 0x72, - 0x65, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x11, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, - 0x2e, 0x44, 0x61, 0x74, 0x65, 0x52, 0x0d, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x64, 0x42, 0x65, - 0x66, 0x6f, 0x72, 0x65, 0x12, 0x1c, 0x0a, 0x07, 0x69, 0x73, 0x5f, 0x6c, 0x69, 0x76, 0x65, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x08, 0x48, 0x01, 0x52, 0x06, 0x69, 0x73, 0x4c, 0x69, 0x76, 0x65, 0x88, - 0x01, 0x01, 0x12, 0x31, 0x0a, 0x12, 0x6e, 0x75, 0x6d, 0x5f, 0x6e, 0x65, 0x77, 0x65, 0x72, 0x5f, - 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x48, 0x02, - 0x52, 0x10, 0x6e, 0x75, 0x6d, 0x4e, 0x65, 0x77, 0x65, 0x72, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, - 0x6e, 0x73, 0x88, 0x01, 0x01, 0x12, 0x32, 0x0a, 0x15, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, - 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x05, - 0x20, 0x03, 0x28, 0x09, 0x52, 0x13, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x53, 0x74, 0x6f, - 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x12, 0x38, 0x0a, 0x16, 0x64, 0x61, 0x79, - 0x73, 0x5f, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x5f, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x74, - 0x69, 0x6d, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x05, 0x48, 0x03, 0x52, 0x13, 0x64, 0x61, 0x79, - 0x73, 0x53, 0x69, 0x6e, 0x63, 0x65, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x54, 0x69, 0x6d, 0x65, - 0x88, 0x01, 0x01, 0x12, 0x3f, 0x0a, 0x12, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x74, 0x69, - 0x6d, 0x65, 0x5f, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x11, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x44, 0x61, - 0x74, 0x65, 0x52, 0x10, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x54, 0x69, 0x6d, 0x65, 0x42, 0x65, - 0x66, 0x6f, 0x72, 0x65, 0x12, 0x40, 0x0a, 0x1a, 0x64, 0x61, 0x79, 0x73, 0x5f, 0x73, 0x69, 0x6e, - 0x63, 0x65, 0x5f, 0x6e, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x69, - 0x6d, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x05, 0x48, 0x04, 0x52, 0x17, 0x64, 0x61, 0x79, 0x73, - 0x53, 0x69, 0x6e, 0x63, 0x65, 0x4e, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x54, - 0x69, 0x6d, 0x65, 0x88, 0x01, 0x01, 0x12, 0x47, 0x0a, 0x16, 0x6e, 0x6f, 0x6e, 0x63, 0x75, 0x72, - 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, - 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x11, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x74, 0x79, 0x70, 0x65, 0x2e, 0x44, 0x61, 0x74, 0x65, 0x52, 0x14, 0x6e, 0x6f, 0x6e, 0x63, 0x75, - 0x72, 0x72, 0x65, 0x6e, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x12, - 0x25, 0x0a, 0x0e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, - 0x78, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0d, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, - 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x25, 0x0a, 0x0e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, - 0x73, 0x5f, 0x73, 0x75, 0x66, 0x66, 0x69, 0x78, 0x18, 0x0c, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0d, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x53, 0x75, 0x66, 0x66, 0x69, 0x78, 0x42, 0x0b, 0x0a, - 0x09, 0x5f, 0x61, 0x67, 0x65, 0x5f, 0x64, 0x61, 0x79, 0x73, 0x42, 0x0a, 0x0a, 0x08, 0x5f, 0x69, - 0x73, 0x5f, 0x6c, 0x69, 0x76, 0x65, 0x42, 0x15, 0x0a, 0x13, 0x5f, 0x6e, 0x75, 0x6d, 0x5f, 0x6e, - 0x65, 0x77, 0x65, 0x72, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x42, 0x19, 0x0a, - 0x17, 0x5f, 0x64, 0x61, 0x79, 0x73, 0x5f, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x5f, 0x63, 0x75, 0x73, - 0x74, 0x6f, 0x6d, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x42, 0x1d, 0x0a, 0x1b, 0x5f, 0x64, 0x61, 0x79, - 0x73, 0x5f, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x5f, 0x6e, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, - 0x6e, 0x74, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x1a, 0x54, 0x0a, 0x07, 0x4c, 0x6f, 0x67, 0x67, 0x69, - 0x6e, 0x67, 0x12, 0x1d, 0x0a, 0x0a, 0x6c, 0x6f, 0x67, 0x5f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x6c, 0x6f, 0x67, 0x42, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x12, 0x2a, 0x0a, 0x11, 0x6c, 0x6f, 0x67, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, - 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x6f, - 0x67, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x1a, 0xbb, 0x01, - 0x0a, 0x0f, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x12, 0x41, 0x0a, 0x0e, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x74, - 0x69, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x25, 0x0a, 0x0e, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6c, 0x6f, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0d, 0x64, + 0x61, 0x74, 0x61, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0xd6, 0x02, 0x0a, + 0x09, 0x41, 0x75, 0x74, 0x6f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x65, 0x6e, + 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x07, 0x65, 0x6e, 0x61, + 0x62, 0x6c, 0x65, 0x64, 0x12, 0x40, 0x0a, 0x0b, 0x74, 0x6f, 0x67, 0x67, 0x6c, 0x65, 0x5f, 0x74, + 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, - 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0d, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, - 0x54, 0x69, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x09, 0x69, 0x73, 0x5f, 0x6c, 0x6f, 0x63, 0x6b, 0x65, - 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x69, 0x73, 0x4c, 0x6f, 0x63, 0x6b, 0x65, - 0x64, 0x12, 0x48, 0x0a, 0x12, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, + 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0a, 0x74, 0x6f, 0x67, 0x67, + 0x6c, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x16, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, + 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x14, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, + 0x61, 0x6c, 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x88, 0x01, + 0x01, 0x12, 0x70, 0x0a, 0x22, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x5f, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x5f, 0x75, 0x70, 0x64, 0x61, + 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x11, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, - 0x69, 0x6f, 0x6e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xd3, 0x01, 0x0a, 0x10, - 0x53, 0x6f, 0x66, 0x74, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x12, 0x4d, 0x0a, 0x12, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x11, 0x72, 0x65, 0x74, 0x65, 0x6e, - 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x88, 0x01, 0x01, 0x12, - 0x46, 0x0a, 0x0e, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x74, 0x69, 0x6d, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, - 0x61, 0x6d, 0x70, 0x48, 0x01, 0x52, 0x0d, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, - 0x54, 0x69, 0x6d, 0x65, 0x88, 0x01, 0x01, 0x42, 0x15, 0x0a, 0x13, 0x5f, 0x72, 0x65, 0x74, 0x65, - 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x11, - 0x0a, 0x0f, 0x5f, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x74, 0x69, 0x6d, - 0x65, 0x1a, 0x26, 0x0a, 0x0a, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x12, - 0x18, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, - 0x52, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x1a, 0x59, 0x0a, 0x07, 0x57, 0x65, 0x62, - 0x73, 0x69, 0x74, 0x65, 0x12, 0x28, 0x0a, 0x10, 0x6d, 0x61, 0x69, 0x6e, 0x5f, 0x70, 0x61, 0x67, - 0x65, 0x5f, 0x73, 0x75, 0x66, 0x66, 0x69, 0x78, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, - 0x6d, 0x61, 0x69, 0x6e, 0x50, 0x61, 0x67, 0x65, 0x53, 0x75, 0x66, 0x66, 0x69, 0x78, 0x12, 0x24, - 0x0a, 0x0e, 0x6e, 0x6f, 0x74, 0x5f, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x70, 0x61, 0x67, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x6e, 0x6f, 0x74, 0x46, 0x6f, 0x75, 0x6e, 0x64, - 0x50, 0x61, 0x67, 0x65, 0x1a, 0x3e, 0x0a, 0x15, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x50, 0x6c, - 0x61, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x25, 0x0a, - 0x0e, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, - 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0d, 0x64, 0x61, 0x74, 0x61, 0x4c, 0x6f, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0xd6, 0x02, 0x0a, 0x09, 0x41, 0x75, 0x74, 0x6f, 0x63, 0x6c, 0x61, - 0x73, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x08, 0x52, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x40, 0x0a, 0x0b, - 0x74, 0x6f, 0x67, 0x67, 0x6c, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, - 0x41, 0x03, 0x52, 0x0a, 0x74, 0x6f, 0x67, 0x67, 0x6c, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x39, - 0x0a, 0x16, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, - 0x52, 0x14, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x88, 0x01, 0x01, 0x12, 0x70, 0x0a, 0x22, 0x74, 0x65, 0x72, - 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, - 0x61, 0x73, 0x73, 0x5f, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x48, 0x01, + 0x52, 0x1e, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, + 0x88, 0x01, 0x01, 0x42, 0x19, 0x0a, 0x17, 0x5f, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c, + 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x42, 0x25, + 0x0a, 0x23, 0x5f, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x5f, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, + 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x1a, 0x36, 0x0a, 0x15, 0x48, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, + 0x68, 0x69, 0x63, 0x61, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x12, 0x1d, + 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x42, + 0x03, 0xe0, 0x41, 0x01, 0x52, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x1a, 0x39, 0x0a, + 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, + 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, + 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x3a, 0x58, 0xea, 0x41, 0x55, 0x0a, 0x1d, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, + 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x23, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, + 0x2f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2f, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x7d, 0x2a, 0x07, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x32, 0x06, 0x62, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x22, 0x97, 0x02, 0x0a, 0x13, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x41, 0x63, 0x63, + 0x65, 0x73, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x12, 0x12, 0x0a, 0x04, 0x72, 0x6f, + 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x72, 0x6f, 0x6c, 0x65, 0x12, 0x0e, + 0x0a, 0x02, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x02, 0x69, 0x64, 0x12, 0x16, + 0x0a, 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, + 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x22, 0x0a, 0x0a, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, + 0x5f, 0x61, 0x6c, 0x74, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, + 0x09, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x41, 0x6c, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x65, 0x6e, + 0x74, 0x69, 0x74, 0x79, 0x5f, 0x69, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x65, + 0x6e, 0x74, 0x69, 0x74, 0x79, 0x49, 0x64, 0x12, 0x12, 0x0a, 0x04, 0x65, 0x74, 0x61, 0x67, 0x18, + 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x65, 0x74, 0x61, 0x67, 0x12, 0x14, 0x0a, 0x05, 0x65, + 0x6d, 0x61, 0x69, 0x6c, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x65, 0x6d, 0x61, 0x69, + 0x6c, 0x12, 0x16, 0x0a, 0x06, 0x64, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x06, 0x64, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x12, 0x41, 0x0a, 0x0c, 0x70, 0x72, 0x6f, + 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x74, 0x65, 0x61, 0x6d, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, + 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x54, 0x65, 0x61, 0x6d, 0x52, + 0x0b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x54, 0x65, 0x61, 0x6d, 0x22, 0x5a, 0x0a, 0x0f, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x12, + 0x1f, 0x0a, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, + 0x42, 0x05, 0xe0, 0x41, 0x01, 0x08, 0x01, 0x52, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, + 0x12, 0x1b, 0x0a, 0x06, 0x63, 0x72, 0x63, 0x33, 0x32, 0x63, 0x18, 0x02, 0x20, 0x01, 0x28, 0x07, + 0x48, 0x00, 0x52, 0x06, 0x63, 0x72, 0x63, 0x33, 0x32, 0x63, 0x88, 0x01, 0x01, 0x42, 0x09, 0x0a, + 0x07, 0x5f, 0x63, 0x72, 0x63, 0x33, 0x32, 0x63, 0x22, 0x54, 0x0a, 0x0f, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x12, 0x1b, 0x0a, 0x06, 0x63, + 0x72, 0x63, 0x33, 0x32, 0x63, 0x18, 0x01, 0x20, 0x01, 0x28, 0x07, 0x48, 0x00, 0x52, 0x06, 0x63, + 0x72, 0x63, 0x33, 0x32, 0x63, 0x88, 0x01, 0x01, 0x12, 0x19, 0x0a, 0x08, 0x6d, 0x64, 0x35, 0x5f, + 0x68, 0x61, 0x73, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x07, 0x6d, 0x64, 0x35, 0x48, + 0x61, 0x73, 0x68, 0x42, 0x09, 0x0a, 0x07, 0x5f, 0x63, 0x72, 0x63, 0x33, 0x32, 0x63, 0x22, 0x71, + 0x0a, 0x12, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x31, 0x0a, 0x14, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x61, 0x6c, 0x67, 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x13, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x6c, + 0x67, 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x12, 0x28, 0x0a, 0x10, 0x6b, 0x65, 0x79, 0x5f, 0x73, + 0x68, 0x61, 0x32, 0x35, 0x36, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0c, 0x52, 0x0e, 0x6b, 0x65, 0x79, 0x53, 0x68, 0x61, 0x32, 0x35, 0x36, 0x42, 0x79, 0x74, 0x65, + 0x73, 0x22, 0xbd, 0x0e, 0x0a, 0x06, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x17, 0x0a, 0x04, + 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x05, 0x52, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3d, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, 0x41, 0x05, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, + 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x12, 0x12, 0x0a, 0x04, 0x65, 0x74, 0x61, 0x67, 0x18, 0x1b, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x04, 0x65, 0x74, 0x61, 0x67, 0x12, 0x23, 0x0a, 0x0a, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, + 0x05, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2d, 0x0a, + 0x0d, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x23, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x48, 0x00, 0x52, 0x0c, 0x72, 0x65, 0x73, + 0x74, 0x6f, 0x72, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x88, 0x01, 0x01, 0x12, 0x2b, 0x0a, 0x0e, + 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, + 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0e, 0x6d, 0x65, 0x74, 0x61, 0x67, + 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x23, 0x0a, 0x0d, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x0c, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x12, 0x17, + 0x0a, 0x04, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, + 0x03, 0x52, 0x04, 0x73, 0x69, 0x7a, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x74, 0x65, + 0x6e, 0x74, 0x5f, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x18, 0x07, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, + 0x6e, 0x67, 0x12, 0x2f, 0x0a, 0x13, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x64, 0x69, + 0x73, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x12, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x44, 0x69, 0x73, 0x70, 0x6f, 0x73, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x23, 0x0a, 0x0d, 0x63, 0x61, 0x63, 0x68, 0x65, 0x5f, 0x63, 0x6f, 0x6e, + 0x74, 0x72, 0x6f, 0x6c, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x63, 0x61, 0x63, 0x68, + 0x65, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x12, 0x38, 0x0a, 0x03, 0x61, 0x63, 0x6c, 0x18, + 0x0a, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x52, 0x03, 0x61, + 0x63, 0x6c, 0x12, 0x29, 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x6c, 0x61, + 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x63, 0x6f, + 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x12, 0x40, 0x0a, + 0x0b, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x0c, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, + 0xe0, 0x41, 0x03, 0x52, 0x0a, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, + 0x44, 0x0a, 0x0d, 0x66, 0x69, 0x6e, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, + 0x18, 0x24, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, + 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0c, 0x66, 0x69, 0x6e, 0x61, 0x6c, 0x69, 0x7a, + 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, + 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x63, 0x6f, 0x6e, + 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x40, 0x0a, 0x0b, 0x63, 0x72, 0x65, 0x61, + 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0a, + 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x2c, 0x0a, 0x0f, 0x63, 0x6f, + 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x0f, 0x20, + 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0e, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, + 0x65, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x45, 0x0a, 0x09, 0x63, 0x68, 0x65, 0x63, + 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x10, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, + 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x42, + 0x03, 0xe0, 0x41, 0x03, 0x52, 0x09, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x12, + 0x40, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x11, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, + 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, + 0x65, 0x12, 0x3f, 0x0a, 0x07, 0x6b, 0x6d, 0x73, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x12, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x26, 0xfa, 0x41, 0x23, 0x0a, 0x21, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x6b, 0x6d, + 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x4b, 0x65, 0x79, 0x52, 0x06, 0x6b, 0x6d, 0x73, 0x4b, + 0x65, 0x79, 0x12, 0x5a, 0x0a, 0x19, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, + 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, - 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x48, 0x01, 0x52, 0x1e, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, - 0x61, 0x6c, 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x55, 0x70, - 0x64, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x88, 0x01, 0x01, 0x42, 0x19, 0x0a, 0x17, 0x5f, - 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x42, 0x25, 0x0a, 0x23, 0x5f, 0x74, 0x65, 0x72, 0x6d, 0x69, - 0x6e, 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, - 0x73, 0x5f, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x1a, 0x36, 0x0a, - 0x15, 0x48, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x4e, 0x61, 0x6d, - 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x12, 0x1d, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, - 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x07, 0x65, 0x6e, - 0x61, 0x62, 0x6c, 0x65, 0x64, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, + 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x16, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x53, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x25, + 0x0a, 0x0e, 0x74, 0x65, 0x6d, 0x70, 0x6f, 0x72, 0x61, 0x72, 0x79, 0x5f, 0x68, 0x6f, 0x6c, 0x64, + 0x18, 0x14, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, 0x74, 0x65, 0x6d, 0x70, 0x6f, 0x72, 0x61, 0x72, + 0x79, 0x48, 0x6f, 0x6c, 0x64, 0x12, 0x4e, 0x0a, 0x15, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x15, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, + 0x52, 0x13, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x45, 0x78, 0x70, 0x69, 0x72, + 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x43, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, + 0x61, 0x18, 0x16, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x45, 0x6e, 0x74, 0x72, 0x79, + 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x2d, 0x0a, 0x10, 0x65, 0x76, + 0x65, 0x6e, 0x74, 0x5f, 0x62, 0x61, 0x73, 0x65, 0x64, 0x5f, 0x68, 0x6f, 0x6c, 0x64, 0x18, 0x17, + 0x20, 0x01, 0x28, 0x08, 0x48, 0x01, 0x52, 0x0e, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x42, 0x61, 0x73, + 0x65, 0x64, 0x48, 0x6f, 0x6c, 0x64, 0x88, 0x01, 0x01, 0x12, 0x33, 0x0a, 0x05, 0x6f, 0x77, 0x6e, + 0x65, 0x72, 0x18, 0x18, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x77, 0x6e, + 0x65, 0x72, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x56, + 0x0a, 0x13, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72, 0x5f, 0x65, 0x6e, 0x63, 0x72, 0x79, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x19, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, + 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x52, 0x12, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72, 0x45, 0x6e, 0x63, 0x72, + 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3b, 0x0a, 0x0b, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, + 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x1a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, + 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0a, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x54, + 0x69, 0x6d, 0x65, 0x12, 0x4e, 0x0a, 0x10, 0x73, 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x65, + 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x1c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x48, 0x02, + 0x52, 0x0e, 0x73, 0x6f, 0x66, 0x74, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, + 0x88, 0x01, 0x01, 0x12, 0x4e, 0x0a, 0x10, 0x68, 0x61, 0x72, 0x64, 0x5f, 0x64, 0x65, 0x6c, 0x65, + 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x1d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x48, 0x03, + 0x52, 0x0e, 0x68, 0x61, 0x72, 0x64, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, + 0x88, 0x01, 0x01, 0x1a, 0x3b, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, - 0x3a, 0x58, 0xea, 0x41, 0x55, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x12, 0x23, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, - 0x2f, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x7d, 0x2a, 0x07, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x73, 0x32, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x22, 0x97, 0x02, 0x0a, 0x13, 0x42, - 0x75, 0x63, 0x6b, 0x65, 0x74, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x72, - 0x6f, 0x6c, 0x12, 0x12, 0x0a, 0x04, 0x72, 0x6f, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x72, 0x6f, 0x6c, 0x65, 0x12, 0x0e, 0x0a, 0x02, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x02, 0x69, 0x64, 0x12, 0x16, 0x0a, 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x22, - 0x0a, 0x0a, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5f, 0x61, 0x6c, 0x74, 0x18, 0x09, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x09, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x41, - 0x6c, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5f, 0x69, 0x64, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x49, 0x64, 0x12, - 0x12, 0x0a, 0x04, 0x65, 0x74, 0x61, 0x67, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x65, - 0x74, 0x61, 0x67, 0x12, 0x14, 0x0a, 0x05, 0x65, 0x6d, 0x61, 0x69, 0x6c, 0x18, 0x05, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x05, 0x65, 0x6d, 0x61, 0x69, 0x6c, 0x12, 0x16, 0x0a, 0x06, 0x64, 0x6f, 0x6d, - 0x61, 0x69, 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x64, 0x6f, 0x6d, 0x61, 0x69, - 0x6e, 0x12, 0x41, 0x0a, 0x0c, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x74, 0x65, 0x61, - 0x6d, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x72, 0x6f, 0x6a, - 0x65, 0x63, 0x74, 0x54, 0x65, 0x61, 0x6d, 0x52, 0x0b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x54, 0x65, 0x61, 0x6d, 0x22, 0x5a, 0x0a, 0x0f, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, - 0x6d, 0x65, 0x64, 0x44, 0x61, 0x74, 0x61, 0x12, 0x1f, 0x0a, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, - 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x42, 0x05, 0xe0, 0x41, 0x01, 0x08, 0x01, 0x52, - 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x06, 0x63, 0x72, 0x63, 0x33, - 0x32, 0x63, 0x18, 0x02, 0x20, 0x01, 0x28, 0x07, 0x48, 0x00, 0x52, 0x06, 0x63, 0x72, 0x63, 0x33, - 0x32, 0x63, 0x88, 0x01, 0x01, 0x42, 0x09, 0x0a, 0x07, 0x5f, 0x63, 0x72, 0x63, 0x33, 0x32, 0x63, - 0x22, 0x54, 0x0a, 0x0f, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x73, - 0x75, 0x6d, 0x73, 0x12, 0x1b, 0x0a, 0x06, 0x63, 0x72, 0x63, 0x33, 0x32, 0x63, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x07, 0x48, 0x00, 0x52, 0x06, 0x63, 0x72, 0x63, 0x33, 0x32, 0x63, 0x88, 0x01, 0x01, - 0x12, 0x19, 0x0a, 0x08, 0x6d, 0x64, 0x35, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0c, 0x52, 0x07, 0x6d, 0x64, 0x35, 0x48, 0x61, 0x73, 0x68, 0x42, 0x09, 0x0a, 0x07, 0x5f, - 0x63, 0x72, 0x63, 0x33, 0x32, 0x63, 0x22, 0x71, 0x0a, 0x12, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, - 0x65, 0x72, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x31, 0x0a, 0x14, - 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, 0x6c, 0x67, 0x6f, 0x72, - 0x69, 0x74, 0x68, 0x6d, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13, 0x65, 0x6e, 0x63, 0x72, - 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x6c, 0x67, 0x6f, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x12, - 0x28, 0x0a, 0x10, 0x6b, 0x65, 0x79, 0x5f, 0x73, 0x68, 0x61, 0x32, 0x35, 0x36, 0x5f, 0x62, 0x79, - 0x74, 0x65, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x0e, 0x6b, 0x65, 0x79, 0x53, 0x68, - 0x61, 0x32, 0x35, 0x36, 0x42, 0x79, 0x74, 0x65, 0x73, 0x22, 0xbd, 0x0e, 0x0a, 0x06, 0x4f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x05, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3d, 0x0a, - 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x25, 0xe0, - 0x41, 0x05, 0xfa, 0x41, 0x1f, 0x0a, 0x1d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x42, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x12, 0x0a, 0x04, - 0x65, 0x74, 0x61, 0x67, 0x18, 0x1b, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x65, 0x74, 0x61, 0x67, - 0x12, 0x23, 0x0a, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x05, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2d, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, - 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x23, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, - 0x03, 0x48, 0x00, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x54, 0x6f, 0x6b, 0x65, - 0x6e, 0x88, 0x01, 0x01, 0x12, 0x2b, 0x0a, 0x0e, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, - 0x03, 0x52, 0x0e, 0x6d, 0x65, 0x74, 0x61, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x23, 0x0a, 0x0d, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, - 0x73, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x12, 0x17, 0x0a, 0x04, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x06, - 0x20, 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x04, 0x73, 0x69, 0x7a, 0x65, 0x12, - 0x29, 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x65, 0x6e, 0x63, 0x6f, 0x64, - 0x69, 0x6e, 0x67, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x74, 0x65, - 0x6e, 0x74, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x2f, 0x0a, 0x13, 0x63, 0x6f, - 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x64, 0x69, 0x73, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x12, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, - 0x44, 0x69, 0x73, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x23, 0x0a, 0x0d, 0x63, - 0x61, 0x63, 0x68, 0x65, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x18, 0x09, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x0c, 0x63, 0x61, 0x63, 0x68, 0x65, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, - 0x12, 0x38, 0x0a, 0x03, 0x61, 0x63, 0x6c, 0x18, 0x0a, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, - 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x43, 0x6f, - 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x52, 0x03, 0x61, 0x63, 0x6c, 0x12, 0x29, 0x0a, 0x10, 0x63, 0x6f, - 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x0b, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4c, 0x61, 0x6e, - 0x67, 0x75, 0x61, 0x67, 0x65, 0x12, 0x40, 0x0a, 0x0b, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x5f, - 0x74, 0x69, 0x6d, 0x65, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, - 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0a, 0x64, 0x65, 0x6c, - 0x65, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x44, 0x0a, 0x0d, 0x66, 0x69, 0x6e, 0x61, 0x6c, - 0x69, 0x7a, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x24, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, - 0x0c, 0x66, 0x69, 0x6e, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x21, 0x0a, - 0x0c, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x0d, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x0b, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, - 0x12, 0x40, 0x0a, 0x0b, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, - 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, - 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0a, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, - 0x6d, 0x65, 0x12, 0x2c, 0x0a, 0x0f, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x5f, - 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x0f, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, 0x41, 0x03, - 0x52, 0x0e, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, - 0x12, 0x45, 0x0a, 0x09, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x18, 0x10, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, - 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x68, - 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x09, 0x63, 0x68, - 0x65, 0x63, 0x6b, 0x73, 0x75, 0x6d, 0x73, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, - 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, - 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x0a, 0x75, - 0x70, 0x64, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x3f, 0x0a, 0x07, 0x6b, 0x6d, 0x73, - 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x12, 0x20, 0x01, 0x28, 0x09, 0x42, 0x26, 0xfa, 0x41, 0x23, 0x0a, - 0x21, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x6b, 0x6d, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x4b, - 0x65, 0x79, 0x52, 0x06, 0x6b, 0x6d, 0x73, 0x4b, 0x65, 0x79, 0x12, 0x5a, 0x0a, 0x19, 0x75, 0x70, - 0x64, 0x61, 0x74, 0x65, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x6c, 0x61, - 0x73, 0x73, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x16, - 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x43, 0x6c, 0x61, - 0x73, 0x73, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x74, 0x65, 0x6d, 0x70, 0x6f, 0x72, - 0x61, 0x72, 0x79, 0x5f, 0x68, 0x6f, 0x6c, 0x64, 0x18, 0x14, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, - 0x74, 0x65, 0x6d, 0x70, 0x6f, 0x72, 0x61, 0x72, 0x79, 0x48, 0x6f, 0x6c, 0x64, 0x12, 0x4e, 0x0a, - 0x15, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x65, 0x78, 0x70, 0x69, 0x72, - 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, - 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x13, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, - 0x69, 0x6f, 0x6e, 0x45, 0x78, 0x70, 0x69, 0x72, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x43, 0x0a, - 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x16, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, - 0x61, 0x74, 0x61, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, - 0x74, 0x61, 0x12, 0x2d, 0x0a, 0x10, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x5f, 0x62, 0x61, 0x73, 0x65, - 0x64, 0x5f, 0x68, 0x6f, 0x6c, 0x64, 0x18, 0x17, 0x20, 0x01, 0x28, 0x08, 0x48, 0x01, 0x52, 0x0e, - 0x65, 0x76, 0x65, 0x6e, 0x74, 0x42, 0x61, 0x73, 0x65, 0x64, 0x48, 0x6f, 0x6c, 0x64, 0x88, 0x01, - 0x01, 0x12, 0x33, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x18, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x77, 0x6e, 0x65, 0x72, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, - 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x56, 0x0a, 0x13, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, - 0x65, 0x72, 0x5f, 0x65, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x19, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, - 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72, - 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x12, 0x63, 0x75, 0x73, 0x74, - 0x6f, 0x6d, 0x65, 0x72, 0x45, 0x6e, 0x63, 0x72, 0x79, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3b, - 0x0a, 0x0b, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x1a, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, - 0x0a, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x4e, 0x0a, 0x10, 0x73, - 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, - 0x1c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, - 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x48, 0x02, 0x52, 0x0e, 0x73, 0x6f, 0x66, 0x74, 0x44, 0x65, - 0x6c, 0x65, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x88, 0x01, 0x01, 0x12, 0x4e, 0x0a, 0x10, 0x68, - 0x61, 0x72, 0x64, 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, - 0x1d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, - 0x70, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x48, 0x03, 0x52, 0x0e, 0x68, 0x61, 0x72, 0x64, 0x44, 0x65, - 0x6c, 0x65, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x88, 0x01, 0x01, 0x1a, 0x3b, 0x0a, 0x0d, 0x4d, - 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, - 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, - 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x42, 0x10, 0x0a, 0x0e, 0x5f, 0x72, 0x65, 0x73, - 0x74, 0x6f, 0x72, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x42, 0x13, 0x0a, 0x11, 0x5f, 0x65, - 0x76, 0x65, 0x6e, 0x74, 0x5f, 0x62, 0x61, 0x73, 0x65, 0x64, 0x5f, 0x68, 0x6f, 0x6c, 0x64, 0x42, - 0x13, 0x0a, 0x11, 0x5f, 0x73, 0x6f, 0x66, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x5f, - 0x74, 0x69, 0x6d, 0x65, 0x42, 0x13, 0x0a, 0x11, 0x5f, 0x68, 0x61, 0x72, 0x64, 0x5f, 0x64, 0x65, - 0x6c, 0x65, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x22, 0x97, 0x02, 0x0a, 0x13, 0x4f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, - 0x6c, 0x12, 0x12, 0x0a, 0x04, 0x72, 0x6f, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x04, 0x72, 0x6f, 0x6c, 0x65, 0x12, 0x0e, 0x0a, 0x02, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x02, 0x69, 0x64, 0x12, 0x16, 0x0a, 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x22, 0x0a, - 0x0a, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5f, 0x61, 0x6c, 0x74, 0x18, 0x09, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x09, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x41, 0x6c, - 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5f, 0x69, 0x64, 0x18, 0x04, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x49, 0x64, 0x12, 0x12, - 0x0a, 0x04, 0x65, 0x74, 0x61, 0x67, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x65, 0x74, - 0x61, 0x67, 0x12, 0x14, 0x0a, 0x05, 0x65, 0x6d, 0x61, 0x69, 0x6c, 0x18, 0x05, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x05, 0x65, 0x6d, 0x61, 0x69, 0x6c, 0x12, 0x16, 0x0a, 0x06, 0x64, 0x6f, 0x6d, 0x61, - 0x69, 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x64, 0x6f, 0x6d, 0x61, 0x69, 0x6e, - 0x12, 0x41, 0x0a, 0x0c, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x74, 0x65, 0x61, 0x6d, - 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x54, 0x65, 0x61, 0x6d, 0x52, 0x0b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x54, - 0x65, 0x61, 0x6d, 0x22, 0x8e, 0x01, 0x0a, 0x13, 0x4c, 0x69, 0x73, 0x74, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x33, 0x0a, 0x07, 0x6f, - 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x07, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, - 0x12, 0x1a, 0x0a, 0x08, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, - 0x28, 0x09, 0x52, 0x08, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, - 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, - 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0x48, 0x0a, 0x0b, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x54, - 0x65, 0x61, 0x6d, 0x12, 0x25, 0x0a, 0x0e, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x6e, - 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, 0x6f, - 0x6a, 0x65, 0x63, 0x74, 0x4e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x65, - 0x61, 0x6d, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x65, 0x61, 0x6d, 0x22, 0x3c, - 0x0a, 0x05, 0x4f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x16, 0x0a, 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, - 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, - 0x1b, 0x0a, 0x09, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5f, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x08, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x49, 0x64, 0x22, 0x5f, 0x0a, 0x0c, - 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, - 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x52, 0x05, 0x73, 0x74, 0x61, - 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, - 0x03, 0x65, 0x6e, 0x64, 0x12, 0x27, 0x0a, 0x0f, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, - 0x5f, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0e, 0x63, - 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x4c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x32, 0xa5, 0x1d, - 0x0a, 0x07, 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x12, 0x72, 0x0a, 0x0c, 0x44, 0x65, 0x6c, - 0x65, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x44, 0x65, - 0x6c, 0x65, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x22, 0xda, 0x41, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x15, 0x12, 0x13, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x6f, 0x0a, - 0x09, 0x47, 0x65, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x23, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x47, - 0x65, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, - 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x22, 0x22, 0xda, 0x41, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x15, 0x12, 0x13, 0x0a, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0xab, - 0x01, 0x0a, 0x0c, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, - 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, - 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, - 0x65, 0x74, 0x22, 0x58, 0xda, 0x41, 0x17, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x2c, 0x62, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x69, 0x64, 0x8a, 0xd3, - 0xe4, 0x93, 0x02, 0x38, 0x12, 0x16, 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x0c, - 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x1e, 0x0a, 0x0e, - 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x0c, - 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x85, 0x01, 0x0a, - 0x0b, 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x12, 0x25, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x1a, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, - 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, 0x6b, - 0x65, 0x74, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x27, 0xda, 0x41, 0x06, - 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x18, 0x12, 0x16, 0x0a, 0x06, - 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x0c, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x93, 0x01, 0x0a, 0x19, 0x4c, 0x6f, 0x63, 0x6b, 0x42, 0x75, 0x63, - 0x6b, 0x65, 0x74, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, - 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4c, 0x6f, 0x63, 0x6b, 0x42, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x42, 0x10, 0x0a, 0x0e, 0x5f, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x5f, 0x74, 0x6f, 0x6b, + 0x65, 0x6e, 0x42, 0x13, 0x0a, 0x11, 0x5f, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x5f, 0x62, 0x61, 0x73, + 0x65, 0x64, 0x5f, 0x68, 0x6f, 0x6c, 0x64, 0x42, 0x13, 0x0a, 0x11, 0x5f, 0x73, 0x6f, 0x66, 0x74, + 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x42, 0x13, 0x0a, 0x11, + 0x5f, 0x68, 0x61, 0x72, 0x64, 0x5f, 0x64, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x5f, 0x74, 0x69, 0x6d, + 0x65, 0x22, 0x97, 0x02, 0x0a, 0x13, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x41, 0x63, 0x63, 0x65, + 0x73, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x12, 0x12, 0x0a, 0x04, 0x72, 0x6f, 0x6c, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x72, 0x6f, 0x6c, 0x65, 0x12, 0x0e, 0x0a, + 0x02, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x02, 0x69, 0x64, 0x12, 0x16, 0x0a, + 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x65, + 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x22, 0x0a, 0x0a, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5f, + 0x61, 0x6c, 0x74, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x09, + 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x41, 0x6c, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x65, 0x6e, 0x74, + 0x69, 0x74, 0x79, 0x5f, 0x69, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x65, 0x6e, + 0x74, 0x69, 0x74, 0x79, 0x49, 0x64, 0x12, 0x12, 0x0a, 0x04, 0x65, 0x74, 0x61, 0x67, 0x18, 0x08, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x65, 0x74, 0x61, 0x67, 0x12, 0x14, 0x0a, 0x05, 0x65, 0x6d, + 0x61, 0x69, 0x6c, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x65, 0x6d, 0x61, 0x69, 0x6c, + 0x12, 0x16, 0x0a, 0x06, 0x64, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x06, 0x64, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x12, 0x41, 0x0a, 0x0c, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x5f, 0x74, 0x65, 0x61, 0x6d, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, + 0x76, 0x32, 0x2e, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x54, 0x65, 0x61, 0x6d, 0x52, 0x0b, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x54, 0x65, 0x61, 0x6d, 0x22, 0x8e, 0x01, 0x0a, 0x13, + 0x4c, 0x69, 0x73, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x12, 0x33, 0x0a, 0x07, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x18, 0x01, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, + 0x07, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x12, 0x1a, 0x0a, 0x08, 0x70, 0x72, 0x65, 0x66, + 0x69, 0x78, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x09, 0x52, 0x08, 0x70, 0x72, 0x65, 0x66, + 0x69, 0x78, 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, + 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, + 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0x48, 0x0a, 0x0b, + 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x54, 0x65, 0x61, 0x6d, 0x12, 0x25, 0x0a, 0x0e, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x4e, 0x75, 0x6d, 0x62, + 0x65, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x65, 0x61, 0x6d, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x04, 0x74, 0x65, 0x61, 0x6d, 0x22, 0x3c, 0x0a, 0x05, 0x4f, 0x77, 0x6e, 0x65, 0x72, 0x12, + 0x16, 0x0a, 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x06, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x1b, 0x0a, 0x09, 0x65, 0x6e, 0x74, 0x69, 0x74, + 0x79, 0x5f, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x65, 0x6e, 0x74, 0x69, + 0x74, 0x79, 0x49, 0x64, 0x22, 0x5f, 0x0a, 0x0c, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x52, + 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x03, 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, + 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x12, 0x27, 0x0a, 0x0f, + 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x5f, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0e, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x4c, + 0x65, 0x6e, 0x67, 0x74, 0x68, 0x32, 0xc1, 0x1e, 0x0a, 0x07, 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x12, 0x72, 0x0a, 0x0c, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x12, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, + 0x79, 0x22, 0x22, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x15, + 0x12, 0x13, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x6f, 0x0a, 0x09, 0x47, 0x65, 0x74, 0x42, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x12, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x47, 0x65, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, - 0x65, 0x74, 0x22, 0x26, 0xda, 0x41, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x8a, 0xd3, 0xe4, - 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, - 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x75, 0x0a, 0x0c, 0x47, 0x65, - 0x74, 0x49, 0x61, 0x6d, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x22, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x47, 0x65, 0x74, 0x49, 0x61, - 0x6d, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x15, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x2a, 0xda, 0x41, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x19, 0x12, 0x17, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, - 0x7d, 0x12, 0x7c, 0x0a, 0x0c, 0x53, 0x65, 0x74, 0x49, 0x61, 0x6d, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x12, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, 0x76, - 0x31, 0x2e, 0x53, 0x65, 0x74, 0x49, 0x61, 0x6d, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x69, - 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x31, 0xda, 0x41, - 0x0f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2c, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x19, 0x12, 0x17, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, - 0x96, 0x02, 0x0a, 0x12, 0x54, 0x65, 0x73, 0x74, 0x49, 0x61, 0x6d, 0x50, 0x65, 0x72, 0x6d, 0x69, - 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x65, 0x73, 0x74, 0x49, 0x61, 0x6d, 0x50, 0x65, - 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, - 0x2e, 0x54, 0x65, 0x73, 0x74, 0x49, 0x61, 0x6d, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, - 0x6f, 0x6e, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0xaa, 0x01, 0xda, 0x41, - 0x14, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2c, 0x70, 0x65, 0x72, 0x6d, 0x69, 0x73, - 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x8c, 0x01, 0x12, 0x17, 0x0a, 0x08, - 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x34, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x12, 0x28, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2f, 0x2a, 0x7d, - 0x2f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2a, 0x12, 0x3b, 0x0a, 0x08, 0x72, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x2f, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, - 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x62, 0x75, 0x63, 0x6b, - 0x65, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x64, 0x46, 0x6f, - 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x12, 0x8a, 0x01, 0x0a, 0x0c, 0x55, 0x70, 0x64, - 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x55, 0x70, - 0x64, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x22, 0x37, 0xda, 0x41, - 0x12, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, - 0x61, 0x73, 0x6b, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x1c, 0x12, 0x1a, 0x0a, 0x0b, 0x62, 0x75, 0x63, - 0x6b, 0x65, 0x74, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x7e, 0x0a, 0x0d, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, - 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x70, 0x6f, - 0x73, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, + 0x65, 0x74, 0x22, 0x22, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x8a, 0xd3, 0xe4, 0x93, 0x02, + 0x15, 0x12, 0x13, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0xab, 0x01, 0x0a, 0x0c, 0x43, 0x72, 0x65, 0x61, 0x74, + 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x72, 0x65, 0x61, + 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, - 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x22, 0x29, 0x8a, 0xd3, 0xe4, 0x93, - 0x02, 0x23, 0x12, 0x21, 0x0a, 0x12, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x2e, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x98, 0x01, 0x0a, 0x0c, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, - 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, - 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x48, 0xda, 0x41, 0x0d, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0xda, 0x41, 0x18, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2c, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, - 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, - 0x12, 0x8d, 0x01, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x12, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, - 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x4f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, - 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x22, 0x38, 0xda, 0x41, 0x18, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2c, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, - 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, - 0x12, 0xba, 0x01, 0x0a, 0x14, 0x43, 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x52, 0x65, 0x73, 0x75, 0x6d, - 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x61, - 0x6e, 0x63, 0x65, 0x6c, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, - 0x74, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x61, - 0x6e, 0x63, 0x65, 0x6c, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, - 0x74, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x41, 0xda, 0x41, 0x09, 0x75, - 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x2f, 0x12, 0x2d, - 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x12, 0x20, 0x7b, 0x62, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, - 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x2a, 0x2a, 0x12, 0x95, 0x01, - 0x0a, 0x09, 0x47, 0x65, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x23, 0x2e, 0x67, 0x6f, + 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x22, 0x58, 0xda, 0x41, 0x17, 0x70, + 0x61, 0x72, 0x65, 0x6e, 0x74, 0x2c, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x62, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x5f, 0x69, 0x64, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x38, 0x12, 0x16, 0x0a, 0x06, + 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x0c, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, + 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x1e, 0x0a, 0x0e, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x0c, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, + 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x85, 0x01, 0x0a, 0x0b, 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x73, 0x12, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, - 0x47, 0x65, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x22, 0x48, 0xda, 0x41, 0x0d, - 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0xda, 0x41, 0x18, - 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2c, 0x67, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, - 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0xa5, 0x01, 0x0a, 0x0a, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x12, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, - 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x25, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, - 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, - 0x65, 0x22, 0x48, 0xda, 0x41, 0x0d, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0xda, 0x41, 0x18, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, - 0x65, 0x63, 0x74, 0x2c, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x8a, 0xd3, - 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, - 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x30, 0x01, 0x12, 0x8c, 0x01, - 0x0a, 0x0c, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x26, + 0x4c, 0x69, 0x73, 0x74, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x22, 0x27, 0xda, 0x41, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x8a, 0xd3, + 0xe4, 0x93, 0x02, 0x18, 0x12, 0x16, 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x0c, + 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x93, 0x01, 0x0a, + 0x19, 0x4c, 0x6f, 0x63, 0x6b, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x74, 0x65, 0x6e, + 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4c, + 0x6f, 0x63, 0x6b, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, + 0x6f, 0x6e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, + 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, + 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x22, 0x26, 0xda, 0x41, 0x06, 0x62, + 0x75, 0x63, 0x6b, 0x65, 0x74, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, + 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, + 0x2a, 0x7d, 0x12, 0x75, 0x0a, 0x0c, 0x47, 0x65, 0x74, 0x49, 0x61, 0x6d, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x12, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, + 0x76, 0x31, 0x2e, 0x47, 0x65, 0x74, 0x49, 0x61, 0x6d, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x2a, 0xda, + 0x41, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x19, + 0x12, 0x17, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x0b, 0x7b, 0x62, + 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x7c, 0x0a, 0x0c, 0x53, 0x65, 0x74, + 0x49, 0x61, 0x6d, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x65, 0x74, 0x49, 0x61, 0x6d, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x15, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x22, 0x31, 0xda, 0x41, 0x0f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x2c, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x19, 0x12, 0x17, + 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x96, 0x02, 0x0a, 0x12, 0x54, 0x65, 0x73, 0x74, + 0x49, 0x61, 0x6d, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x28, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x54, + 0x65, 0x73, 0x74, 0x49, 0x61, 0x6d, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, + 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x69, 0x61, 0x6d, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x65, 0x73, 0x74, 0x49, 0x61, 0x6d, + 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x22, 0xaa, 0x01, 0xda, 0x41, 0x14, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x2c, 0x70, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x8a, 0xd3, 0xe4, + 0x93, 0x02, 0x8c, 0x01, 0x12, 0x17, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x34, 0x0a, + 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x28, 0x7b, 0x62, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x62, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, + 0x2f, 0x2a, 0x2a, 0x12, 0x3b, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, + 0x2f, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, + 0x73, 0x2f, 0x2a, 0x2f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, + 0x61, 0x6e, 0x61, 0x67, 0x65, 0x64, 0x46, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x2a, 0x2a, + 0x12, 0x8a, 0x01, 0x0a, 0x0c, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x12, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x42, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x22, 0x37, 0xda, 0x41, 0x12, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, + 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x8a, 0xd3, 0xe4, 0x93, 0x02, + 0x1c, 0x12, 0x1a, 0x0a, 0x0b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2e, 0x6e, 0x61, 0x6d, 0x65, + 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x7e, 0x0a, + 0x0d, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x76, 0x32, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x22, 0x39, 0xda, 0x41, 0x12, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2c, 0x75, 0x70, 0x64, - 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x1e, 0x12, 0x1c, - 0x0a, 0x0d, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2e, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, - 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x60, 0x0a, 0x0b, - 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x25, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, - 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x1a, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, - 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x00, 0x28, 0x01, 0x12, 0x6e, - 0x0a, 0x0f, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x12, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, - 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, - 0x2e, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, - 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x00, 0x28, 0x01, 0x30, 0x01, 0x12, 0x84, - 0x01, 0x0a, 0x0b, 0x4c, 0x69, 0x73, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x12, 0x25, + 0x76, 0x32, 0x2e, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x22, 0x29, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x23, 0x12, 0x21, 0x0a, 0x12, 0x64, 0x65, + 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x98, 0x01, + 0x0a, 0x0c, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, - 0x76, 0x32, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, - 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4f, 0x62, - 0x6a, 0x65, 0x63, 0x74, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x26, 0xda, - 0x41, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, - 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, - 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x98, 0x01, 0x0a, 0x0d, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, - 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x77, 0x72, - 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, - 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x73, 0x70, - 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x3a, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x34, 0x12, 0x0f, 0x0a, 0x0d, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x21, 0x0a, - 0x12, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x62, 0x75, 0x63, + 0x76, 0x32, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x48, + 0xda, 0x41, 0x0d, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0xda, 0x41, 0x18, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x2c, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x8a, 0xd3, 0xe4, 0x93, 0x02, + 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x8d, 0x01, 0x0a, 0x0d, 0x52, 0x65, 0x73, + 0x74, 0x6f, 0x72, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x27, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, + 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x22, 0x38, + 0xda, 0x41, 0x18, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x2c, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x8a, 0xd3, 0xe4, 0x93, 0x02, + 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0xba, 0x01, 0x0a, 0x14, 0x43, 0x61, 0x6e, + 0x63, 0x65, 0x6c, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, + 0x65, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x52, 0x65, 0x73, 0x75, + 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, + 0x74, 0x1a, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x52, 0x65, 0x73, 0x75, + 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, + 0x73, 0x65, 0x22, 0x41, 0xda, 0x41, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, + 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x2f, 0x12, 0x2d, 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, + 0x5f, 0x69, 0x64, 0x12, 0x20, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x70, 0x72, 0x6f, + 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2f, + 0x2a, 0x7d, 0x2f, 0x2a, 0x2a, 0x12, 0x95, 0x01, 0x0a, 0x09, 0x47, 0x65, 0x74, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x12, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, + 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x47, 0x65, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x22, 0x48, 0xda, 0x41, 0x0d, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0xda, 0x41, 0x18, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2c, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0xa5, 0x01, + 0x0a, 0x0a, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x24, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, + 0x2e, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x1a, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x48, 0xda, 0x41, 0x0d, 0x62, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0xda, 0x41, 0x18, 0x62, 0x75, + 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2c, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, + 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, + 0x2a, 0x2a, 0x7d, 0x30, 0x01, 0x12, 0x99, 0x01, 0x0a, 0x0e, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, + 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, + 0x69, 0x52, 0x65, 0x61, 0x64, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, 0x52, 0x65, 0x61, 0x64, 0x4f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x2e, 0x8a, + 0xd3, 0xe4, 0x93, 0x02, 0x28, 0x12, 0x26, 0x0a, 0x17, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x2e, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x28, 0x01, 0x30, + 0x01, 0x12, 0x8c, 0x01, 0x0a, 0x0c, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x12, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x22, 0x39, 0xda, 0x41, 0x12, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, + 0x2c, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x8a, 0xd3, 0xe4, 0x93, + 0x02, 0x1e, 0x12, 0x1c, 0x0a, 0x0d, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2e, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, - 0x12, 0xae, 0x01, 0x0a, 0x13, 0x53, 0x74, 0x61, 0x72, 0x74, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, - 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x12, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x53, 0x74, 0x61, - 0x72, 0x74, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, - 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x53, 0x74, 0x61, 0x72, - 0x74, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x52, - 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x38, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x32, 0x12, - 0x30, 0x0a, 0x21, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x5f, - 0x73, 0x70, 0x65, 0x63, 0x2e, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x62, 0x75, - 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, - 0x7d, 0x12, 0xae, 0x01, 0x0a, 0x10, 0x51, 0x75, 0x65, 0x72, 0x79, 0x57, 0x72, 0x69, 0x74, 0x65, - 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x12, 0x60, 0x0a, 0x0b, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, + 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, + 0x2e, 0x76, 0x32, 0x2e, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x57, 0x72, 0x69, 0x74, 0x65, + 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x00, + 0x28, 0x01, 0x12, 0x6e, 0x0a, 0x0f, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, + 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, + 0x1a, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x42, 0x69, 0x64, 0x69, 0x57, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x00, 0x28, 0x01, + 0x30, 0x01, 0x12, 0x84, 0x01, 0x0a, 0x0b, 0x4c, 0x69, 0x73, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x73, 0x12, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, + 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, + 0x74, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4c, 0x69, + 0x73, 0x74, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, + 0x65, 0x22, 0x26, 0xda, 0x41, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x8a, 0xd3, 0xe4, 0x93, + 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x12, 0x0b, 0x7b, 0x62, + 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x98, 0x01, 0x0a, 0x0d, 0x52, 0x65, + 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x27, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, + 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x1a, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, + 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x52, 0x65, 0x77, 0x72, 0x69, 0x74, 0x65, + 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x3a, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x34, + 0x12, 0x0f, 0x0a, 0x0d, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x62, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x12, 0x21, 0x0a, 0x12, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0xae, 0x01, 0x0a, 0x13, 0x53, 0x74, 0x61, 0x72, 0x74, 0x52, 0x65, + 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, 0x69, 0x74, 0x65, 0x12, 0x2d, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, + 0x2e, 0x53, 0x74, 0x61, 0x72, 0x74, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, + 0x72, 0x69, 0x74, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2e, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, + 0x53, 0x74, 0x61, 0x72, 0x74, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62, 0x6c, 0x65, 0x57, 0x72, + 0x69, 0x74, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x38, 0x8a, 0xd3, 0xe4, + 0x93, 0x02, 0x32, 0x12, 0x30, 0x0a, 0x21, 0x77, 0x72, 0x69, 0x74, 0x65, 0x5f, 0x6f, 0x62, 0x6a, + 0x65, 0x63, 0x74, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x2e, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x2e, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0xae, 0x01, 0x0a, 0x10, 0x51, 0x75, 0x65, 0x72, 0x79, 0x57, + 0x72, 0x69, 0x74, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x51, + 0x75, 0x65, 0x72, 0x79, 0x57, 0x72, 0x69, 0x74, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, - 0x57, 0x72, 0x69, 0x74, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x1a, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, - 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x57, 0x72, 0x69, 0x74, - 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, - 0x41, 0xda, 0x41, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, 0x8a, 0xd3, 0xe4, - 0x93, 0x02, 0x2f, 0x12, 0x2d, 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, 0x64, - 0x12, 0x20, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, - 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, - 0x2a, 0x2a, 0x12, 0x96, 0x01, 0x0a, 0x0a, 0x4d, 0x6f, 0x76, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, - 0x74, 0x12, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, - 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4d, 0x6f, 0x76, 0x65, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, - 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x22, 0x47, 0xda, 0x41, 0x27, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x2c, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2c, 0x64, 0x65, 0x73, 0x74, - 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x8a, 0xd3, - 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x0b, - 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x1a, 0xa7, 0x02, 0xca, 0x41, - 0x16, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, - 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x8a, 0x02, 0x68, 0x74, 0x74, 0x70, 0x73, - 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, - 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, - 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, - 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, - 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x2d, 0x6f, 0x6e, - 0x6c, 0x79, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, - 0x74, 0x68, 0x2f, 0x64, 0x65, 0x76, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x66, 0x75, - 0x6c, 0x6c, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, - 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, - 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x64, 0x65, 0x76, 0x73, 0x74, - 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6f, 0x6e, 0x6c, 0x79, 0x2c, - 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, - 0x64, 0x65, 0x76, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x5f, - 0x77, 0x72, 0x69, 0x74, 0x65, 0x42, 0xe2, 0x01, 0xea, 0x41, 0x78, 0x0a, 0x21, 0x63, 0x6c, 0x6f, - 0x75, 0x64, 0x6b, 0x6d, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x4b, 0x65, 0x79, 0x12, 0x53, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, - 0x74, 0x7d, 0x2f, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6c, 0x6f, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6b, 0x65, 0x79, 0x52, 0x69, 0x6e, 0x67, 0x73, - 0x2f, 0x7b, 0x6b, 0x65, 0x79, 0x5f, 0x72, 0x69, 0x6e, 0x67, 0x7d, 0x2f, 0x63, 0x72, 0x79, 0x70, - 0x74, 0x6f, 0x4b, 0x65, 0x79, 0x73, 0x2f, 0x7b, 0x63, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x5f, 0x6b, - 0x65, 0x79, 0x7d, 0x0a, 0x15, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x42, 0x0c, 0x53, 0x74, 0x6f, 0x72, - 0x61, 0x67, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3e, 0x63, 0x6c, 0x6f, 0x75, - 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, - 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, - 0x2f, 0x61, 0x70, 0x69, 0x76, 0x32, 0x2f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x70, 0x62, - 0x3b, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x70, 0x62, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, + 0x57, 0x72, 0x69, 0x74, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x22, 0x41, 0xda, 0x41, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x69, + 0x64, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x2f, 0x12, 0x2d, 0x0a, 0x09, 0x75, 0x70, 0x6c, 0x6f, 0x61, + 0x64, 0x5f, 0x69, 0x64, 0x12, 0x20, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x73, + 0x2f, 0x2a, 0x7d, 0x2f, 0x2a, 0x2a, 0x12, 0x96, 0x01, 0x0a, 0x0a, 0x4d, 0x6f, 0x76, 0x65, 0x4f, + 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, + 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4d, 0x6f, 0x76, 0x65, 0x4f, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x19, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x2e, + 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x22, 0x47, 0xda, 0x41, 0x27, 0x62, 0x75, 0x63, 0x6b, 0x65, + 0x74, 0x2c, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2c, + 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6f, 0x62, 0x6a, 0x65, + 0x63, 0x74, 0x8a, 0xd3, 0xe4, 0x93, 0x02, 0x17, 0x12, 0x15, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, + 0x65, 0x74, 0x12, 0x0b, 0x7b, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x3d, 0x2a, 0x2a, 0x7d, 0x1a, + 0xa7, 0x02, 0xca, 0x41, 0x16, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x8a, 0x02, 0x68, + 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, + 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, + 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, + 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2e, 0x72, 0x65, 0x61, + 0x64, 0x2d, 0x6f, 0x6e, 0x6c, 0x79, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, + 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x64, 0x65, 0x76, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, + 0x65, 0x2e, 0x66, 0x75, 0x6c, 0x6c, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2c, 0x68, + 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x64, + 0x65, 0x76, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x5f, 0x6f, + 0x6e, 0x6c, 0x79, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, + 0x75, 0x74, 0x68, 0x2f, 0x64, 0x65, 0x76, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x72, + 0x65, 0x61, 0x64, 0x5f, 0x77, 0x72, 0x69, 0x74, 0x65, 0x42, 0xe2, 0x01, 0xea, 0x41, 0x78, 0x0a, + 0x21, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x6b, 0x6d, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x43, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x4b, + 0x65, 0x79, 0x12, 0x53, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x2f, 0x7b, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6b, 0x65, 0x79, 0x52, + 0x69, 0x6e, 0x67, 0x73, 0x2f, 0x7b, 0x6b, 0x65, 0x79, 0x5f, 0x72, 0x69, 0x6e, 0x67, 0x7d, 0x2f, + 0x63, 0x72, 0x79, 0x70, 0x74, 0x6f, 0x4b, 0x65, 0x79, 0x73, 0x2f, 0x7b, 0x63, 0x72, 0x79, 0x70, + 0x74, 0x6f, 0x5f, 0x6b, 0x65, 0x79, 0x7d, 0x0a, 0x15, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x76, 0x32, 0x42, 0x0c, + 0x53, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3e, + 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, + 0x2f, 0x67, 0x6f, 0x2f, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2f, 0x69, 0x6e, 0x74, 0x65, + 0x72, 0x6e, 0x61, 0x6c, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x32, 0x2f, 0x73, 0x74, 0x6f, 0x72, 0x61, + 0x67, 0x65, 0x70, 0x62, 0x3b, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x70, 0x62, 0x62, 0x06, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -7812,7 +8929,7 @@ func file_google_storage_v2_storage_proto_rawDescGZIP() []byte { } var file_google_storage_v2_storage_proto_enumTypes = make([]protoimpl.EnumInfo, 1) -var file_google_storage_v2_storage_proto_msgTypes = make([]protoimpl.MessageInfo, 63) +var file_google_storage_v2_storage_proto_msgTypes = make([]protoimpl.MessageInfo, 75) var file_google_storage_v2_storage_proto_goTypes = []any{ (ServiceConstants_Values)(0), // 0: google.storage.v2.ServiceConstants.Values (*DeleteBucketRequest)(nil), // 1: google.storage.v2.DeleteBucketRequest @@ -7830,212 +8947,244 @@ var file_google_storage_v2_storage_proto_goTypes = []any{ (*ReadObjectRequest)(nil), // 13: google.storage.v2.ReadObjectRequest (*GetObjectRequest)(nil), // 14: google.storage.v2.GetObjectRequest (*ReadObjectResponse)(nil), // 15: google.storage.v2.ReadObjectResponse - (*WriteObjectSpec)(nil), // 16: google.storage.v2.WriteObjectSpec - (*WriteObjectRequest)(nil), // 17: google.storage.v2.WriteObjectRequest - (*WriteObjectResponse)(nil), // 18: google.storage.v2.WriteObjectResponse - (*BidiWriteObjectRequest)(nil), // 19: google.storage.v2.BidiWriteObjectRequest - (*BidiWriteObjectResponse)(nil), // 20: google.storage.v2.BidiWriteObjectResponse - (*ListObjectsRequest)(nil), // 21: google.storage.v2.ListObjectsRequest - (*QueryWriteStatusRequest)(nil), // 22: google.storage.v2.QueryWriteStatusRequest - (*QueryWriteStatusResponse)(nil), // 23: google.storage.v2.QueryWriteStatusResponse - (*RewriteObjectRequest)(nil), // 24: google.storage.v2.RewriteObjectRequest - (*RewriteResponse)(nil), // 25: google.storage.v2.RewriteResponse - (*MoveObjectRequest)(nil), // 26: google.storage.v2.MoveObjectRequest - (*StartResumableWriteRequest)(nil), // 27: google.storage.v2.StartResumableWriteRequest - (*StartResumableWriteResponse)(nil), // 28: google.storage.v2.StartResumableWriteResponse - (*UpdateObjectRequest)(nil), // 29: google.storage.v2.UpdateObjectRequest - (*CommonObjectRequestParams)(nil), // 30: google.storage.v2.CommonObjectRequestParams - (*ServiceConstants)(nil), // 31: google.storage.v2.ServiceConstants - (*Bucket)(nil), // 32: google.storage.v2.Bucket - (*BucketAccessControl)(nil), // 33: google.storage.v2.BucketAccessControl - (*ChecksummedData)(nil), // 34: google.storage.v2.ChecksummedData - (*ObjectChecksums)(nil), // 35: google.storage.v2.ObjectChecksums - (*CustomerEncryption)(nil), // 36: google.storage.v2.CustomerEncryption - (*Object)(nil), // 37: google.storage.v2.Object - (*ObjectAccessControl)(nil), // 38: google.storage.v2.ObjectAccessControl - (*ListObjectsResponse)(nil), // 39: google.storage.v2.ListObjectsResponse - (*ProjectTeam)(nil), // 40: google.storage.v2.ProjectTeam - (*Owner)(nil), // 41: google.storage.v2.Owner - (*ContentRange)(nil), // 42: google.storage.v2.ContentRange - (*ComposeObjectRequest_SourceObject)(nil), // 43: google.storage.v2.ComposeObjectRequest.SourceObject - (*ComposeObjectRequest_SourceObject_ObjectPreconditions)(nil), // 44: google.storage.v2.ComposeObjectRequest.SourceObject.ObjectPreconditions - (*Bucket_Billing)(nil), // 45: google.storage.v2.Bucket.Billing - (*Bucket_Cors)(nil), // 46: google.storage.v2.Bucket.Cors - (*Bucket_Encryption)(nil), // 47: google.storage.v2.Bucket.Encryption - (*Bucket_IamConfig)(nil), // 48: google.storage.v2.Bucket.IamConfig - (*Bucket_Lifecycle)(nil), // 49: google.storage.v2.Bucket.Lifecycle - (*Bucket_Logging)(nil), // 50: google.storage.v2.Bucket.Logging - (*Bucket_RetentionPolicy)(nil), // 51: google.storage.v2.Bucket.RetentionPolicy - (*Bucket_SoftDeletePolicy)(nil), // 52: google.storage.v2.Bucket.SoftDeletePolicy - (*Bucket_Versioning)(nil), // 53: google.storage.v2.Bucket.Versioning - (*Bucket_Website)(nil), // 54: google.storage.v2.Bucket.Website - (*Bucket_CustomPlacementConfig)(nil), // 55: google.storage.v2.Bucket.CustomPlacementConfig - (*Bucket_Autoclass)(nil), // 56: google.storage.v2.Bucket.Autoclass - (*Bucket_HierarchicalNamespace)(nil), // 57: google.storage.v2.Bucket.HierarchicalNamespace - nil, // 58: google.storage.v2.Bucket.LabelsEntry - (*Bucket_IamConfig_UniformBucketLevelAccess)(nil), // 59: google.storage.v2.Bucket.IamConfig.UniformBucketLevelAccess - (*Bucket_Lifecycle_Rule)(nil), // 60: google.storage.v2.Bucket.Lifecycle.Rule - (*Bucket_Lifecycle_Rule_Action)(nil), // 61: google.storage.v2.Bucket.Lifecycle.Rule.Action - (*Bucket_Lifecycle_Rule_Condition)(nil), // 62: google.storage.v2.Bucket.Lifecycle.Rule.Condition - nil, // 63: google.storage.v2.Object.MetadataEntry - (*fieldmaskpb.FieldMask)(nil), // 64: google.protobuf.FieldMask - (*timestamppb.Timestamp)(nil), // 65: google.protobuf.Timestamp - (*durationpb.Duration)(nil), // 66: google.protobuf.Duration - (*date.Date)(nil), // 67: google.type.Date - (*iampb.GetIamPolicyRequest)(nil), // 68: google.iam.v1.GetIamPolicyRequest - (*iampb.SetIamPolicyRequest)(nil), // 69: google.iam.v1.SetIamPolicyRequest - (*iampb.TestIamPermissionsRequest)(nil), // 70: google.iam.v1.TestIamPermissionsRequest - (*emptypb.Empty)(nil), // 71: google.protobuf.Empty - (*iampb.Policy)(nil), // 72: google.iam.v1.Policy - (*iampb.TestIamPermissionsResponse)(nil), // 73: google.iam.v1.TestIamPermissionsResponse + (*BidiReadObjectSpec)(nil), // 16: google.storage.v2.BidiReadObjectSpec + (*BidiReadObjectRequest)(nil), // 17: google.storage.v2.BidiReadObjectRequest + (*BidiReadObjectResponse)(nil), // 18: google.storage.v2.BidiReadObjectResponse + (*BidiReadObjectRedirectedError)(nil), // 19: google.storage.v2.BidiReadObjectRedirectedError + (*BidiWriteObjectRedirectedError)(nil), // 20: google.storage.v2.BidiWriteObjectRedirectedError + (*BidiReadObjectError)(nil), // 21: google.storage.v2.BidiReadObjectError + (*ReadRangeError)(nil), // 22: google.storage.v2.ReadRangeError + (*ReadRange)(nil), // 23: google.storage.v2.ReadRange + (*ObjectRangeData)(nil), // 24: google.storage.v2.ObjectRangeData + (*BidiReadHandle)(nil), // 25: google.storage.v2.BidiReadHandle + (*BidiWriteHandle)(nil), // 26: google.storage.v2.BidiWriteHandle + (*WriteObjectSpec)(nil), // 27: google.storage.v2.WriteObjectSpec + (*WriteObjectRequest)(nil), // 28: google.storage.v2.WriteObjectRequest + (*WriteObjectResponse)(nil), // 29: google.storage.v2.WriteObjectResponse + (*AppendObjectSpec)(nil), // 30: google.storage.v2.AppendObjectSpec + (*BidiWriteObjectRequest)(nil), // 31: google.storage.v2.BidiWriteObjectRequest + (*BidiWriteObjectResponse)(nil), // 32: google.storage.v2.BidiWriteObjectResponse + (*ListObjectsRequest)(nil), // 33: google.storage.v2.ListObjectsRequest + (*QueryWriteStatusRequest)(nil), // 34: google.storage.v2.QueryWriteStatusRequest + (*QueryWriteStatusResponse)(nil), // 35: google.storage.v2.QueryWriteStatusResponse + (*RewriteObjectRequest)(nil), // 36: google.storage.v2.RewriteObjectRequest + (*RewriteResponse)(nil), // 37: google.storage.v2.RewriteResponse + (*MoveObjectRequest)(nil), // 38: google.storage.v2.MoveObjectRequest + (*StartResumableWriteRequest)(nil), // 39: google.storage.v2.StartResumableWriteRequest + (*StartResumableWriteResponse)(nil), // 40: google.storage.v2.StartResumableWriteResponse + (*UpdateObjectRequest)(nil), // 41: google.storage.v2.UpdateObjectRequest + (*CommonObjectRequestParams)(nil), // 42: google.storage.v2.CommonObjectRequestParams + (*ServiceConstants)(nil), // 43: google.storage.v2.ServiceConstants + (*Bucket)(nil), // 44: google.storage.v2.Bucket + (*BucketAccessControl)(nil), // 45: google.storage.v2.BucketAccessControl + (*ChecksummedData)(nil), // 46: google.storage.v2.ChecksummedData + (*ObjectChecksums)(nil), // 47: google.storage.v2.ObjectChecksums + (*CustomerEncryption)(nil), // 48: google.storage.v2.CustomerEncryption + (*Object)(nil), // 49: google.storage.v2.Object + (*ObjectAccessControl)(nil), // 50: google.storage.v2.ObjectAccessControl + (*ListObjectsResponse)(nil), // 51: google.storage.v2.ListObjectsResponse + (*ProjectTeam)(nil), // 52: google.storage.v2.ProjectTeam + (*Owner)(nil), // 53: google.storage.v2.Owner + (*ContentRange)(nil), // 54: google.storage.v2.ContentRange + (*ComposeObjectRequest_SourceObject)(nil), // 55: google.storage.v2.ComposeObjectRequest.SourceObject + (*ComposeObjectRequest_SourceObject_ObjectPreconditions)(nil), // 56: google.storage.v2.ComposeObjectRequest.SourceObject.ObjectPreconditions + (*Bucket_Billing)(nil), // 57: google.storage.v2.Bucket.Billing + (*Bucket_Cors)(nil), // 58: google.storage.v2.Bucket.Cors + (*Bucket_Encryption)(nil), // 59: google.storage.v2.Bucket.Encryption + (*Bucket_IamConfig)(nil), // 60: google.storage.v2.Bucket.IamConfig + (*Bucket_Lifecycle)(nil), // 61: google.storage.v2.Bucket.Lifecycle + (*Bucket_Logging)(nil), // 62: google.storage.v2.Bucket.Logging + (*Bucket_RetentionPolicy)(nil), // 63: google.storage.v2.Bucket.RetentionPolicy + (*Bucket_SoftDeletePolicy)(nil), // 64: google.storage.v2.Bucket.SoftDeletePolicy + (*Bucket_Versioning)(nil), // 65: google.storage.v2.Bucket.Versioning + (*Bucket_Website)(nil), // 66: google.storage.v2.Bucket.Website + (*Bucket_CustomPlacementConfig)(nil), // 67: google.storage.v2.Bucket.CustomPlacementConfig + (*Bucket_Autoclass)(nil), // 68: google.storage.v2.Bucket.Autoclass + (*Bucket_HierarchicalNamespace)(nil), // 69: google.storage.v2.Bucket.HierarchicalNamespace + nil, // 70: google.storage.v2.Bucket.LabelsEntry + (*Bucket_IamConfig_UniformBucketLevelAccess)(nil), // 71: google.storage.v2.Bucket.IamConfig.UniformBucketLevelAccess + (*Bucket_Lifecycle_Rule)(nil), // 72: google.storage.v2.Bucket.Lifecycle.Rule + (*Bucket_Lifecycle_Rule_Action)(nil), // 73: google.storage.v2.Bucket.Lifecycle.Rule.Action + (*Bucket_Lifecycle_Rule_Condition)(nil), // 74: google.storage.v2.Bucket.Lifecycle.Rule.Condition + nil, // 75: google.storage.v2.Object.MetadataEntry + (*fieldmaskpb.FieldMask)(nil), // 76: google.protobuf.FieldMask + (*status.Status)(nil), // 77: google.rpc.Status + (*timestamppb.Timestamp)(nil), // 78: google.protobuf.Timestamp + (*durationpb.Duration)(nil), // 79: google.protobuf.Duration + (*date.Date)(nil), // 80: google.type.Date + (*iampb.GetIamPolicyRequest)(nil), // 81: google.iam.v1.GetIamPolicyRequest + (*iampb.SetIamPolicyRequest)(nil), // 82: google.iam.v1.SetIamPolicyRequest + (*iampb.TestIamPermissionsRequest)(nil), // 83: google.iam.v1.TestIamPermissionsRequest + (*emptypb.Empty)(nil), // 84: google.protobuf.Empty + (*iampb.Policy)(nil), // 85: google.iam.v1.Policy + (*iampb.TestIamPermissionsResponse)(nil), // 86: google.iam.v1.TestIamPermissionsResponse } var file_google_storage_v2_storage_proto_depIdxs = []int32{ - 64, // 0: google.storage.v2.GetBucketRequest.read_mask:type_name -> google.protobuf.FieldMask - 32, // 1: google.storage.v2.CreateBucketRequest.bucket:type_name -> google.storage.v2.Bucket - 64, // 2: google.storage.v2.ListBucketsRequest.read_mask:type_name -> google.protobuf.FieldMask - 32, // 3: google.storage.v2.ListBucketsResponse.buckets:type_name -> google.storage.v2.Bucket - 32, // 4: google.storage.v2.UpdateBucketRequest.bucket:type_name -> google.storage.v2.Bucket - 64, // 5: google.storage.v2.UpdateBucketRequest.update_mask:type_name -> google.protobuf.FieldMask - 37, // 6: google.storage.v2.ComposeObjectRequest.destination:type_name -> google.storage.v2.Object - 43, // 7: google.storage.v2.ComposeObjectRequest.source_objects:type_name -> google.storage.v2.ComposeObjectRequest.SourceObject - 30, // 8: google.storage.v2.ComposeObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 35, // 9: google.storage.v2.ComposeObjectRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums - 30, // 10: google.storage.v2.DeleteObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 30, // 11: google.storage.v2.RestoreObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 30, // 12: google.storage.v2.ReadObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 64, // 13: google.storage.v2.ReadObjectRequest.read_mask:type_name -> google.protobuf.FieldMask - 30, // 14: google.storage.v2.GetObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 64, // 15: google.storage.v2.GetObjectRequest.read_mask:type_name -> google.protobuf.FieldMask - 34, // 16: google.storage.v2.ReadObjectResponse.checksummed_data:type_name -> google.storage.v2.ChecksummedData - 35, // 17: google.storage.v2.ReadObjectResponse.object_checksums:type_name -> google.storage.v2.ObjectChecksums - 42, // 18: google.storage.v2.ReadObjectResponse.content_range:type_name -> google.storage.v2.ContentRange - 37, // 19: google.storage.v2.ReadObjectResponse.metadata:type_name -> google.storage.v2.Object - 37, // 20: google.storage.v2.WriteObjectSpec.resource:type_name -> google.storage.v2.Object - 16, // 21: google.storage.v2.WriteObjectRequest.write_object_spec:type_name -> google.storage.v2.WriteObjectSpec - 34, // 22: google.storage.v2.WriteObjectRequest.checksummed_data:type_name -> google.storage.v2.ChecksummedData - 35, // 23: google.storage.v2.WriteObjectRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums - 30, // 24: google.storage.v2.WriteObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 37, // 25: google.storage.v2.WriteObjectResponse.resource:type_name -> google.storage.v2.Object - 16, // 26: google.storage.v2.BidiWriteObjectRequest.write_object_spec:type_name -> google.storage.v2.WriteObjectSpec - 34, // 27: google.storage.v2.BidiWriteObjectRequest.checksummed_data:type_name -> google.storage.v2.ChecksummedData - 35, // 28: google.storage.v2.BidiWriteObjectRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums - 30, // 29: google.storage.v2.BidiWriteObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 37, // 30: google.storage.v2.BidiWriteObjectResponse.resource:type_name -> google.storage.v2.Object - 64, // 31: google.storage.v2.ListObjectsRequest.read_mask:type_name -> google.protobuf.FieldMask - 30, // 32: google.storage.v2.QueryWriteStatusRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 37, // 33: google.storage.v2.QueryWriteStatusResponse.resource:type_name -> google.storage.v2.Object - 37, // 34: google.storage.v2.RewriteObjectRequest.destination:type_name -> google.storage.v2.Object - 30, // 35: google.storage.v2.RewriteObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 35, // 36: google.storage.v2.RewriteObjectRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums - 37, // 37: google.storage.v2.RewriteResponse.resource:type_name -> google.storage.v2.Object - 16, // 38: google.storage.v2.StartResumableWriteRequest.write_object_spec:type_name -> google.storage.v2.WriteObjectSpec - 30, // 39: google.storage.v2.StartResumableWriteRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 35, // 40: google.storage.v2.StartResumableWriteRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums - 37, // 41: google.storage.v2.UpdateObjectRequest.object:type_name -> google.storage.v2.Object - 64, // 42: google.storage.v2.UpdateObjectRequest.update_mask:type_name -> google.protobuf.FieldMask - 30, // 43: google.storage.v2.UpdateObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams - 33, // 44: google.storage.v2.Bucket.acl:type_name -> google.storage.v2.BucketAccessControl - 38, // 45: google.storage.v2.Bucket.default_object_acl:type_name -> google.storage.v2.ObjectAccessControl - 49, // 46: google.storage.v2.Bucket.lifecycle:type_name -> google.storage.v2.Bucket.Lifecycle - 65, // 47: google.storage.v2.Bucket.create_time:type_name -> google.protobuf.Timestamp - 46, // 48: google.storage.v2.Bucket.cors:type_name -> google.storage.v2.Bucket.Cors - 65, // 49: google.storage.v2.Bucket.update_time:type_name -> google.protobuf.Timestamp - 58, // 50: google.storage.v2.Bucket.labels:type_name -> google.storage.v2.Bucket.LabelsEntry - 54, // 51: google.storage.v2.Bucket.website:type_name -> google.storage.v2.Bucket.Website - 53, // 52: google.storage.v2.Bucket.versioning:type_name -> google.storage.v2.Bucket.Versioning - 50, // 53: google.storage.v2.Bucket.logging:type_name -> google.storage.v2.Bucket.Logging - 41, // 54: google.storage.v2.Bucket.owner:type_name -> google.storage.v2.Owner - 47, // 55: google.storage.v2.Bucket.encryption:type_name -> google.storage.v2.Bucket.Encryption - 45, // 56: google.storage.v2.Bucket.billing:type_name -> google.storage.v2.Bucket.Billing - 51, // 57: google.storage.v2.Bucket.retention_policy:type_name -> google.storage.v2.Bucket.RetentionPolicy - 48, // 58: google.storage.v2.Bucket.iam_config:type_name -> google.storage.v2.Bucket.IamConfig - 55, // 59: google.storage.v2.Bucket.custom_placement_config:type_name -> google.storage.v2.Bucket.CustomPlacementConfig - 56, // 60: google.storage.v2.Bucket.autoclass:type_name -> google.storage.v2.Bucket.Autoclass - 57, // 61: google.storage.v2.Bucket.hierarchical_namespace:type_name -> google.storage.v2.Bucket.HierarchicalNamespace - 52, // 62: google.storage.v2.Bucket.soft_delete_policy:type_name -> google.storage.v2.Bucket.SoftDeletePolicy - 40, // 63: google.storage.v2.BucketAccessControl.project_team:type_name -> google.storage.v2.ProjectTeam - 38, // 64: google.storage.v2.Object.acl:type_name -> google.storage.v2.ObjectAccessControl - 65, // 65: google.storage.v2.Object.delete_time:type_name -> google.protobuf.Timestamp - 65, // 66: google.storage.v2.Object.finalize_time:type_name -> google.protobuf.Timestamp - 65, // 67: google.storage.v2.Object.create_time:type_name -> google.protobuf.Timestamp - 35, // 68: google.storage.v2.Object.checksums:type_name -> google.storage.v2.ObjectChecksums - 65, // 69: google.storage.v2.Object.update_time:type_name -> google.protobuf.Timestamp - 65, // 70: google.storage.v2.Object.update_storage_class_time:type_name -> google.protobuf.Timestamp - 65, // 71: google.storage.v2.Object.retention_expire_time:type_name -> google.protobuf.Timestamp - 63, // 72: google.storage.v2.Object.metadata:type_name -> google.storage.v2.Object.MetadataEntry - 41, // 73: google.storage.v2.Object.owner:type_name -> google.storage.v2.Owner - 36, // 74: google.storage.v2.Object.customer_encryption:type_name -> google.storage.v2.CustomerEncryption - 65, // 75: google.storage.v2.Object.custom_time:type_name -> google.protobuf.Timestamp - 65, // 76: google.storage.v2.Object.soft_delete_time:type_name -> google.protobuf.Timestamp - 65, // 77: google.storage.v2.Object.hard_delete_time:type_name -> google.protobuf.Timestamp - 40, // 78: google.storage.v2.ObjectAccessControl.project_team:type_name -> google.storage.v2.ProjectTeam - 37, // 79: google.storage.v2.ListObjectsResponse.objects:type_name -> google.storage.v2.Object - 44, // 80: google.storage.v2.ComposeObjectRequest.SourceObject.object_preconditions:type_name -> google.storage.v2.ComposeObjectRequest.SourceObject.ObjectPreconditions - 59, // 81: google.storage.v2.Bucket.IamConfig.uniform_bucket_level_access:type_name -> google.storage.v2.Bucket.IamConfig.UniformBucketLevelAccess - 60, // 82: google.storage.v2.Bucket.Lifecycle.rule:type_name -> google.storage.v2.Bucket.Lifecycle.Rule - 65, // 83: google.storage.v2.Bucket.RetentionPolicy.effective_time:type_name -> google.protobuf.Timestamp - 66, // 84: google.storage.v2.Bucket.RetentionPolicy.retention_duration:type_name -> google.protobuf.Duration - 66, // 85: google.storage.v2.Bucket.SoftDeletePolicy.retention_duration:type_name -> google.protobuf.Duration - 65, // 86: google.storage.v2.Bucket.SoftDeletePolicy.effective_time:type_name -> google.protobuf.Timestamp - 65, // 87: google.storage.v2.Bucket.Autoclass.toggle_time:type_name -> google.protobuf.Timestamp - 65, // 88: google.storage.v2.Bucket.Autoclass.terminal_storage_class_update_time:type_name -> google.protobuf.Timestamp - 65, // 89: google.storage.v2.Bucket.IamConfig.UniformBucketLevelAccess.lock_time:type_name -> google.protobuf.Timestamp - 61, // 90: google.storage.v2.Bucket.Lifecycle.Rule.action:type_name -> google.storage.v2.Bucket.Lifecycle.Rule.Action - 62, // 91: google.storage.v2.Bucket.Lifecycle.Rule.condition:type_name -> google.storage.v2.Bucket.Lifecycle.Rule.Condition - 67, // 92: google.storage.v2.Bucket.Lifecycle.Rule.Condition.created_before:type_name -> google.type.Date - 67, // 93: google.storage.v2.Bucket.Lifecycle.Rule.Condition.custom_time_before:type_name -> google.type.Date - 67, // 94: google.storage.v2.Bucket.Lifecycle.Rule.Condition.noncurrent_time_before:type_name -> google.type.Date - 1, // 95: google.storage.v2.Storage.DeleteBucket:input_type -> google.storage.v2.DeleteBucketRequest - 2, // 96: google.storage.v2.Storage.GetBucket:input_type -> google.storage.v2.GetBucketRequest - 3, // 97: google.storage.v2.Storage.CreateBucket:input_type -> google.storage.v2.CreateBucketRequest - 4, // 98: google.storage.v2.Storage.ListBuckets:input_type -> google.storage.v2.ListBucketsRequest - 6, // 99: google.storage.v2.Storage.LockBucketRetentionPolicy:input_type -> google.storage.v2.LockBucketRetentionPolicyRequest - 68, // 100: google.storage.v2.Storage.GetIamPolicy:input_type -> google.iam.v1.GetIamPolicyRequest - 69, // 101: google.storage.v2.Storage.SetIamPolicy:input_type -> google.iam.v1.SetIamPolicyRequest - 70, // 102: google.storage.v2.Storage.TestIamPermissions:input_type -> google.iam.v1.TestIamPermissionsRequest - 7, // 103: google.storage.v2.Storage.UpdateBucket:input_type -> google.storage.v2.UpdateBucketRequest - 8, // 104: google.storage.v2.Storage.ComposeObject:input_type -> google.storage.v2.ComposeObjectRequest - 9, // 105: google.storage.v2.Storage.DeleteObject:input_type -> google.storage.v2.DeleteObjectRequest - 10, // 106: google.storage.v2.Storage.RestoreObject:input_type -> google.storage.v2.RestoreObjectRequest - 11, // 107: google.storage.v2.Storage.CancelResumableWrite:input_type -> google.storage.v2.CancelResumableWriteRequest - 14, // 108: google.storage.v2.Storage.GetObject:input_type -> google.storage.v2.GetObjectRequest - 13, // 109: google.storage.v2.Storage.ReadObject:input_type -> google.storage.v2.ReadObjectRequest - 29, // 110: google.storage.v2.Storage.UpdateObject:input_type -> google.storage.v2.UpdateObjectRequest - 17, // 111: google.storage.v2.Storage.WriteObject:input_type -> google.storage.v2.WriteObjectRequest - 19, // 112: google.storage.v2.Storage.BidiWriteObject:input_type -> google.storage.v2.BidiWriteObjectRequest - 21, // 113: google.storage.v2.Storage.ListObjects:input_type -> google.storage.v2.ListObjectsRequest - 24, // 114: google.storage.v2.Storage.RewriteObject:input_type -> google.storage.v2.RewriteObjectRequest - 27, // 115: google.storage.v2.Storage.StartResumableWrite:input_type -> google.storage.v2.StartResumableWriteRequest - 22, // 116: google.storage.v2.Storage.QueryWriteStatus:input_type -> google.storage.v2.QueryWriteStatusRequest - 26, // 117: google.storage.v2.Storage.MoveObject:input_type -> google.storage.v2.MoveObjectRequest - 71, // 118: google.storage.v2.Storage.DeleteBucket:output_type -> google.protobuf.Empty - 32, // 119: google.storage.v2.Storage.GetBucket:output_type -> google.storage.v2.Bucket - 32, // 120: google.storage.v2.Storage.CreateBucket:output_type -> google.storage.v2.Bucket - 5, // 121: google.storage.v2.Storage.ListBuckets:output_type -> google.storage.v2.ListBucketsResponse - 32, // 122: google.storage.v2.Storage.LockBucketRetentionPolicy:output_type -> google.storage.v2.Bucket - 72, // 123: google.storage.v2.Storage.GetIamPolicy:output_type -> google.iam.v1.Policy - 72, // 124: google.storage.v2.Storage.SetIamPolicy:output_type -> google.iam.v1.Policy - 73, // 125: google.storage.v2.Storage.TestIamPermissions:output_type -> google.iam.v1.TestIamPermissionsResponse - 32, // 126: google.storage.v2.Storage.UpdateBucket:output_type -> google.storage.v2.Bucket - 37, // 127: google.storage.v2.Storage.ComposeObject:output_type -> google.storage.v2.Object - 71, // 128: google.storage.v2.Storage.DeleteObject:output_type -> google.protobuf.Empty - 37, // 129: google.storage.v2.Storage.RestoreObject:output_type -> google.storage.v2.Object - 12, // 130: google.storage.v2.Storage.CancelResumableWrite:output_type -> google.storage.v2.CancelResumableWriteResponse - 37, // 131: google.storage.v2.Storage.GetObject:output_type -> google.storage.v2.Object - 15, // 132: google.storage.v2.Storage.ReadObject:output_type -> google.storage.v2.ReadObjectResponse - 37, // 133: google.storage.v2.Storage.UpdateObject:output_type -> google.storage.v2.Object - 18, // 134: google.storage.v2.Storage.WriteObject:output_type -> google.storage.v2.WriteObjectResponse - 20, // 135: google.storage.v2.Storage.BidiWriteObject:output_type -> google.storage.v2.BidiWriteObjectResponse - 39, // 136: google.storage.v2.Storage.ListObjects:output_type -> google.storage.v2.ListObjectsResponse - 25, // 137: google.storage.v2.Storage.RewriteObject:output_type -> google.storage.v2.RewriteResponse - 28, // 138: google.storage.v2.Storage.StartResumableWrite:output_type -> google.storage.v2.StartResumableWriteResponse - 23, // 139: google.storage.v2.Storage.QueryWriteStatus:output_type -> google.storage.v2.QueryWriteStatusResponse - 37, // 140: google.storage.v2.Storage.MoveObject:output_type -> google.storage.v2.Object - 118, // [118:141] is the sub-list for method output_type - 95, // [95:118] is the sub-list for method input_type - 95, // [95:95] is the sub-list for extension type_name - 95, // [95:95] is the sub-list for extension extendee - 0, // [0:95] is the sub-list for field type_name + 76, // 0: google.storage.v2.GetBucketRequest.read_mask:type_name -> google.protobuf.FieldMask + 44, // 1: google.storage.v2.CreateBucketRequest.bucket:type_name -> google.storage.v2.Bucket + 76, // 2: google.storage.v2.ListBucketsRequest.read_mask:type_name -> google.protobuf.FieldMask + 44, // 3: google.storage.v2.ListBucketsResponse.buckets:type_name -> google.storage.v2.Bucket + 44, // 4: google.storage.v2.UpdateBucketRequest.bucket:type_name -> google.storage.v2.Bucket + 76, // 5: google.storage.v2.UpdateBucketRequest.update_mask:type_name -> google.protobuf.FieldMask + 49, // 6: google.storage.v2.ComposeObjectRequest.destination:type_name -> google.storage.v2.Object + 55, // 7: google.storage.v2.ComposeObjectRequest.source_objects:type_name -> google.storage.v2.ComposeObjectRequest.SourceObject + 42, // 8: google.storage.v2.ComposeObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 47, // 9: google.storage.v2.ComposeObjectRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums + 42, // 10: google.storage.v2.DeleteObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 42, // 11: google.storage.v2.RestoreObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 42, // 12: google.storage.v2.ReadObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 76, // 13: google.storage.v2.ReadObjectRequest.read_mask:type_name -> google.protobuf.FieldMask + 42, // 14: google.storage.v2.GetObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 76, // 15: google.storage.v2.GetObjectRequest.read_mask:type_name -> google.protobuf.FieldMask + 46, // 16: google.storage.v2.ReadObjectResponse.checksummed_data:type_name -> google.storage.v2.ChecksummedData + 47, // 17: google.storage.v2.ReadObjectResponse.object_checksums:type_name -> google.storage.v2.ObjectChecksums + 54, // 18: google.storage.v2.ReadObjectResponse.content_range:type_name -> google.storage.v2.ContentRange + 49, // 19: google.storage.v2.ReadObjectResponse.metadata:type_name -> google.storage.v2.Object + 42, // 20: google.storage.v2.BidiReadObjectSpec.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 76, // 21: google.storage.v2.BidiReadObjectSpec.read_mask:type_name -> google.protobuf.FieldMask + 25, // 22: google.storage.v2.BidiReadObjectSpec.read_handle:type_name -> google.storage.v2.BidiReadHandle + 16, // 23: google.storage.v2.BidiReadObjectRequest.read_object_spec:type_name -> google.storage.v2.BidiReadObjectSpec + 23, // 24: google.storage.v2.BidiReadObjectRequest.read_ranges:type_name -> google.storage.v2.ReadRange + 24, // 25: google.storage.v2.BidiReadObjectResponse.object_data_ranges:type_name -> google.storage.v2.ObjectRangeData + 49, // 26: google.storage.v2.BidiReadObjectResponse.metadata:type_name -> google.storage.v2.Object + 25, // 27: google.storage.v2.BidiReadObjectResponse.read_handle:type_name -> google.storage.v2.BidiReadHandle + 25, // 28: google.storage.v2.BidiReadObjectRedirectedError.read_handle:type_name -> google.storage.v2.BidiReadHandle + 26, // 29: google.storage.v2.BidiWriteObjectRedirectedError.write_handle:type_name -> google.storage.v2.BidiWriteHandle + 22, // 30: google.storage.v2.BidiReadObjectError.read_range_errors:type_name -> google.storage.v2.ReadRangeError + 77, // 31: google.storage.v2.ReadRangeError.status:type_name -> google.rpc.Status + 46, // 32: google.storage.v2.ObjectRangeData.checksummed_data:type_name -> google.storage.v2.ChecksummedData + 23, // 33: google.storage.v2.ObjectRangeData.read_range:type_name -> google.storage.v2.ReadRange + 49, // 34: google.storage.v2.WriteObjectSpec.resource:type_name -> google.storage.v2.Object + 27, // 35: google.storage.v2.WriteObjectRequest.write_object_spec:type_name -> google.storage.v2.WriteObjectSpec + 46, // 36: google.storage.v2.WriteObjectRequest.checksummed_data:type_name -> google.storage.v2.ChecksummedData + 47, // 37: google.storage.v2.WriteObjectRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums + 42, // 38: google.storage.v2.WriteObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 49, // 39: google.storage.v2.WriteObjectResponse.resource:type_name -> google.storage.v2.Object + 26, // 40: google.storage.v2.AppendObjectSpec.write_handle:type_name -> google.storage.v2.BidiWriteHandle + 27, // 41: google.storage.v2.BidiWriteObjectRequest.write_object_spec:type_name -> google.storage.v2.WriteObjectSpec + 30, // 42: google.storage.v2.BidiWriteObjectRequest.append_object_spec:type_name -> google.storage.v2.AppendObjectSpec + 46, // 43: google.storage.v2.BidiWriteObjectRequest.checksummed_data:type_name -> google.storage.v2.ChecksummedData + 47, // 44: google.storage.v2.BidiWriteObjectRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums + 42, // 45: google.storage.v2.BidiWriteObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 49, // 46: google.storage.v2.BidiWriteObjectResponse.resource:type_name -> google.storage.v2.Object + 26, // 47: google.storage.v2.BidiWriteObjectResponse.write_handle:type_name -> google.storage.v2.BidiWriteHandle + 76, // 48: google.storage.v2.ListObjectsRequest.read_mask:type_name -> google.protobuf.FieldMask + 42, // 49: google.storage.v2.QueryWriteStatusRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 49, // 50: google.storage.v2.QueryWriteStatusResponse.resource:type_name -> google.storage.v2.Object + 49, // 51: google.storage.v2.RewriteObjectRequest.destination:type_name -> google.storage.v2.Object + 42, // 52: google.storage.v2.RewriteObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 47, // 53: google.storage.v2.RewriteObjectRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums + 49, // 54: google.storage.v2.RewriteResponse.resource:type_name -> google.storage.v2.Object + 27, // 55: google.storage.v2.StartResumableWriteRequest.write_object_spec:type_name -> google.storage.v2.WriteObjectSpec + 42, // 56: google.storage.v2.StartResumableWriteRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 47, // 57: google.storage.v2.StartResumableWriteRequest.object_checksums:type_name -> google.storage.v2.ObjectChecksums + 49, // 58: google.storage.v2.UpdateObjectRequest.object:type_name -> google.storage.v2.Object + 76, // 59: google.storage.v2.UpdateObjectRequest.update_mask:type_name -> google.protobuf.FieldMask + 42, // 60: google.storage.v2.UpdateObjectRequest.common_object_request_params:type_name -> google.storage.v2.CommonObjectRequestParams + 45, // 61: google.storage.v2.Bucket.acl:type_name -> google.storage.v2.BucketAccessControl + 50, // 62: google.storage.v2.Bucket.default_object_acl:type_name -> google.storage.v2.ObjectAccessControl + 61, // 63: google.storage.v2.Bucket.lifecycle:type_name -> google.storage.v2.Bucket.Lifecycle + 78, // 64: google.storage.v2.Bucket.create_time:type_name -> google.protobuf.Timestamp + 58, // 65: google.storage.v2.Bucket.cors:type_name -> google.storage.v2.Bucket.Cors + 78, // 66: google.storage.v2.Bucket.update_time:type_name -> google.protobuf.Timestamp + 70, // 67: google.storage.v2.Bucket.labels:type_name -> google.storage.v2.Bucket.LabelsEntry + 66, // 68: google.storage.v2.Bucket.website:type_name -> google.storage.v2.Bucket.Website + 65, // 69: google.storage.v2.Bucket.versioning:type_name -> google.storage.v2.Bucket.Versioning + 62, // 70: google.storage.v2.Bucket.logging:type_name -> google.storage.v2.Bucket.Logging + 53, // 71: google.storage.v2.Bucket.owner:type_name -> google.storage.v2.Owner + 59, // 72: google.storage.v2.Bucket.encryption:type_name -> google.storage.v2.Bucket.Encryption + 57, // 73: google.storage.v2.Bucket.billing:type_name -> google.storage.v2.Bucket.Billing + 63, // 74: google.storage.v2.Bucket.retention_policy:type_name -> google.storage.v2.Bucket.RetentionPolicy + 60, // 75: google.storage.v2.Bucket.iam_config:type_name -> google.storage.v2.Bucket.IamConfig + 67, // 76: google.storage.v2.Bucket.custom_placement_config:type_name -> google.storage.v2.Bucket.CustomPlacementConfig + 68, // 77: google.storage.v2.Bucket.autoclass:type_name -> google.storage.v2.Bucket.Autoclass + 69, // 78: google.storage.v2.Bucket.hierarchical_namespace:type_name -> google.storage.v2.Bucket.HierarchicalNamespace + 64, // 79: google.storage.v2.Bucket.soft_delete_policy:type_name -> google.storage.v2.Bucket.SoftDeletePolicy + 52, // 80: google.storage.v2.BucketAccessControl.project_team:type_name -> google.storage.v2.ProjectTeam + 50, // 81: google.storage.v2.Object.acl:type_name -> google.storage.v2.ObjectAccessControl + 78, // 82: google.storage.v2.Object.delete_time:type_name -> google.protobuf.Timestamp + 78, // 83: google.storage.v2.Object.finalize_time:type_name -> google.protobuf.Timestamp + 78, // 84: google.storage.v2.Object.create_time:type_name -> google.protobuf.Timestamp + 47, // 85: google.storage.v2.Object.checksums:type_name -> google.storage.v2.ObjectChecksums + 78, // 86: google.storage.v2.Object.update_time:type_name -> google.protobuf.Timestamp + 78, // 87: google.storage.v2.Object.update_storage_class_time:type_name -> google.protobuf.Timestamp + 78, // 88: google.storage.v2.Object.retention_expire_time:type_name -> google.protobuf.Timestamp + 75, // 89: google.storage.v2.Object.metadata:type_name -> google.storage.v2.Object.MetadataEntry + 53, // 90: google.storage.v2.Object.owner:type_name -> google.storage.v2.Owner + 48, // 91: google.storage.v2.Object.customer_encryption:type_name -> google.storage.v2.CustomerEncryption + 78, // 92: google.storage.v2.Object.custom_time:type_name -> google.protobuf.Timestamp + 78, // 93: google.storage.v2.Object.soft_delete_time:type_name -> google.protobuf.Timestamp + 78, // 94: google.storage.v2.Object.hard_delete_time:type_name -> google.protobuf.Timestamp + 52, // 95: google.storage.v2.ObjectAccessControl.project_team:type_name -> google.storage.v2.ProjectTeam + 49, // 96: google.storage.v2.ListObjectsResponse.objects:type_name -> google.storage.v2.Object + 56, // 97: google.storage.v2.ComposeObjectRequest.SourceObject.object_preconditions:type_name -> google.storage.v2.ComposeObjectRequest.SourceObject.ObjectPreconditions + 71, // 98: google.storage.v2.Bucket.IamConfig.uniform_bucket_level_access:type_name -> google.storage.v2.Bucket.IamConfig.UniformBucketLevelAccess + 72, // 99: google.storage.v2.Bucket.Lifecycle.rule:type_name -> google.storage.v2.Bucket.Lifecycle.Rule + 78, // 100: google.storage.v2.Bucket.RetentionPolicy.effective_time:type_name -> google.protobuf.Timestamp + 79, // 101: google.storage.v2.Bucket.RetentionPolicy.retention_duration:type_name -> google.protobuf.Duration + 79, // 102: google.storage.v2.Bucket.SoftDeletePolicy.retention_duration:type_name -> google.protobuf.Duration + 78, // 103: google.storage.v2.Bucket.SoftDeletePolicy.effective_time:type_name -> google.protobuf.Timestamp + 78, // 104: google.storage.v2.Bucket.Autoclass.toggle_time:type_name -> google.protobuf.Timestamp + 78, // 105: google.storage.v2.Bucket.Autoclass.terminal_storage_class_update_time:type_name -> google.protobuf.Timestamp + 78, // 106: google.storage.v2.Bucket.IamConfig.UniformBucketLevelAccess.lock_time:type_name -> google.protobuf.Timestamp + 73, // 107: google.storage.v2.Bucket.Lifecycle.Rule.action:type_name -> google.storage.v2.Bucket.Lifecycle.Rule.Action + 74, // 108: google.storage.v2.Bucket.Lifecycle.Rule.condition:type_name -> google.storage.v2.Bucket.Lifecycle.Rule.Condition + 80, // 109: google.storage.v2.Bucket.Lifecycle.Rule.Condition.created_before:type_name -> google.type.Date + 80, // 110: google.storage.v2.Bucket.Lifecycle.Rule.Condition.custom_time_before:type_name -> google.type.Date + 80, // 111: google.storage.v2.Bucket.Lifecycle.Rule.Condition.noncurrent_time_before:type_name -> google.type.Date + 1, // 112: google.storage.v2.Storage.DeleteBucket:input_type -> google.storage.v2.DeleteBucketRequest + 2, // 113: google.storage.v2.Storage.GetBucket:input_type -> google.storage.v2.GetBucketRequest + 3, // 114: google.storage.v2.Storage.CreateBucket:input_type -> google.storage.v2.CreateBucketRequest + 4, // 115: google.storage.v2.Storage.ListBuckets:input_type -> google.storage.v2.ListBucketsRequest + 6, // 116: google.storage.v2.Storage.LockBucketRetentionPolicy:input_type -> google.storage.v2.LockBucketRetentionPolicyRequest + 81, // 117: google.storage.v2.Storage.GetIamPolicy:input_type -> google.iam.v1.GetIamPolicyRequest + 82, // 118: google.storage.v2.Storage.SetIamPolicy:input_type -> google.iam.v1.SetIamPolicyRequest + 83, // 119: google.storage.v2.Storage.TestIamPermissions:input_type -> google.iam.v1.TestIamPermissionsRequest + 7, // 120: google.storage.v2.Storage.UpdateBucket:input_type -> google.storage.v2.UpdateBucketRequest + 8, // 121: google.storage.v2.Storage.ComposeObject:input_type -> google.storage.v2.ComposeObjectRequest + 9, // 122: google.storage.v2.Storage.DeleteObject:input_type -> google.storage.v2.DeleteObjectRequest + 10, // 123: google.storage.v2.Storage.RestoreObject:input_type -> google.storage.v2.RestoreObjectRequest + 11, // 124: google.storage.v2.Storage.CancelResumableWrite:input_type -> google.storage.v2.CancelResumableWriteRequest + 14, // 125: google.storage.v2.Storage.GetObject:input_type -> google.storage.v2.GetObjectRequest + 13, // 126: google.storage.v2.Storage.ReadObject:input_type -> google.storage.v2.ReadObjectRequest + 17, // 127: google.storage.v2.Storage.BidiReadObject:input_type -> google.storage.v2.BidiReadObjectRequest + 41, // 128: google.storage.v2.Storage.UpdateObject:input_type -> google.storage.v2.UpdateObjectRequest + 28, // 129: google.storage.v2.Storage.WriteObject:input_type -> google.storage.v2.WriteObjectRequest + 31, // 130: google.storage.v2.Storage.BidiWriteObject:input_type -> google.storage.v2.BidiWriteObjectRequest + 33, // 131: google.storage.v2.Storage.ListObjects:input_type -> google.storage.v2.ListObjectsRequest + 36, // 132: google.storage.v2.Storage.RewriteObject:input_type -> google.storage.v2.RewriteObjectRequest + 39, // 133: google.storage.v2.Storage.StartResumableWrite:input_type -> google.storage.v2.StartResumableWriteRequest + 34, // 134: google.storage.v2.Storage.QueryWriteStatus:input_type -> google.storage.v2.QueryWriteStatusRequest + 38, // 135: google.storage.v2.Storage.MoveObject:input_type -> google.storage.v2.MoveObjectRequest + 84, // 136: google.storage.v2.Storage.DeleteBucket:output_type -> google.protobuf.Empty + 44, // 137: google.storage.v2.Storage.GetBucket:output_type -> google.storage.v2.Bucket + 44, // 138: google.storage.v2.Storage.CreateBucket:output_type -> google.storage.v2.Bucket + 5, // 139: google.storage.v2.Storage.ListBuckets:output_type -> google.storage.v2.ListBucketsResponse + 44, // 140: google.storage.v2.Storage.LockBucketRetentionPolicy:output_type -> google.storage.v2.Bucket + 85, // 141: google.storage.v2.Storage.GetIamPolicy:output_type -> google.iam.v1.Policy + 85, // 142: google.storage.v2.Storage.SetIamPolicy:output_type -> google.iam.v1.Policy + 86, // 143: google.storage.v2.Storage.TestIamPermissions:output_type -> google.iam.v1.TestIamPermissionsResponse + 44, // 144: google.storage.v2.Storage.UpdateBucket:output_type -> google.storage.v2.Bucket + 49, // 145: google.storage.v2.Storage.ComposeObject:output_type -> google.storage.v2.Object + 84, // 146: google.storage.v2.Storage.DeleteObject:output_type -> google.protobuf.Empty + 49, // 147: google.storage.v2.Storage.RestoreObject:output_type -> google.storage.v2.Object + 12, // 148: google.storage.v2.Storage.CancelResumableWrite:output_type -> google.storage.v2.CancelResumableWriteResponse + 49, // 149: google.storage.v2.Storage.GetObject:output_type -> google.storage.v2.Object + 15, // 150: google.storage.v2.Storage.ReadObject:output_type -> google.storage.v2.ReadObjectResponse + 18, // 151: google.storage.v2.Storage.BidiReadObject:output_type -> google.storage.v2.BidiReadObjectResponse + 49, // 152: google.storage.v2.Storage.UpdateObject:output_type -> google.storage.v2.Object + 29, // 153: google.storage.v2.Storage.WriteObject:output_type -> google.storage.v2.WriteObjectResponse + 32, // 154: google.storage.v2.Storage.BidiWriteObject:output_type -> google.storage.v2.BidiWriteObjectResponse + 51, // 155: google.storage.v2.Storage.ListObjects:output_type -> google.storage.v2.ListObjectsResponse + 37, // 156: google.storage.v2.Storage.RewriteObject:output_type -> google.storage.v2.RewriteResponse + 40, // 157: google.storage.v2.Storage.StartResumableWrite:output_type -> google.storage.v2.StartResumableWriteResponse + 35, // 158: google.storage.v2.Storage.QueryWriteStatus:output_type -> google.storage.v2.QueryWriteStatusResponse + 49, // 159: google.storage.v2.Storage.MoveObject:output_type -> google.storage.v2.Object + 136, // [136:160] is the sub-list for method output_type + 112, // [112:136] is the sub-list for method input_type + 112, // [112:112] is the sub-list for extension type_name + 112, // [112:112] is the sub-list for extension extendee + 0, // [0:112] is the sub-list for field type_name } func init() { file_google_storage_v2_storage_proto_init() } @@ -8053,46 +9202,51 @@ func file_google_storage_v2_storage_proto_init() { file_google_storage_v2_storage_proto_msgTypes[12].OneofWrappers = []any{} file_google_storage_v2_storage_proto_msgTypes[13].OneofWrappers = []any{} file_google_storage_v2_storage_proto_msgTypes[15].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[16].OneofWrappers = []any{ + file_google_storage_v2_storage_proto_msgTypes[18].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[19].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[26].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[27].OneofWrappers = []any{ (*WriteObjectRequest_UploadId)(nil), (*WriteObjectRequest_WriteObjectSpec)(nil), (*WriteObjectRequest_ChecksummedData)(nil), } - file_google_storage_v2_storage_proto_msgTypes[17].OneofWrappers = []any{ + file_google_storage_v2_storage_proto_msgTypes[28].OneofWrappers = []any{ (*WriteObjectResponse_PersistedSize)(nil), (*WriteObjectResponse_Resource)(nil), } - file_google_storage_v2_storage_proto_msgTypes[18].OneofWrappers = []any{ + file_google_storage_v2_storage_proto_msgTypes[29].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[30].OneofWrappers = []any{ (*BidiWriteObjectRequest_UploadId)(nil), (*BidiWriteObjectRequest_WriteObjectSpec)(nil), + (*BidiWriteObjectRequest_AppendObjectSpec)(nil), (*BidiWriteObjectRequest_ChecksummedData)(nil), } - file_google_storage_v2_storage_proto_msgTypes[19].OneofWrappers = []any{ + file_google_storage_v2_storage_proto_msgTypes[31].OneofWrappers = []any{ (*BidiWriteObjectResponse_PersistedSize)(nil), (*BidiWriteObjectResponse_Resource)(nil), } - file_google_storage_v2_storage_proto_msgTypes[20].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[22].OneofWrappers = []any{ + file_google_storage_v2_storage_proto_msgTypes[32].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[34].OneofWrappers = []any{ (*QueryWriteStatusResponse_PersistedSize)(nil), (*QueryWriteStatusResponse_Resource)(nil), } - file_google_storage_v2_storage_proto_msgTypes[23].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[25].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[28].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[33].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[34].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[36].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[43].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[51].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[35].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[37].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[40].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[45].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[46].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[48].OneofWrappers = []any{} file_google_storage_v2_storage_proto_msgTypes[55].OneofWrappers = []any{} - file_google_storage_v2_storage_proto_msgTypes[61].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[63].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[67].OneofWrappers = []any{} + file_google_storage_v2_storage_proto_msgTypes[73].OneofWrappers = []any{} type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_storage_v2_storage_proto_rawDesc, NumEnums: 1, - NumMessages: 63, + NumMessages: 75, NumExtensions: 0, NumServices: 1, }, @@ -8150,12 +9304,26 @@ type StorageClient interface { // Concatenates a list of existing objects into a new object in the same // bucket. ComposeObject(ctx context.Context, in *ComposeObjectRequest, opts ...grpc.CallOption) (*Object, error) - // Deletes an object and its metadata. + // Deletes an object and its metadata. Deletions are permanent if versioning + // is not enabled for the bucket, or if the generation parameter is used, or + // if [soft delete](https://cloud.google.com/storage/docs/soft-delete) is not + // enabled for the bucket. + // When this API is used to delete an object from a bucket that has soft + // delete policy enabled, the object becomes soft deleted, and the + // `softDeleteTime` and `hardDeleteTime` properties are set on the object. + // This API cannot be used to permanently delete soft-deleted objects. + // Soft-deleted objects are permanently deleted according to their + // `hardDeleteTime`. + // + // You can use the [`RestoreObject`][google.storage.v2.Storage.RestoreObject] + // API to restore soft-deleted objects until the soft delete retention period + // has passed. // - // Deletions are normally permanent when versioning is disabled or whenever - // the generation parameter is used. However, if soft delete is enabled for - // the bucket, deleted objects can be restored using RestoreObject until the - // soft delete retention period has passed. + // **IAM Permissions**: + // + // Requires `storage.objects.delete` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. DeleteObject(ctx context.Context, in *DeleteObjectRequest, opts ...grpc.CallOption) (*emptypb.Empty, error) // Restores a soft-deleted object. RestoreObject(ctx context.Context, in *RestoreObjectRequest, opts ...grpc.CallOption) (*Object, error) @@ -8168,10 +9336,43 @@ type StorageClient interface { // they could either complete before the cancellation or fail if the // cancellation completes first. CancelResumableWrite(ctx context.Context, in *CancelResumableWriteRequest, opts ...grpc.CallOption) (*CancelResumableWriteResponse, error) - // Retrieves an object's metadata. + // Retrieves object metadata. + // + // **IAM Permissions**: + // + // Requires `storage.objects.get` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. To return object ACLs, the authenticated user must also have + // the `storage.objects.getIamPolicy` permission. GetObject(ctx context.Context, in *GetObjectRequest, opts ...grpc.CallOption) (*Object, error) - // Reads an object's data. + // Retrieves object data. + // + // **IAM Permissions**: + // + // Requires `storage.objects.get` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. ReadObject(ctx context.Context, in *ReadObjectRequest, opts ...grpc.CallOption) (Storage_ReadObjectClient, error) + // Reads an object's data. + // + // This is a bi-directional API with the added support for reading multiple + // ranges within one stream both within and across multiple messages. + // If the server encountered an error for any of the inputs, the stream will + // be closed with the relevant error code. + // Because the API allows for multiple outstanding requests, when the stream + // is closed the error response will contain a BidiReadObjectRangesError proto + // in the error extension describing the error for each outstanding read_id. + // + // **IAM Permissions**: + // + // Requires `storage.objects.get` + // + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. + // + // This API is currently in preview and is not yet available for general + // use. + BidiReadObject(ctx context.Context, opts ...grpc.CallOption) (Storage_BidiReadObjectClient, error) // Updates an object's metadata. // Equivalent to JSON API's storage.objects.patch. UpdateObject(ctx context.Context, in *UpdateObjectRequest, opts ...grpc.CallOption) (*Object, error) @@ -8228,12 +9429,18 @@ type StorageClient interface { // whether the service views the object as complete. // // Attempting to resume an already finalized object will result in an OK - // status, with a WriteObjectResponse containing the finalized object's + // status, with a `WriteObjectResponse` containing the finalized object's // metadata. // // Alternatively, the BidiWriteObject operation may be used to write an // object with controls over flushing and the ability to fetch the ability to // determine the current persisted size. + // + // **IAM Permissions**: + // + // Requires `storage.objects.create` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. WriteObject(ctx context.Context, opts ...grpc.CallOption) (Storage_WriteObjectClient, error) // Stores a new object and metadata. // @@ -8252,26 +9459,47 @@ type StorageClient interface { // always be sent to the client, regardless of the value of `state_lookup`. BidiWriteObject(ctx context.Context, opts ...grpc.CallOption) (Storage_BidiWriteObjectClient, error) // Retrieves a list of objects matching the criteria. + // + // **IAM Permissions**: + // + // The authenticated user requires `storage.objects.list` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) + // to use this method. To return object ACLs, the authenticated user must also + // have the `storage.objects.getIamPolicy` permission. ListObjects(ctx context.Context, in *ListObjectsRequest, opts ...grpc.CallOption) (*ListObjectsResponse, error) // Rewrites a source object to a destination object. Optionally overrides // metadata. RewriteObject(ctx context.Context, in *RewriteObjectRequest, opts ...grpc.CallOption) (*RewriteResponse, error) - // Starts a resumable write. How long the write operation remains valid, and - // what happens when the write operation becomes invalid, are - // service-dependent. + // Starts a resumable write operation. This + // method is part of the [Resumable + // upload](https://cloud.google.com/storage/docs/resumable-uploads) feature. + // This allows you to upload large objects in multiple chunks, which is more + // resilient to network interruptions than a single upload. The validity + // duration of the write operation, and the consequences of it becoming + // invalid, are service-dependent. + // + // **IAM Permissions**: + // + // Requires `storage.objects.create` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. StartResumableWrite(ctx context.Context, in *StartResumableWriteRequest, opts ...grpc.CallOption) (*StartResumableWriteResponse, error) - // Determines the `persisted_size` for an object that is being written, which - // can then be used as the `write_offset` for the next `Write()` call. + // Determines the `persisted_size` of an object that is being written. This + // method is part of the [resumable + // upload](https://cloud.google.com/storage/docs/resumable-uploads) feature. + // The returned value is the size of the object that has been persisted so + // far. The value can be used as the `write_offset` for the next `Write()` + // call. // - // If the object does not exist (i.e., the object has been deleted, or the - // first `Write()` has not yet reached the service), this method returns the + // If the object does not exist, meaning if it was deleted, or the + // first `Write()` has not yet reached the service, this method returns the // error `NOT_FOUND`. // - // The client **may** call `QueryWriteStatus()` at any time to determine how - // much data has been processed for this object. This is useful if the - // client is buffering data and needs to know which data can be safely - // evicted. For any sequence of `QueryWriteStatus()` calls for a given - // object name, the sequence of returned `persisted_size` values will be + // This method is useful for clients that buffer data and need to know which + // data can be safely evicted. The client can call `QueryWriteStatus()` at any + // time to determine how much data has been logged for this object. + // For any sequence of `QueryWriteStatus()` calls for a given + // object name, the sequence of returned `persisted_size` values are // non-decreasing. QueryWriteStatus(ctx context.Context, in *QueryWriteStatusRequest, opts ...grpc.CallOption) (*QueryWriteStatusResponse, error) // Moves the source object to the destination object in the same bucket. @@ -8444,6 +9672,37 @@ func (x *storageReadObjectClient) Recv() (*ReadObjectResponse, error) { return m, nil } +func (c *storageClient) BidiReadObject(ctx context.Context, opts ...grpc.CallOption) (Storage_BidiReadObjectClient, error) { + stream, err := c.cc.NewStream(ctx, &_Storage_serviceDesc.Streams[1], "/google.storage.v2.Storage/BidiReadObject", opts...) + if err != nil { + return nil, err + } + x := &storageBidiReadObjectClient{stream} + return x, nil +} + +type Storage_BidiReadObjectClient interface { + Send(*BidiReadObjectRequest) error + Recv() (*BidiReadObjectResponse, error) + grpc.ClientStream +} + +type storageBidiReadObjectClient struct { + grpc.ClientStream +} + +func (x *storageBidiReadObjectClient) Send(m *BidiReadObjectRequest) error { + return x.ClientStream.SendMsg(m) +} + +func (x *storageBidiReadObjectClient) Recv() (*BidiReadObjectResponse, error) { + m := new(BidiReadObjectResponse) + if err := x.ClientStream.RecvMsg(m); err != nil { + return nil, err + } + return m, nil +} + func (c *storageClient) UpdateObject(ctx context.Context, in *UpdateObjectRequest, opts ...grpc.CallOption) (*Object, error) { out := new(Object) err := c.cc.Invoke(ctx, "/google.storage.v2.Storage/UpdateObject", in, out, opts...) @@ -8454,7 +9713,7 @@ func (c *storageClient) UpdateObject(ctx context.Context, in *UpdateObjectReques } func (c *storageClient) WriteObject(ctx context.Context, opts ...grpc.CallOption) (Storage_WriteObjectClient, error) { - stream, err := c.cc.NewStream(ctx, &_Storage_serviceDesc.Streams[1], "/google.storage.v2.Storage/WriteObject", opts...) + stream, err := c.cc.NewStream(ctx, &_Storage_serviceDesc.Streams[2], "/google.storage.v2.Storage/WriteObject", opts...) if err != nil { return nil, err } @@ -8488,7 +9747,7 @@ func (x *storageWriteObjectClient) CloseAndRecv() (*WriteObjectResponse, error) } func (c *storageClient) BidiWriteObject(ctx context.Context, opts ...grpc.CallOption) (Storage_BidiWriteObjectClient, error) { - stream, err := c.cc.NewStream(ctx, &_Storage_serviceDesc.Streams[2], "/google.storage.v2.Storage/BidiWriteObject", opts...) + stream, err := c.cc.NewStream(ctx, &_Storage_serviceDesc.Streams[3], "/google.storage.v2.Storage/BidiWriteObject", opts...) if err != nil { return nil, err } @@ -8596,12 +9855,26 @@ type StorageServer interface { // Concatenates a list of existing objects into a new object in the same // bucket. ComposeObject(context.Context, *ComposeObjectRequest) (*Object, error) - // Deletes an object and its metadata. + // Deletes an object and its metadata. Deletions are permanent if versioning + // is not enabled for the bucket, or if the generation parameter is used, or + // if [soft delete](https://cloud.google.com/storage/docs/soft-delete) is not + // enabled for the bucket. + // When this API is used to delete an object from a bucket that has soft + // delete policy enabled, the object becomes soft deleted, and the + // `softDeleteTime` and `hardDeleteTime` properties are set on the object. + // This API cannot be used to permanently delete soft-deleted objects. + // Soft-deleted objects are permanently deleted according to their + // `hardDeleteTime`. + // + // You can use the [`RestoreObject`][google.storage.v2.Storage.RestoreObject] + // API to restore soft-deleted objects until the soft delete retention period + // has passed. // - // Deletions are normally permanent when versioning is disabled or whenever - // the generation parameter is used. However, if soft delete is enabled for - // the bucket, deleted objects can be restored using RestoreObject until the - // soft delete retention period has passed. + // **IAM Permissions**: + // + // Requires `storage.objects.delete` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. DeleteObject(context.Context, *DeleteObjectRequest) (*emptypb.Empty, error) // Restores a soft-deleted object. RestoreObject(context.Context, *RestoreObjectRequest) (*Object, error) @@ -8614,10 +9887,43 @@ type StorageServer interface { // they could either complete before the cancellation or fail if the // cancellation completes first. CancelResumableWrite(context.Context, *CancelResumableWriteRequest) (*CancelResumableWriteResponse, error) - // Retrieves an object's metadata. + // Retrieves object metadata. + // + // **IAM Permissions**: + // + // Requires `storage.objects.get` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. To return object ACLs, the authenticated user must also have + // the `storage.objects.getIamPolicy` permission. GetObject(context.Context, *GetObjectRequest) (*Object, error) - // Reads an object's data. + // Retrieves object data. + // + // **IAM Permissions**: + // + // Requires `storage.objects.get` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. ReadObject(*ReadObjectRequest, Storage_ReadObjectServer) error + // Reads an object's data. + // + // This is a bi-directional API with the added support for reading multiple + // ranges within one stream both within and across multiple messages. + // If the server encountered an error for any of the inputs, the stream will + // be closed with the relevant error code. + // Because the API allows for multiple outstanding requests, when the stream + // is closed the error response will contain a BidiReadObjectRangesError proto + // in the error extension describing the error for each outstanding read_id. + // + // **IAM Permissions**: + // + // Requires `storage.objects.get` + // + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. + // + // This API is currently in preview and is not yet available for general + // use. + BidiReadObject(Storage_BidiReadObjectServer) error // Updates an object's metadata. // Equivalent to JSON API's storage.objects.patch. UpdateObject(context.Context, *UpdateObjectRequest) (*Object, error) @@ -8674,12 +9980,18 @@ type StorageServer interface { // whether the service views the object as complete. // // Attempting to resume an already finalized object will result in an OK - // status, with a WriteObjectResponse containing the finalized object's + // status, with a `WriteObjectResponse` containing the finalized object's // metadata. // // Alternatively, the BidiWriteObject operation may be used to write an // object with controls over flushing and the ability to fetch the ability to // determine the current persisted size. + // + // **IAM Permissions**: + // + // Requires `storage.objects.create` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. WriteObject(Storage_WriteObjectServer) error // Stores a new object and metadata. // @@ -8698,26 +10010,47 @@ type StorageServer interface { // always be sent to the client, regardless of the value of `state_lookup`. BidiWriteObject(Storage_BidiWriteObjectServer) error // Retrieves a list of objects matching the criteria. + // + // **IAM Permissions**: + // + // The authenticated user requires `storage.objects.list` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) + // to use this method. To return object ACLs, the authenticated user must also + // have the `storage.objects.getIamPolicy` permission. ListObjects(context.Context, *ListObjectsRequest) (*ListObjectsResponse, error) // Rewrites a source object to a destination object. Optionally overrides // metadata. RewriteObject(context.Context, *RewriteObjectRequest) (*RewriteResponse, error) - // Starts a resumable write. How long the write operation remains valid, and - // what happens when the write operation becomes invalid, are - // service-dependent. + // Starts a resumable write operation. This + // method is part of the [Resumable + // upload](https://cloud.google.com/storage/docs/resumable-uploads) feature. + // This allows you to upload large objects in multiple chunks, which is more + // resilient to network interruptions than a single upload. The validity + // duration of the write operation, and the consequences of it becoming + // invalid, are service-dependent. + // + // **IAM Permissions**: + // + // Requires `storage.objects.create` + // [IAM permission](https://cloud.google.com/iam/docs/overview#permissions) on + // the bucket. StartResumableWrite(context.Context, *StartResumableWriteRequest) (*StartResumableWriteResponse, error) - // Determines the `persisted_size` for an object that is being written, which - // can then be used as the `write_offset` for the next `Write()` call. + // Determines the `persisted_size` of an object that is being written. This + // method is part of the [resumable + // upload](https://cloud.google.com/storage/docs/resumable-uploads) feature. + // The returned value is the size of the object that has been persisted so + // far. The value can be used as the `write_offset` for the next `Write()` + // call. // - // If the object does not exist (i.e., the object has been deleted, or the - // first `Write()` has not yet reached the service), this method returns the + // If the object does not exist, meaning if it was deleted, or the + // first `Write()` has not yet reached the service, this method returns the // error `NOT_FOUND`. // - // The client **may** call `QueryWriteStatus()` at any time to determine how - // much data has been processed for this object. This is useful if the - // client is buffering data and needs to know which data can be safely - // evicted. For any sequence of `QueryWriteStatus()` calls for a given - // object name, the sequence of returned `persisted_size` values will be + // This method is useful for clients that buffer data and need to know which + // data can be safely evicted. The client can call `QueryWriteStatus()` at any + // time to determine how much data has been logged for this object. + // For any sequence of `QueryWriteStatus()` calls for a given + // object name, the sequence of returned `persisted_size` values are // non-decreasing. QueryWriteStatus(context.Context, *QueryWriteStatusRequest) (*QueryWriteStatusResponse, error) // Moves the source object to the destination object in the same bucket. @@ -8729,73 +10062,76 @@ type UnimplementedStorageServer struct { } func (*UnimplementedStorageServer) DeleteBucket(context.Context, *DeleteBucketRequest) (*emptypb.Empty, error) { - return nil, status.Errorf(codes.Unimplemented, "method DeleteBucket not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method DeleteBucket not implemented") } func (*UnimplementedStorageServer) GetBucket(context.Context, *GetBucketRequest) (*Bucket, error) { - return nil, status.Errorf(codes.Unimplemented, "method GetBucket not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method GetBucket not implemented") } func (*UnimplementedStorageServer) CreateBucket(context.Context, *CreateBucketRequest) (*Bucket, error) { - return nil, status.Errorf(codes.Unimplemented, "method CreateBucket not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method CreateBucket not implemented") } func (*UnimplementedStorageServer) ListBuckets(context.Context, *ListBucketsRequest) (*ListBucketsResponse, error) { - return nil, status.Errorf(codes.Unimplemented, "method ListBuckets not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method ListBuckets not implemented") } func (*UnimplementedStorageServer) LockBucketRetentionPolicy(context.Context, *LockBucketRetentionPolicyRequest) (*Bucket, error) { - return nil, status.Errorf(codes.Unimplemented, "method LockBucketRetentionPolicy not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method LockBucketRetentionPolicy not implemented") } func (*UnimplementedStorageServer) GetIamPolicy(context.Context, *iampb.GetIamPolicyRequest) (*iampb.Policy, error) { - return nil, status.Errorf(codes.Unimplemented, "method GetIamPolicy not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method GetIamPolicy not implemented") } func (*UnimplementedStorageServer) SetIamPolicy(context.Context, *iampb.SetIamPolicyRequest) (*iampb.Policy, error) { - return nil, status.Errorf(codes.Unimplemented, "method SetIamPolicy not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method SetIamPolicy not implemented") } func (*UnimplementedStorageServer) TestIamPermissions(context.Context, *iampb.TestIamPermissionsRequest) (*iampb.TestIamPermissionsResponse, error) { - return nil, status.Errorf(codes.Unimplemented, "method TestIamPermissions not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method TestIamPermissions not implemented") } func (*UnimplementedStorageServer) UpdateBucket(context.Context, *UpdateBucketRequest) (*Bucket, error) { - return nil, status.Errorf(codes.Unimplemented, "method UpdateBucket not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method UpdateBucket not implemented") } func (*UnimplementedStorageServer) ComposeObject(context.Context, *ComposeObjectRequest) (*Object, error) { - return nil, status.Errorf(codes.Unimplemented, "method ComposeObject not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method ComposeObject not implemented") } func (*UnimplementedStorageServer) DeleteObject(context.Context, *DeleteObjectRequest) (*emptypb.Empty, error) { - return nil, status.Errorf(codes.Unimplemented, "method DeleteObject not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method DeleteObject not implemented") } func (*UnimplementedStorageServer) RestoreObject(context.Context, *RestoreObjectRequest) (*Object, error) { - return nil, status.Errorf(codes.Unimplemented, "method RestoreObject not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method RestoreObject not implemented") } func (*UnimplementedStorageServer) CancelResumableWrite(context.Context, *CancelResumableWriteRequest) (*CancelResumableWriteResponse, error) { - return nil, status.Errorf(codes.Unimplemented, "method CancelResumableWrite not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method CancelResumableWrite not implemented") } func (*UnimplementedStorageServer) GetObject(context.Context, *GetObjectRequest) (*Object, error) { - return nil, status.Errorf(codes.Unimplemented, "method GetObject not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method GetObject not implemented") } func (*UnimplementedStorageServer) ReadObject(*ReadObjectRequest, Storage_ReadObjectServer) error { - return status.Errorf(codes.Unimplemented, "method ReadObject not implemented") + return status1.Errorf(codes.Unimplemented, "method ReadObject not implemented") +} +func (*UnimplementedStorageServer) BidiReadObject(Storage_BidiReadObjectServer) error { + return status1.Errorf(codes.Unimplemented, "method BidiReadObject not implemented") } func (*UnimplementedStorageServer) UpdateObject(context.Context, *UpdateObjectRequest) (*Object, error) { - return nil, status.Errorf(codes.Unimplemented, "method UpdateObject not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method UpdateObject not implemented") } func (*UnimplementedStorageServer) WriteObject(Storage_WriteObjectServer) error { - return status.Errorf(codes.Unimplemented, "method WriteObject not implemented") + return status1.Errorf(codes.Unimplemented, "method WriteObject not implemented") } func (*UnimplementedStorageServer) BidiWriteObject(Storage_BidiWriteObjectServer) error { - return status.Errorf(codes.Unimplemented, "method BidiWriteObject not implemented") + return status1.Errorf(codes.Unimplemented, "method BidiWriteObject not implemented") } func (*UnimplementedStorageServer) ListObjects(context.Context, *ListObjectsRequest) (*ListObjectsResponse, error) { - return nil, status.Errorf(codes.Unimplemented, "method ListObjects not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method ListObjects not implemented") } func (*UnimplementedStorageServer) RewriteObject(context.Context, *RewriteObjectRequest) (*RewriteResponse, error) { - return nil, status.Errorf(codes.Unimplemented, "method RewriteObject not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method RewriteObject not implemented") } func (*UnimplementedStorageServer) StartResumableWrite(context.Context, *StartResumableWriteRequest) (*StartResumableWriteResponse, error) { - return nil, status.Errorf(codes.Unimplemented, "method StartResumableWrite not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method StartResumableWrite not implemented") } func (*UnimplementedStorageServer) QueryWriteStatus(context.Context, *QueryWriteStatusRequest) (*QueryWriteStatusResponse, error) { - return nil, status.Errorf(codes.Unimplemented, "method QueryWriteStatus not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method QueryWriteStatus not implemented") } func (*UnimplementedStorageServer) MoveObject(context.Context, *MoveObjectRequest) (*Object, error) { - return nil, status.Errorf(codes.Unimplemented, "method MoveObject not implemented") + return nil, status1.Errorf(codes.Unimplemented, "method MoveObject not implemented") } func RegisterStorageServer(s *grpc.Server, srv StorageServer) { @@ -9075,6 +10411,32 @@ func (x *storageReadObjectServer) Send(m *ReadObjectResponse) error { return x.ServerStream.SendMsg(m) } +func _Storage_BidiReadObject_Handler(srv interface{}, stream grpc.ServerStream) error { + return srv.(StorageServer).BidiReadObject(&storageBidiReadObjectServer{stream}) +} + +type Storage_BidiReadObjectServer interface { + Send(*BidiReadObjectResponse) error + Recv() (*BidiReadObjectRequest, error) + grpc.ServerStream +} + +type storageBidiReadObjectServer struct { + grpc.ServerStream +} + +func (x *storageBidiReadObjectServer) Send(m *BidiReadObjectResponse) error { + return x.ServerStream.SendMsg(m) +} + +func (x *storageBidiReadObjectServer) Recv() (*BidiReadObjectRequest, error) { + m := new(BidiReadObjectRequest) + if err := x.ServerStream.RecvMsg(m); err != nil { + return nil, err + } + return m, nil +} + func _Storage_UpdateObject_Handler(srv interface{}, ctx context.Context, dec func(interface{}) error, interceptor grpc.UnaryServerInterceptor) (interface{}, error) { in := new(UpdateObjectRequest) if err := dec(in); err != nil { @@ -9326,6 +10688,12 @@ var _Storage_serviceDesc = grpc.ServiceDesc{ Handler: _Storage_ReadObject_Handler, ServerStreams: true, }, + { + StreamName: "BidiReadObject", + Handler: _Storage_BidiReadObject_Handler, + ServerStreams: true, + ClientStreams: true, + }, { StreamName: "WriteObject", Handler: _Storage_WriteObject_Handler, diff --git a/vendor/cloud.google.com/go/storage/internal/experimental.go b/vendor/cloud.google.com/go/storage/internal/experimental.go index 7db3ff52743cc..2fd5111fb3061 100644 --- a/vendor/cloud.google.com/go/storage/internal/experimental.go +++ b/vendor/cloud.google.com/go/storage/internal/experimental.go @@ -29,4 +29,8 @@ var ( // WithReadStallTimeout is a function which is implemented by storage package. // It takes ReadStallTimeoutConfig as inputs and returns a option.ClientOption. WithReadStallTimeout any // func (*ReadStallTimeoutConfig) option.ClientOption + + // WithGRPCBidiReads is a function which is implemented by the storage package. + // It sets the gRPC client to use the BidiReadObject API for downloads. + WithGRPCBidiReads any // func() option.ClientOption ) diff --git a/vendor/cloud.google.com/go/storage/internal/version.go b/vendor/cloud.google.com/go/storage/internal/version.go index 8e10894500bc2..ba56cacd8ede3 100644 --- a/vendor/cloud.google.com/go/storage/internal/version.go +++ b/vendor/cloud.google.com/go/storage/internal/version.go @@ -15,4 +15,4 @@ package internal // Version is the current tagged release of the library. -const Version = "1.49.0" +const Version = "1.50.0" diff --git a/vendor/cloud.google.com/go/storage/invoke.go b/vendor/cloud.google.com/go/storage/invoke.go index b1e838fc7193b..99783f3df47b6 100644 --- a/vendor/cloud.google.com/go/storage/invoke.go +++ b/vendor/cloud.google.com/go/storage/invoke.go @@ -58,9 +58,9 @@ func run(ctx context.Context, call func(ctx context.Context) error, retry *retry } bo := gax.Backoff{} if retry.backoff != nil { - bo.Multiplier = retry.backoff.GetMultiplier() - bo.Initial = retry.backoff.GetInitial() - bo.Max = retry.backoff.GetMax() + bo.Multiplier = retry.backoff.Multiplier + bo.Initial = retry.backoff.Initial + bo.Max = retry.backoff.Max } var errorFunc func(err error) bool = ShouldRetry if retry.shouldRetry != nil { diff --git a/vendor/cloud.google.com/go/storage/option.go b/vendor/cloud.google.com/go/storage/option.go index a7474842b78a3..16d57644aaebe 100644 --- a/vendor/cloud.google.com/go/storage/option.go +++ b/vendor/cloud.google.com/go/storage/option.go @@ -40,6 +40,7 @@ func init() { storageinternal.WithMetricExporter = withMetricExporter storageinternal.WithMetricInterval = withMetricInterval storageinternal.WithReadStallTimeout = withReadStallTimeout + storageinternal.WithGRPCBidiReads = withGRPCBidiReads } // getDynamicReadReqIncreaseRateFromEnv returns the value set in the env variable. @@ -81,6 +82,7 @@ type storageConfig struct { metricInterval time.Duration manualReader *metric.ManualReader readStallTimeoutConfig *experimental.ReadStallTimeoutConfig + grpcBidiReads bool } // newStorageConfig generates a new storageConfig with all the given @@ -240,3 +242,15 @@ type withReadStallTimeoutConfig struct { func (wrstc *withReadStallTimeoutConfig) ApplyStorageOpt(config *storageConfig) { config.readStallTimeoutConfig = wrstc.readStallTimeoutConfig } + +func withGRPCBidiReads() option.ClientOption { + return &withGRPCBidiReadsConfig{} +} + +type withGRPCBidiReadsConfig struct { + internaloption.EmbeddableAdapter +} + +func (w *withGRPCBidiReadsConfig) ApplyStorageOpt(config *storageConfig) { + config.grpcBidiReads = true +} diff --git a/vendor/cloud.google.com/go/storage/reader.go b/vendor/cloud.google.com/go/storage/reader.go index 7f5abee1f25e8..6b14fd1dce13b 100644 --- a/vendor/cloud.google.com/go/storage/reader.go +++ b/vendor/cloud.google.com/go/storage/reader.go @@ -22,6 +22,7 @@ import ( "io/ioutil" "net/http" "strings" + "sync" "time" "cloud.google.com/go/internal/trace" @@ -140,6 +141,7 @@ func (o *ObjectHandle) NewRangeReader(ctx context.Context, offset, length int64) encryptionKey: o.encryptionKey, conds: o.conds, readCompressed: o.readCompressed, + handle: &o.readHandle, } r, err = o.c.tc.NewRangeReader(ctx, params, opts...) @@ -155,6 +157,49 @@ func (o *ObjectHandle) NewRangeReader(ctx context.Context, offset, length int64) return r, err } +// NewMultiRangeDownloader creates a multi-range reader for an object. +// Must be called on a gRPC client created using [NewGRPCClient]. +// +// This uses the gRPC-specific bi-directional read API, which is in private +// preview; please contact your account manager if interested. +func (o *ObjectHandle) NewMultiRangeDownloader(ctx context.Context) (mrd *MultiRangeDownloader, err error) { + // This span covers the life of the reader. It is closed via the context + // in Reader.Close. + ctx = trace.StartSpan(ctx, "cloud.google.com/go/storage.Object.MultiRangeDownloader") + + if err := o.validate(); err != nil { + return nil, err + } + if o.conds != nil { + if err := o.conds.validate("NewMultiRangeDownloader"); err != nil { + return nil, err + } + } + + opts := makeStorageOpts(true, o.retry, o.userProject) + + params := &newMultiRangeDownloaderParams{ + bucket: o.bucket, + conds: o.conds, + encryptionKey: o.encryptionKey, + gen: o.gen, + object: o.object, + handle: &o.readHandle, + } + + r, err := o.c.tc.NewMultiRangeDownloader(ctx, params, opts...) + + // Pass the context so that the span can be closed in MultiRangeDownloader.Close(), or close the + // span now if there is an error. + if err == nil { + r.ctx = ctx + } else { + trace.EndSpan(ctx, err) + } + + return r, err +} + // decompressiveTranscoding returns true if the request was served decompressed // and different than its original storage form. This happens when the "Content-Encoding" // header is "gzip". @@ -230,6 +275,8 @@ type Reader struct { reader io.ReadCloser ctx context.Context + mu sync.Mutex + handle *ReadHandle } // Close closes the Reader. It must be called when done reading. @@ -313,3 +360,82 @@ func (r *Reader) Metadata() map[string]string { } return nil } + +// ReadHandle returns the read handle associated with an object. +// ReadHandle will be periodically refreshed. +// +// ReadHandle requires the gRPC-specific bi-directional read API, which is in +// private preview; please contact your account manager if interested. +// Note that this only valid for gRPC and only with zonal buckets. +func (r *Reader) ReadHandle() ReadHandle { + if r.handle == nil { + r.handle = &ReadHandle{} + } + r.mu.Lock() + defer r.mu.Unlock() + return (*r.handle) +} + +// MultiRangeDownloader reads a Cloud Storage object. +// +// Typically, a MultiRangeDownloader opens a stream to which we can add +// different ranges to read from the object. +// +// This API is currently in preview and is not yet available for general use. +type MultiRangeDownloader struct { + Attrs ReaderObjectAttrs + reader multiRangeDownloader + ctx context.Context +} + +type multiRangeDownloader interface { + add(output io.Writer, offset, limit int64, callback func(int64, int64, error)) + wait() + close() error + getHandle() []byte +} + +// Add adds a new range to MultiRangeDownloader. +// +// The offset for the first byte to return in the read, relative to the start +// of the object. +// +// A negative offset value will be interpreted as the number of bytes from the +// end of the object to be returned. Requesting a negative offset with magnitude +// larger than the size of the object will return the entire object. An offset +// larger than the size of the object will result in an OutOfRange error. +// +// A limit of zero indicates that there is no limit, and a negative limit will +// cause an error. +// +// This will initiate the read range but is non-blocking; call callback to +// process the result. Add is thread-safe and can be called simultaneously +// from different goroutines. +func (mrd *MultiRangeDownloader) Add(output io.Writer, offset, length int64, callback func(int64, int64, error)) { + mrd.reader.add(output, offset, length, callback) +} + +// Close the MultiRangeDownloader. It must be called when done reading. +// Adding new ranges after this has been called will cause an error. +// +// This will immediately close the stream and can result in a +// "stream closed early" error if a response for a range is still not processed. +// Call [MultiRangeDownloader.Wait] to avoid this error. +func (mrd *MultiRangeDownloader) Close() error { + err := mrd.reader.close() + trace.EndSpan(mrd.ctx, err) + return err +} + +// Wait for all the responses to process on the stream. +// Adding new ranges after this has been called will cause an error. +// Wait will wait for all callbacks to finish. +func (mrd *MultiRangeDownloader) Wait() { + mrd.reader.wait() +} + +// GetHandle returns the read handle. This can be used to further speed up the +// follow up read if the same object is read through a different stream. +func (mrd *MultiRangeDownloader) GetHandle() []byte { + return mrd.reader.getHandle() +} diff --git a/vendor/cloud.google.com/go/storage/storage.go b/vendor/cloud.google.com/go/storage/storage.go index a487ebd65ec40..9c40ca1b47ec2 100644 --- a/vendor/cloud.google.com/go/storage/storage.go +++ b/vendor/cloud.google.com/go/storage/storage.go @@ -72,8 +72,8 @@ var ( // errMethodNotSupported indicates that the method called is not currently supported by the client. // TODO: Export this error when launching the transport-agnostic client. errMethodNotSupported = errors.New("storage: method is not currently supported") - // errMethodNotValid indicates that given HTTP method is not valid. - errMethodNotValid = fmt.Errorf("storage: HTTP method should be one of %v", reflect.ValueOf(signedURLMethods).MapKeys()) + // errSignedURLMethodNotValid indicates that given HTTP method is not valid. + errSignedURLMethodNotValid = fmt.Errorf("storage: HTTP method should be one of %v", reflect.ValueOf(signedURLMethods).MapKeys()) ) var userAgent = fmt.Sprintf("gcloud-golang-storage/%s", internal.Version) @@ -689,7 +689,7 @@ func validateOptions(opts *SignedURLOptions, now time.Time) error { } opts.Method = strings.ToUpper(opts.Method) if _, ok := signedURLMethods[opts.Method]; !ok { - return errMethodNotValid + return errSignedURLMethodNotValid } if opts.Expires.IsZero() { return errors.New("storage: missing required expires option") @@ -937,6 +937,9 @@ func signedURLV2(bucket, name string, opts *SignedURLOptions) (string, error) { return u.String(), nil } +// ReadHandle associated with the object. This is periodically refreshed. +type ReadHandle []byte + // ObjectHandle provides operations on an object in a Google Cloud Storage bucket. // Use BucketHandle.Object to get a handle. type ObjectHandle struct { @@ -952,6 +955,23 @@ type ObjectHandle struct { retry *retryConfig overrideRetention *bool softDeleted bool + readHandle ReadHandle +} + +// ReadHandle returns a new ObjectHandle that uses the ReadHandle to open the objects. +// +// Objects that have already been opened can be opened an additional time, +// using a read handle returned in the response, at lower latency. +// This produces the exact same object and generation and does not check if +// the generation is still the newest one. +// Note that this will be a noop unless it's set on a gRPC client on buckets with +// bi-directional read API access. +// Also note that you can get a ReadHandle only via calling reader.ReadHandle() on a +// previous read of the same object. +func (o *ObjectHandle) ReadHandle(r ReadHandle) *ObjectHandle { + o2 := *o + o2.readHandle = r + return &o2 } // ACL provides access to the object's access control list. @@ -2304,7 +2324,7 @@ type withBackoff struct { } func (wb *withBackoff) apply(config *retryConfig) { - config.backoff = gaxBackoffFromStruct(&wb.backoff) + config.backoff = &wb.backoff } // WithMaxAttempts configures the maximum number of times an API call can be made @@ -2395,58 +2415,8 @@ func (wef *withErrorFunc) apply(config *retryConfig) { config.shouldRetry = wef.shouldRetry } -type backoff interface { - Pause() time.Duration - - SetInitial(time.Duration) - SetMax(time.Duration) - SetMultiplier(float64) - - GetInitial() time.Duration - GetMax() time.Duration - GetMultiplier() float64 -} - -func gaxBackoffFromStruct(bo *gax.Backoff) *gaxBackoff { - if bo == nil { - return nil - } - b := &gaxBackoff{} - b.Backoff = *bo - return b -} - -// gaxBackoff is a gax.Backoff that implements the backoff interface -type gaxBackoff struct { - gax.Backoff -} - -func (b *gaxBackoff) SetInitial(i time.Duration) { - b.Initial = i -} - -func (b *gaxBackoff) SetMax(m time.Duration) { - b.Max = m -} - -func (b *gaxBackoff) SetMultiplier(m float64) { - b.Multiplier = m -} - -func (b *gaxBackoff) GetInitial() time.Duration { - return b.Initial -} - -func (b *gaxBackoff) GetMax() time.Duration { - return b.Max -} - -func (b *gaxBackoff) GetMultiplier() float64 { - return b.Multiplier -} - type retryConfig struct { - backoff backoff + backoff *gax.Backoff policy RetryPolicy shouldRetry func(err error) bool maxAttempts *int @@ -2456,22 +2426,22 @@ func (r *retryConfig) clone() *retryConfig { if r == nil { return nil } - newConfig := &retryConfig{ - backoff: nil, - policy: r.policy, - shouldRetry: r.shouldRetry, - maxAttempts: r.maxAttempts, - } + var bo *gax.Backoff if r.backoff != nil { - bo := &gaxBackoff{} - bo.Initial = r.backoff.GetInitial() - bo.Max = r.backoff.GetMax() - bo.Multiplier = r.backoff.GetMultiplier() - newConfig.backoff = bo + bo = &gax.Backoff{ + Initial: r.backoff.Initial, + Max: r.backoff.Max, + Multiplier: r.backoff.Multiplier, + } } - return newConfig + return &retryConfig{ + backoff: bo, + policy: r.policy, + shouldRetry: r.shouldRetry, + maxAttempts: r.maxAttempts, + } } // composeSourceObj wraps a *raw.ComposeRequestSourceObjects, but adds the methods diff --git a/vendor/cloud.google.com/go/storage/writer.go b/vendor/cloud.google.com/go/storage/writer.go index c0fc2ec2398e1..ae8f6a63928d3 100644 --- a/vendor/cloud.google.com/go/storage/writer.go +++ b/vendor/cloud.google.com/go/storage/writer.go @@ -102,6 +102,15 @@ type Writer struct { // is provided, then gax.DetermineContentType is called to sniff the type. ForceEmptyContentType bool + // Append is a parameter to indicate whether the writer should use appendable + // object semantics for the new object generation. Appendable objects are + // visible on the first Write() call, and can be appended to until they are + // finalized. The object is finalized on a call to Close(). + // + // Append is only supported for gRPC. This feature is in preview and is not + // yet available for general use. + Append bool + // ProgressFunc can be used to monitor the progress of a large write // operation. If ProgressFunc is not nil and writing requires multiple // calls to the underlying service (see @@ -203,6 +212,7 @@ func (w *Writer) openWriter() (err error) { conds: w.o.conds, encryptionKey: w.o.encryptionKey, sendCRC32C: w.SendCRC32C, + append: w.Append, donec: w.donec, setError: w.error, progress: w.progress, diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/README.md b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/README.md index c77d5eb154461..ea391705f251c 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/README.md +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/README.md @@ -3,7 +3,14 @@ [![Docs](https://godoc.org/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric?status.svg)](https://pkg.go.dev/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric) [![Apache License][license-image]][license-url] -OpenTelemetry Google Cloud Monitoring Exporter allow the user to send collected metrics to Google Cloud. +OpenTelemetry Google Cloud Monitoring Exporter allows the user to send collected metrics to Google Cloud. + +To get started with instrumentation in Google Cloud, see [Generate traces and metrics with +Go](https://cloud.google.com/stackdriver/docs/instrumentation/setup/go). + +To learn more about instrumentation and observability, including opinionated recommendations +for Google Cloud Observability, visit [Instrumentation and +observability](https://cloud.google.com/stackdriver/docs/instrumentation/overview). [Google Cloud Monitoring](https://cloud.google.com/monitoring) provides visibility into the performance, uptime, and overall health of cloud-powered applications. It collects metrics, events, and metadata from Google Cloud, Amazon Web Services, hosted uptime probes, application instrumentation, and a variety of common application components including Cassandra, Nginx, Apache Web Server, Elasticsearch, and many others. Operations ingests that data and generates insights via dashboards, charts, and alerts. Cloud Monitoring alerting helps you collaborate by integrating with Slack, PagerDuty, and more. diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/metric.go b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/metric.go index ba0012e25a916..b0ab713c6d09f 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/metric.go +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/metric.go @@ -68,7 +68,7 @@ type key struct { libraryname string } -func keyOf(metrics metricdata.Metrics, library instrumentation.Library) key { +func keyOf(metrics metricdata.Metrics, library instrumentation.Scope) key { return key{ name: metrics.Name, libraryname: library.Name, @@ -426,7 +426,7 @@ func recordToMdpbKindType(a metricdata.Aggregation) (googlemetricpb.MetricDescri } // recordToMpb converts data from records to Metric proto type for Cloud Monitoring. -func (me *metricExporter) recordToMpb(metrics metricdata.Metrics, attributes attribute.Set, library instrumentation.Library, extraLabels *attribute.Set) *googlemetricpb.Metric { +func (me *metricExporter) recordToMpb(metrics metricdata.Metrics, attributes attribute.Set, library instrumentation.Scope, extraLabels *attribute.Set) *googlemetricpb.Metric { me.mdLock.RLock() defer me.mdLock.RUnlock() k := keyOf(metrics, library) diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/option.go b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/option.go index 11b96067d557d..701b10b101473 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/option.go +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/option.go @@ -92,7 +92,7 @@ type options struct { // WithProjectID sets Google Cloud Platform project as projectID. // Without using this option, it automatically detects the project ID // from the default credential detection process. -// Please find the detailed order of the default credentail detection proecess on the doc: +// Please find the detailed order of the default credential detection process on the doc: // https://godoc.org/golang.org/x/oauth2/google#FindDefaultCredentials func WithProjectID(id string) func(o *options) { return func(o *options) { diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/version.go b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/version.go index e31119fc1293f..a8054fec34bdd 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/version.go +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/version.go @@ -17,5 +17,5 @@ package metric // Version is the current release version of the OpenTelemetry // Operations Metric Exporter in use. func Version() string { - return "0.48.1" + return "0.49.0" } diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping/resourcemapping.go b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping/resourcemapping.go index 4b5af517fe62d..510391b824aaf 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping/resourcemapping.go +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping/resourcemapping.go @@ -221,9 +221,8 @@ func commonResourceAttributesToMonitoredResource(cloudPlatform string, attrs Rea return createMonitoredResource(k8sPod, attrs) } else if _, ok := attrs.GetString(string(semconv.K8SNodeNameKey)); ok { return createMonitoredResource(k8sNode, attrs) - } else { - return createMonitoredResource(k8sCluster, attrs) } + return createMonitoredResource(k8sCluster, attrs) } // Fallback to generic_task diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/bucket.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/bucket.go index 4026f1a4a0deb..93c67e537e798 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/bucket.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/bucket.go @@ -16,7 +16,8 @@ import ( "github.com/gorilla/mux" ) -var bucketRegexp = regexp.MustCompile(`^[a-zA-Z0-9][a-zA-Z0-9._-]*[a-zA-Z0-9]$`) +// https://cloud.google.com/storage/docs/buckets#naming +var bucketRegexp = regexp.MustCompile(`^[a-z0-9][a-z0-9._-]*[a-z0-9]$`) // CreateBucket creates a bucket inside the server, so any API calls that // require the bucket name will recognize this bucket. diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/object.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/object.go index b229a452331e6..664751ee44349 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/object.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/object.go @@ -32,9 +32,11 @@ type ObjectAttrs struct { BucketName string Name string Size int64 + StorageClass string ContentType string ContentEncoding string ContentDisposition string + ContentLanguage string CacheControl string // Crc32c checksum of Content. calculated by server when it's upload methods are used. Crc32c string @@ -59,9 +61,11 @@ type jsonObject struct { BucketName string `json:"bucket"` Name string `json:"name"` Size int64 `json:"size,string"` + StorageClass string `json:"storageClass"` ContentType string `json:"contentType"` ContentEncoding string `json:"contentEncoding"` ContentDisposition string `json:"contentDisposition"` + ContentLanguage string `json:"contentLanguage"` Crc32c string `json:"crc32c,omitempty"` Md5Hash string `json:"md5Hash,omitempty"` Etag string `json:"etag,omitempty"` @@ -79,9 +83,11 @@ func (o ObjectAttrs) MarshalJSON() ([]byte, error) { temp := jsonObject{ BucketName: o.BucketName, Name: o.Name, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, Size: o.Size, Crc32c: o.Crc32c, Md5Hash: o.Md5Hash, @@ -108,9 +114,11 @@ func (o *ObjectAttrs) UnmarshalJSON(data []byte) error { } o.BucketName = temp.BucketName o.Name = temp.Name + o.StorageClass = temp.StorageClass o.ContentType = temp.ContentType o.ContentEncoding = temp.ContentEncoding o.ContentDisposition = temp.ContentDisposition + o.ContentLanguage = temp.ContentLanguage o.Size = temp.Size o.Crc32c = temp.Crc32c o.Md5Hash = temp.Md5Hash @@ -315,6 +323,7 @@ type ListOptions struct { StartOffset string EndOffset string IncludeTrailingDelimiter bool + MaxResults int } // ListObjects returns a sorted list of objects that match the given criteria, @@ -365,6 +374,9 @@ func (s *Server) ListObjectsWithOptions(bucketName string, options ListOptions) respPrefixes = append(respPrefixes, p) } sort.Strings(respPrefixes) + if options.MaxResults != 0 && len(respObjects) > options.MaxResults { + respObjects = respObjects[:options.MaxResults] + } return respObjects, respPrefixes, nil } @@ -394,9 +406,11 @@ func toBackendObjects(objects []StreamingObject) []backend.StreamingObject { ObjectAttrs: backend.ObjectAttrs{ BucketName: o.BucketName, Name: o.Name, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, CacheControl: o.CacheControl, ACL: o.ACL, Created: getCurrentIfZero(o.Created).Format(timestampFormat), @@ -420,9 +434,11 @@ func bufferedObjectsToBackendObjects(objects []Object) []backend.StreamingObject ObjectAttrs: backend.ObjectAttrs{ BucketName: o.BucketName, Name: o.Name, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, ACL: o.ACL, Created: getCurrentIfZero(o.Created).Format(timestampFormat), Deleted: o.Deleted.Format(timestampFormat), @@ -449,9 +465,11 @@ func fromBackendObjects(objects []backend.StreamingObject) []StreamingObject { BucketName: o.BucketName, Name: o.Name, Size: o.Size, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, CacheControl: o.CacheControl, Crc32c: o.Crc32c, Md5Hash: o.Md5Hash, @@ -477,9 +495,11 @@ func fromBackendObjectsAttrs(objectAttrs []backend.ObjectAttrs) []ObjectAttrs { BucketName: o.BucketName, Name: o.Name, Size: o.Size, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, CacheControl: o.CacheControl, Crc32c: o.Crc32c, Md5Hash: o.Md5Hash, @@ -557,6 +577,14 @@ func (s *Server) objectWithGenerationOnValidGeneration(bucketName, objectName, g func (s *Server) listObjects(r *http.Request) jsonResponse { bucketName := unescapeMuxVars(mux.Vars(r))["bucketName"] + var maxResults int + var err error + if maxResultsStr := r.URL.Query().Get("maxResults"); maxResultsStr != "" { + maxResults, err = strconv.Atoi(maxResultsStr) + if err != nil { + return jsonResponse{status: http.StatusBadRequest} + } + } objs, prefixes, err := s.ListObjectsWithOptions(bucketName, ListOptions{ Prefix: r.URL.Query().Get("prefix"), Delimiter: r.URL.Query().Get("delimiter"), @@ -564,6 +592,7 @@ func (s *Server) listObjects(r *http.Request) jsonResponse { StartOffset: r.URL.Query().Get("startOffset"), EndOffset: r.URL.Query().Get("endOffset"), IncludeTrailingDelimiter: r.URL.Query().Get("includeTrailingDelimiter") == "true", + MaxResults: maxResults, }) if err != nil { return jsonResponse{status: http.StatusNotFound} @@ -710,6 +739,59 @@ func (s *Server) listObjectACL(r *http.Request) jsonResponse { return jsonResponse{data: newACLListResponse(obj.ObjectAttrs)} } +func (s *Server) deleteObjectACL(r *http.Request) jsonResponse { + vars := unescapeMuxVars(mux.Vars(r)) + + obj, err := s.GetObjectStreaming(vars["bucketName"], vars["objectName"]) + if err != nil { + return jsonResponse{status: http.StatusNotFound} + } + defer obj.Close() + entity := vars["entity"] + + var newAcls []storage.ACLRule + for _, aclRule := range obj.ObjectAttrs.ACL { + if entity != string(aclRule.Entity) { + newAcls = append(newAcls, aclRule) + } + } + + obj.ACL = newAcls + obj, err = s.createObject(obj, backend.NoConditions{}) + if err != nil { + return errToJsonResponse(err) + } + defer obj.Close() + + return jsonResponse{status: http.StatusOK} +} + +func (s *Server) getObjectACL(r *http.Request) jsonResponse { + vars := unescapeMuxVars(mux.Vars(r)) + + obj, err := s.backend.GetObject(vars["bucketName"], vars["objectName"]) + if err != nil { + return jsonResponse{status: http.StatusNotFound} + } + defer obj.Close() + entity := vars["entity"] + + for _, aclRule := range obj.ObjectAttrs.ACL { + if entity == string(aclRule.Entity) { + oac := &objectAccessControl{ + Bucket: obj.BucketName, + Entity: string(aclRule.Entity), + Object: obj.Name, + Role: string(aclRule.Role), + Etag: "RVRhZw==", + Kind: "storage#objectAccessControl", + } + return jsonResponse{data: oac} + } + } + return jsonResponse{status: http.StatusNotFound} +} + func (s *Server) setObjectACL(r *http.Request) jsonResponse { vars := unescapeMuxVars(mux.Vars(r)) @@ -783,6 +865,9 @@ func (s *Server) rewriteObject(r *http.Request) jsonResponse { if metadata.ContentDisposition == "" { metadata.ContentDisposition = obj.ContentDisposition } + if metadata.ContentLanguage == "" { + metadata.ContentLanguage = obj.ContentLanguage + } dstBucket := vars["destinationBucket"] newObject := StreamingObject{ @@ -793,6 +878,7 @@ func (s *Server) rewriteObject(r *http.Request) jsonResponse { ContentType: metadata.ContentType, ContentEncoding: metadata.ContentEncoding, ContentDisposition: metadata.ContentDisposition, + ContentLanguage: metadata.ContentLanguage, Metadata: metadata.Metadata, }, Content: obj.Content, @@ -912,6 +998,9 @@ func (s *Server) downloadObject(w http.ResponseWriter, r *http.Request) { if obj.ContentDisposition != "" { w.Header().Set("Content-Disposition", obj.ContentDisposition) } + if obj.ContentLanguage != "" { + w.Header().Set("Content-Language", obj.ContentLanguage) + } // X-Goog-Stored-Content-Encoding must be set to the original encoding, // defaulting to "identity" if no encoding was set. storedContentEncoding := "identity" @@ -943,7 +1032,7 @@ func (s *Server) handleRange(obj StreamingObject, r *http.Request) (ranged bool, // Length: 40, Range: bytes=50- case start >= obj.Size: // This IS a ranged request, but it ISN'T satisfiable. - return true, 0, 0, false + return true, 0, -1, false // Negative range, ignore range and return all content. // Examples: // Length: 40, Range: bytes=30-20 @@ -1037,6 +1126,7 @@ func (s *Server) patchObject(r *http.Request) jsonResponse { ContentType string ContentEncoding string ContentDisposition string + ContentLanguage string Metadata map[string]string `json:"metadata"` CustomTime string Acl []acls @@ -1054,6 +1144,7 @@ func (s *Server) patchObject(r *http.Request) jsonResponse { attrsToUpdate.ContentType = payload.ContentType attrsToUpdate.ContentEncoding = payload.ContentEncoding attrsToUpdate.ContentDisposition = payload.ContentDisposition + attrsToUpdate.ContentLanguage = payload.ContentLanguage attrsToUpdate.Metadata = payload.Metadata attrsToUpdate.CustomTime = payload.CustomTime @@ -1092,6 +1183,7 @@ func (s *Server) updateObject(r *http.Request) jsonResponse { Metadata map[string]string `json:"metadata"` ContentType string `json:"contentType"` ContentDisposition string `json:"contentDisposition"` + ContentLanguage string `json:"contentLanguage"` CustomTime string Acl []acls } @@ -1109,6 +1201,7 @@ func (s *Server) updateObject(r *http.Request) jsonResponse { attrsToUpdate.CustomTime = payload.CustomTime attrsToUpdate.ContentType = payload.ContentType attrsToUpdate.ContentDisposition = payload.ContentDisposition + attrsToUpdate.ContentLanguage = payload.ContentLanguage if len(payload.Acl) > 0 { attrsToUpdate.ACL = []storage.ACLRule{} for _, aclData := range payload.Acl { @@ -1142,6 +1235,7 @@ func (s *Server) composeObject(r *http.Request) jsonResponse { Bucket string ContentType string ContentDisposition string + ContentLanguage string Metadata map[string]string } } @@ -1168,7 +1262,7 @@ func (s *Server) composeObject(r *http.Request) jsonResponse { sourceNames = append(sourceNames, n.Name) } - backendObj, err := s.backend.ComposeObject(bucketName, sourceNames, destinationObject, composeRequest.Destination.Metadata, composeRequest.Destination.ContentType) + backendObj, err := s.backend.ComposeObject(bucketName, sourceNames, destinationObject, composeRequest.Destination.Metadata, composeRequest.Destination.ContentType, composeRequest.Destination.ContentDisposition, composeRequest.Destination.ContentLanguage) if err != nil { return jsonResponse{ status: http.StatusInternalServerError, diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/response.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/response.go index f40dcd3fe9dd7..8957af37fa5ac 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/response.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/response.go @@ -119,6 +119,7 @@ type objectResponse struct { ContentType string `json:"contentType,omitempty"` ContentEncoding string `json:"contentEncoding,omitempty"` ContentDisposition string `json:"contentDisposition,omitempty"` + ContentLanguage string `json:"contentLanguage,omitempty"` Crc32c string `json:"crc32c,omitempty"` ACL []*objectAccessControl `json:"acl,omitempty"` Md5Hash string `json:"md5Hash,omitempty"` @@ -146,6 +147,10 @@ func newProjectedObjectResponse(obj ObjectAttrs, externalURL string, projection func newObjectResponse(obj ObjectAttrs, externalURL string) objectResponse { acl := getAccessControlsListFromObject(obj) + storageClass := obj.StorageClass + if storageClass == "" { + storageClass = "STANDARD" + } return objectResponse{ Kind: "storage#object", @@ -156,11 +161,12 @@ func newObjectResponse(obj ObjectAttrs, externalURL string) objectResponse { ContentType: obj.ContentType, ContentEncoding: obj.ContentEncoding, ContentDisposition: obj.ContentDisposition, + ContentLanguage: obj.ContentLanguage, Crc32c: obj.Crc32c, Md5Hash: obj.Md5Hash, Etag: obj.Etag, ACL: acl, - StorageClass: "STANDARD", + StorageClass: storageClass, Metadata: obj.Metadata, TimeCreated: formatTime(obj.Created), TimeDeleted: formatTime(obj.Deleted), diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/server.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/server.go index 4283ccf030dc0..e64e58586acb4 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/server.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/server.go @@ -267,12 +267,16 @@ func (s *Server) buildMuxer() { r.Path("/b/").Methods(http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.createBucketByPost)) r.Path("/b/{bucketName}").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.getBucket)) r.Path("/b/{bucketName}").Methods(http.MethodPatch).HandlerFunc(jsonToHTTPHandler(s.updateBucket)) + r.Path("/b/{bucketName}").Methods(http.MethodPost).Headers("X-HTTP-Method-Override", "PATCH").HandlerFunc(jsonToHTTPHandler(s.updateBucket)) r.Path("/b/{bucketName}").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteBucket)) r.Path("/b/{bucketName}/o").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.listObjects)) r.Path("/b/{bucketName}/o/").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.listObjects)) r.Path("/b/{bucketName}/o/{objectName:.+}").Methods(http.MethodPatch).HandlerFunc(jsonToHTTPHandler(s.patchObject)) + r.Path("/b/{bucketName}/o/{objectName:.+}").Methods(http.MethodPost).Headers("X-HTTP-Method-Override", "PATCH").HandlerFunc(jsonToHTTPHandler(s.patchObject)) r.Path("/b/{bucketName}/o/{objectName:.+}/acl").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.listObjectACL)) r.Path("/b/{bucketName}/o/{objectName:.+}/acl").Methods(http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.setObjectACL)) + r.Path("/b/{bucketName}/o/{objectName:.+}/acl/{entity}").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteObjectACL)) + r.Path("/b/{bucketName}/o/{objectName:.+}/acl/{entity}").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.getObjectACL)) r.Path("/b/{bucketName}/o/{objectName:.+}/acl/{entity}").Methods(http.MethodPut).HandlerFunc(jsonToHTTPHandler(s.setObjectACL)) r.Path("/b/{bucketName}/o/{objectName:.+}").Methods(http.MethodGet, http.MethodHead).HandlerFunc(s.getObject) r.Path("/b/{bucketName}/o/{objectName:.+}").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteObject)) @@ -285,6 +289,7 @@ func (s *Server) buildMuxer() { handler.Path("/_internal/config").Methods(http.MethodPut).HandlerFunc(jsonToHTTPHandler(s.updateServerConfig)) handler.MatcherFunc(s.publicHostMatcher).Path("/_internal/config").Methods(http.MethodPut).HandlerFunc(jsonToHTTPHandler(s.updateServerConfig)) handler.Path("/_internal/reseed").Methods(http.MethodPut, http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.reseedServer)) + handler.Path("/_internal/delete_all").Methods(http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.deleteAllFiles)) // Internal - end // XML API @@ -304,6 +309,8 @@ func (s *Server) buildMuxer() { handler.Path("/upload/storage/v1/b/{bucketName}/o/").Methods(http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.insertObject)) handler.Path("/upload/storage/v1/b/{bucketName}/o").Methods(http.MethodPut).HandlerFunc(jsonToHTTPHandler(s.uploadFileContent)) handler.Path("/upload/storage/v1/b/{bucketName}/o/").Methods(http.MethodPut).HandlerFunc(jsonToHTTPHandler(s.uploadFileContent)) + handler.Path("/upload/storage/v1/b/{bucketName}/o").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteResumableUpload)) + handler.Path("/upload/storage/v1/b/{bucketName}/o/").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteResumableUpload)) handler.Path("/upload/resumable/{uploadId}").Methods(http.MethodPut, http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.uploadFileContent)) // Batch endpoint @@ -361,6 +368,20 @@ func (s *Server) reseedServer(r *http.Request) jsonResponse { return jsonResponse{data: fromBackendObjects(backendObjects)} } +func (s *Server) deleteAllFiles(r *http.Request) jsonResponse { + if err := s.backend.DeleteAllFiles(); err != nil { + return jsonResponse{ + status: http.StatusInternalServerError, + errorMessage: err.Error(), + } + } + + return jsonResponse{ + status: http.StatusOK, + data: map[string]string{"message": "All files deleted successfully"}, + } +} + func generateObjectsFromFiles(folder string) ([]Object, []string) { var objects []Object var emptyBuckets []string diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/upload.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/upload.go index e9181df46f47a..1438068f98c33 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/upload.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/upload.go @@ -54,9 +54,11 @@ type multipartMetadata struct { ContentType string `json:"contentType"` ContentEncoding string `json:"contentEncoding"` ContentDisposition string `json:"contentDisposition"` + ContentLanguage string `json:"ContentLanguage"` CacheControl string `json:"cacheControl"` CustomTime time.Time `json:"customTime,omitempty"` Name string `json:"name"` + StorageClass string `json:"storageClass"` Metadata map[string]string `json:"metadata"` } @@ -378,10 +380,12 @@ func (s *Server) multipartUpload(bucketName string, r *http.Request) jsonRespons ObjectAttrs: ObjectAttrs{ BucketName: bucketName, Name: objName, + StorageClass: metadata.StorageClass, ContentType: contentType, CacheControl: metadata.CacheControl, ContentEncoding: metadata.ContentEncoding, ContentDisposition: metadata.ContentDisposition, + ContentLanguage: metadata.ContentLanguage, CustomTime: metadata.CustomTime, ACL: getObjectACL(predefinedACL), Metadata: metadata.Metadata, @@ -630,6 +634,10 @@ func parseContentRange(r string) (parsed contentRange, err error) { return parsed, nil } +func (s *Server) deleteResumableUpload(r *http.Request) jsonResponse { + return jsonResponse{status: 499} +} + func loadMetadata(rc io.ReadCloser) (*multipartMetadata, error) { defer rc.Close() var m multipartMetadata diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/fs.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/fs.go index c96867d802df6..d915ac1b7a5b6 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/fs.go +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/fs.go @@ -253,6 +253,9 @@ func (s *storageFS) CreateObject(obj StreamingObject, conditions Conditions) (St if obj.Etag == "" { obj.Etag = obj.Md5Hash } + if obj.StorageClass == "" { + obj.StorageClass = "STANDARD" + } // TODO: Handle if metadata is not present more gracefully? encoded, err := json.Marshal(obj.ObjectAttrs) @@ -437,7 +440,7 @@ func concatObjectReaders(objects []StreamingObject) io.ReadSeekCloser { return concatenatedContent{io.MultiReader(readers...)} } -func (s *storageFS) ComposeObject(bucketName string, objectNames []string, destinationName string, metadata map[string]string, contentType string) (StreamingObject, error) { +func (s *storageFS) ComposeObject(bucketName string, objectNames []string, destinationName string, metadata map[string]string, contentType string, contentDisposition string, contentLanguage string) (StreamingObject, error) { var sourceObjects []StreamingObject for _, n := range objectNames { obj, err := s.GetObject(bucketName, n) @@ -448,12 +451,16 @@ func (s *storageFS) ComposeObject(bucketName string, objectNames []string, desti sourceObjects = append(sourceObjects, obj) } + now := time.Now().Format(timestampFormat) dest := StreamingObject{ ObjectAttrs: ObjectAttrs{ - BucketName: bucketName, - Name: destinationName, - ContentType: contentType, - Created: time.Now().String(), + BucketName: bucketName, + Name: destinationName, + ContentType: contentType, + ContentDisposition: contentDisposition, + ContentLanguage: contentLanguage, + Created: now, + Updated: now, }, } @@ -467,3 +474,12 @@ func (s *storageFS) ComposeObject(bucketName string, objectNames []string, desti return result, nil } + +func (s *storageFS) DeleteAllFiles() error { + s.mtx.Lock() + defer s.mtx.Unlock() + if err := os.RemoveAll(s.rootDir); err != nil { + return err + } + return os.MkdirAll(s.rootDir, 0o700) +} diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/memory.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/memory.go index c32f06abf2cd4..fa54d9101c09f 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/memory.go +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/memory.go @@ -49,6 +49,9 @@ func (bm *bucketInMemory) addObject(obj Object) Object { if obj.Size == 0 { obj.Size = int64(len(obj.Content)) } + if obj.StorageClass == "" { + obj.StorageClass = "STANDARD" + } obj.Generation = getNewGenerationIfZero(obj.Generation) index := findObject(obj, bm.activeObjects, false) if index >= 0 { @@ -344,7 +347,7 @@ func (s *storageMemory) UpdateObject(bucketName, objectName string, attrsToUpdat return obj, nil } -func (s *storageMemory) ComposeObject(bucketName string, objectNames []string, destinationName string, metadata map[string]string, contentType string) (StreamingObject, error) { +func (s *storageMemory) ComposeObject(bucketName string, objectNames []string, destinationName string, metadata map[string]string, contentType string, contentDisposition string, contentLanguage string) (StreamingObject, error) { var data []byte for _, n := range objectNames { obj, err := s.GetObject(bucketName, n) @@ -361,12 +364,16 @@ func (s *storageMemory) ComposeObject(bucketName string, objectNames []string, d var dest Object streamingDest, err := s.GetObject(bucketName, destinationName) if err != nil { + now := time.Now().Format(timestampFormat) dest = Object{ ObjectAttrs: ObjectAttrs{ - BucketName: bucketName, - Name: destinationName, - ContentType: contentType, - Created: time.Now().String(), + BucketName: bucketName, + Name: destinationName, + ContentType: contentType, + ContentDisposition: contentDisposition, + ContentLanguage: contentLanguage, + Created: now, + Updated: now, }, } } else { @@ -390,3 +397,10 @@ func (s *storageMemory) ComposeObject(bucketName string, objectNames []string, d return result, nil } + +func (s *storageMemory) DeleteAllFiles() error { + s.mtx.Lock() + defer s.mtx.Unlock() + s.buckets = make(map[string]bucketInMemory) + return nil +} diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/object.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/object.go index 63bf8d6d147c3..aa2379c4e8dc7 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/object.go +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/object.go @@ -18,9 +18,11 @@ type ObjectAttrs struct { BucketName string `json:"-"` Name string `json:"-"` Size int64 `json:"-"` + StorageClass string ContentType string ContentEncoding string ContentDisposition string + ContentLanguage string CacheControl string Crc32c string Md5Hash string diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/storage.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/storage.go index da8e8e51e2128..c428fcc8d27b1 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/storage.go +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/storage.go @@ -30,7 +30,8 @@ type Storage interface { DeleteObject(bucketName, objectName string) error PatchObject(bucketName, objectName string, attrsToUpdate ObjectAttrs) (StreamingObject, error) UpdateObject(bucketName, objectName string, attrsToUpdate ObjectAttrs) (StreamingObject, error) - ComposeObject(bucketName string, objectNames []string, destinationName string, metadata map[string]string, contentType string) (StreamingObject, error) + ComposeObject(bucketName string, objectNames []string, destinationName string, metadata map[string]string, contentType string, contentDisposition string, contentLanguage string) (StreamingObject, error) + DeleteAllFiles() error } type Error string diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/time_openbsd.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/time_openbsd.go new file mode 100644 index 0000000000000..15076c2d7dae2 --- /dev/null +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/time_openbsd.go @@ -0,0 +1,15 @@ +//go:build openbsd + +package backend + +import ( + "os" + "syscall" +) + +func createTimeFromFileInfo(input os.FileInfo) syscall.Timespec { + if statT, ok := input.Sys().(*syscall.Stat_t); ok { + return statT.Ctim + } + return syscall.Timespec{} +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile.go b/vendor/github.com/goccy/go-json/internal/decoder/compile.go index fab6437647bb5..8ad50936c0c44 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile.go @@ -5,6 +5,7 @@ import ( "fmt" "reflect" "strings" + "sync" "sync/atomic" "unicode" "unsafe" @@ -17,22 +18,27 @@ var ( typeAddr *runtime.TypeAddr cachedDecoderMap unsafe.Pointer // map[uintptr]decoder cachedDecoder []Decoder + initOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) +func initDecoder() { + initOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadDecoderMap() map[uintptr]Decoder { + initDecoder() p := atomic.LoadPointer(&cachedDecoderMap) return *(*map[uintptr]Decoder)(unsafe.Pointer(&p)) } func storeDecoder(typ uintptr, dec Decoder, m map[uintptr]Decoder) { + initDecoder() newDecoderMap := make(map[uintptr]Decoder, len(m)+1) newDecoderMap[typ] = dec diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go index eb7e2b1345d7f..025ca85b5e22b 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go @@ -10,6 +10,7 @@ import ( ) func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go index 49cdda4a172f2..023b817c3681b 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go @@ -13,6 +13,7 @@ import ( var decMu sync.RWMutex func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go index 37b7aa38e26a1..b107636890af4 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go @@ -5,6 +5,7 @@ import ( "encoding" "encoding/json" "reflect" + "sync" "sync/atomic" "unsafe" @@ -24,14 +25,17 @@ var ( cachedOpcodeSets []*OpcodeSet cachedOpcodeMap unsafe.Pointer // map[uintptr]*OpcodeSet typeAddr *runtime.TypeAddr + initEncoderOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) +func initEncoder() { + initEncoderOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadOpcodeMap() map[uintptr]*OpcodeSet { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go index 20c93cbf70988..b6f45a49b0e78 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go @@ -4,6 +4,7 @@ package encoder func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go index 13ba23fdff8e5..47b482f7fb664 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go @@ -10,6 +10,7 @@ import ( var setsMu sync.RWMutex func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go index 14eb6a0d643b9..b436f5b21ffed 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go @@ -406,6 +406,11 @@ func AppendMarshalJSON(ctx *RuntimeContext, code *Opcode, b []byte, v interface{ rv = newV } } + + if rv.Kind() == reflect.Ptr && rv.IsNil() { + return AppendNull(ctx, b), nil + } + v = rv.Interface() var bb []byte if (code.Flags & MarshalerContextFlags) != 0 { diff --git a/vendor/github.com/googleapis/gax-go/v2/.release-please-manifest.json b/vendor/github.com/googleapis/gax-go/v2/.release-please-manifest.json index 29a5900c7da8a..a8c082dd61eb3 100644 --- a/vendor/github.com/googleapis/gax-go/v2/.release-please-manifest.json +++ b/vendor/github.com/googleapis/gax-go/v2/.release-please-manifest.json @@ -1,3 +1,3 @@ { - "v2": "2.14.0" + "v2": "2.14.1" } diff --git a/vendor/github.com/googleapis/gax-go/v2/CHANGES.md b/vendor/github.com/googleapis/gax-go/v2/CHANGES.md index 9fb9035908de5..17cced15eca61 100644 --- a/vendor/github.com/googleapis/gax-go/v2/CHANGES.md +++ b/vendor/github.com/googleapis/gax-go/v2/CHANGES.md @@ -1,5 +1,17 @@ # Changelog +## [2.14.1](https://github.com/googleapis/gax-go/compare/v2.14.0...v2.14.1) (2024-12-19) + + +### Bug Fixes + +* update golang.org/x/net to v0.33.0 ([#391](https://github.com/googleapis/gax-go/issues/391)) ([547a5b4](https://github.com/googleapis/gax-go/commit/547a5b43aa6f376f71242da9f18e65fbdfb342f6)) + + +### Documentation + +* fix godoc to refer to the proper envvar ([#387](https://github.com/googleapis/gax-go/issues/387)) ([dc6baf7](https://github.com/googleapis/gax-go/commit/dc6baf75c1a737233739630b5af6c9759f08abcd)) + ## [2.14.0](https://github.com/googleapis/gax-go/compare/v2.13.0...v2.14.0) (2024-11-13) diff --git a/vendor/github.com/googleapis/gax-go/v2/internal/version.go b/vendor/github.com/googleapis/gax-go/v2/internal/version.go index 8828893454926..2b284a24a482b 100644 --- a/vendor/github.com/googleapis/gax-go/v2/internal/version.go +++ b/vendor/github.com/googleapis/gax-go/v2/internal/version.go @@ -30,4 +30,4 @@ package internal // Version is the current tagged release of the library. -const Version = "2.14.0" +const Version = "2.14.1" diff --git a/vendor/github.com/googleapis/gax-go/v2/internallog/internallog.go b/vendor/github.com/googleapis/gax-go/v2/internallog/internallog.go index 91b648a6a4c72..e47ab32acc29d 100644 --- a/vendor/github.com/googleapis/gax-go/v2/internallog/internallog.go +++ b/vendor/github.com/googleapis/gax-go/v2/internallog/internallog.go @@ -44,7 +44,7 @@ import ( // New returns a new [slog.Logger] default logger, or the provided logger if // non-nil. The returned logger will be a no-op logger unless the environment -// variable GOOGLE_SDK_DEBUG_LOGGING is set. +// variable GOOGLE_SDK_GO_LOGGING_LEVEL is set. func New(l *slog.Logger) *slog.Logger { if l != nil { return l diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 21508edbdb3c8..f06ba51c56b7d 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -281,6 +281,7 @@ Exit Code 1 | AMXBF16 | Tile computational operations on BFLOAT16 numbers | | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | +| AMXFP8 | Tile computational operations on FP8 numbers | | AMXTILE | Tile architecture | | APX_F | Intel APX | | AVX | AVX functions | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 53bc18ca71959..db99eb62f7b08 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -55,6 +55,12 @@ const ( Qualcomm Marvell + QEMU + QNX + ACRN + SRE + Apple + lastVendor ) @@ -75,6 +81,7 @@ const ( AMXBF16 // Tile computational operations on BFLOAT16 numbers AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers + AMXFP8 // Tile computational operations on FP8 numbers AMXTILE // Tile architecture APX_F // Intel APX AVX // AVX functions @@ -296,20 +303,22 @@ const ( // CPUInfo contains information about the detected system CPU. type CPUInfo struct { - BrandName string // Brand name reported by the CPU - VendorID Vendor // Comparable CPU vendor ID - VendorString string // Raw vendor string. - featureSet flagSet // Features of the CPU - PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. - ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. - LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. - Family int // CPU family number - Model int // CPU model number - Stepping int // CPU stepping info - CacheLine int // Cache line size in bytes. Will be 0 if undetectable. - Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. - BoostFreq int64 // Max clock speed, if known, 0 otherwise - Cache struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + HypervisorVendorID Vendor // Hypervisor vendor + HypervisorVendorString string // Raw hypervisor vendor string + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected L2 int // L2 Cache (per core or shared). Will be -1 if undetected @@ -318,8 +327,9 @@ type CPUInfo struct { SGX SGXSupport AMDMemEncryption AMDMemEncryptionSupport AVX10Level uint8 - maxFunc uint32 - maxExFunc uint32 + + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -503,7 +513,7 @@ func (c CPUInfo) FeatureSet() []string { // Uses the RDTSCP instruction. The value 0 is returned // if the CPU does not support the instruction. func (c CPUInfo) RTCounter() uint64 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } a, _, _, d := rdtscpAsm() @@ -515,13 +525,22 @@ func (c CPUInfo) RTCounter() uint64 { // about the current cpu/core the code is running on. // If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. func (c CPUInfo) Ia32TscAux() uint32 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } _, _, ecx, _ := rdtscpAsm() return ecx } +// SveLengths returns arm SVE vector and predicate lengths. +// Will return 0, 0 if SVE is not enabled or otherwise unable to detect. +func (c CPUInfo) SveLengths() (vl, pl uint64) { + if !c.Has(SVE) { + return 0, 0 + } + return getVectorLength() +} + // LogicalCPU will return the Logical CPU the code is currently executing on. // This is likely to change when the OS re-schedules the running thread // to another CPU. @@ -781,11 +800,16 @@ func threadsPerCore() int { _, b, _, _ := cpuidex(0xb, 0) if b&0xffff == 0 { if vend == AMD { - // Workaround for AMD returning 0, assume 2 if >= Zen 2 - // It will be more correct than not. + // if >= Zen 2 0x8000001e EBX 15-8 bits means threads per core. + // The number of threads per core is ThreadsPerCore+1 + // See PPR for AMD Family 17h Models 00h-0Fh (page 82) fam, _, _ := familyModel() _, _, _, d := cpuid(1) if (d&(1<<28)) != 0 && fam >= 23 { + if maxExtendedFunction() >= 0x8000001e { + _, b, _, _ := cpuid(0x8000001e) + return int((b>>8)&0xff) + 1 + } return 2 } } @@ -877,7 +901,9 @@ var vendorMapping = map[string]Vendor{ "GenuineTMx86": Transmeta, "Geode by NSC": NSC, "VIA VIA VIA ": VIA, - "KVMKVMKVMKVM": KVM, + "KVMKVMKVM": KVM, + "Linux KVM Hv": KVM, + "TCGTCGTCGTCG": QEMU, "Microsoft Hv": MSVM, "VMwareVMware": VMware, "XenVMMXenVMM": XenHVM, @@ -887,6 +913,10 @@ var vendorMapping = map[string]Vendor{ "SiS SiS SiS ": SiS, "RiseRiseRise": SiS, "Genuine RDC": RDC, + "QNXQVMBSQG": QNX, + "ACRNACRNACRN": ACRN, + "SRESRESRESRE": SRE, + "Apple VZ": Apple, } func vendorID() (Vendor, string) { @@ -899,6 +929,17 @@ func vendorID() (Vendor, string) { return vend, v } +func hypervisorVendorID() (Vendor, string) { + // https://lwn.net/Articles/301888/ + _, b, c, d := cpuid(0x40000000) + v := string(valAsString(b, c, d)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + func cacheLine() int { if maxFunctionID() < 0x1 { return 0 @@ -1271,6 +1312,7 @@ func support() flagSet { fs.setIf(ebx&(1<<31) != 0, AVX512VL) // ecx fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<3) != 0, AMXFP8) fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s index b31d6aec43f61..b196f78eb447f 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -24,3 +24,13 @@ TEXT ·getInstAttributes(SB), 7, $0 MOVD R1, instAttrReg1+8(FP) RET +TEXT ·getVectorLength(SB), 7, $0 + WORD $0xd2800002 // mov x2, #0 + WORD $0x04225022 // addvl x2, x2, #1 + WORD $0xd37df042 // lsl x2, x2, #3 + WORD $0xd2800003 // mov x3, #0 + WORD $0x04635023 // addpl x3, x3, #1 + WORD $0xd37df063 // lsl x3, x3, #3 + MOVD R2, vl+0(FP) + MOVD R3, pl+8(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go index 9a53504a042df..566743d2204b8 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -10,6 +10,7 @@ import "runtime" func getMidr() (midr uint64) func getProcFeatures() (procFeatures uint64) func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) +func getVectorLength() (vl, pl uint64) func initCPU() { cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } @@ -24,7 +25,7 @@ func addInfo(c *CPUInfo, safe bool) { detectOS(c) // ARM64 disabled since it may crash if interrupt is not intercepted by OS. - if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" { + if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" { return } midr := getMidr() diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go index 9636c2bc17c63..574f9389c07e4 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -10,6 +10,8 @@ func initCPU() { cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } xgetbv = func(uint32) (a, b uint32) { return 0, 0 } rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } + } func addInfo(info *CPUInfo, safe bool) {} +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 799b400c2ecee..f924c9d8399ab 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -32,7 +32,10 @@ func addInfo(c *CPUInfo, safe bool) { c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID() c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } + +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 3a25603103992..e7f874a7e8d24 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -15,224 +15,225 @@ func _() { _ = x[AMXBF16-5] _ = x[AMXFP16-6] _ = x[AMXINT8-7] - _ = x[AMXTILE-8] - _ = x[APX_F-9] - _ = x[AVX-10] - _ = x[AVX10-11] - _ = x[AVX10_128-12] - _ = x[AVX10_256-13] - _ = x[AVX10_512-14] - _ = x[AVX2-15] - _ = x[AVX512BF16-16] - _ = x[AVX512BITALG-17] - _ = x[AVX512BW-18] - _ = x[AVX512CD-19] - _ = x[AVX512DQ-20] - _ = x[AVX512ER-21] - _ = x[AVX512F-22] - _ = x[AVX512FP16-23] - _ = x[AVX512IFMA-24] - _ = x[AVX512PF-25] - _ = x[AVX512VBMI-26] - _ = x[AVX512VBMI2-27] - _ = x[AVX512VL-28] - _ = x[AVX512VNNI-29] - _ = x[AVX512VP2INTERSECT-30] - _ = x[AVX512VPOPCNTDQ-31] - _ = x[AVXIFMA-32] - _ = x[AVXNECONVERT-33] - _ = x[AVXSLOW-34] - _ = x[AVXVNNI-35] - _ = x[AVXVNNIINT8-36] - _ = x[AVXVNNIINT16-37] - _ = x[BHI_CTRL-38] - _ = x[BMI1-39] - _ = x[BMI2-40] - _ = x[CETIBT-41] - _ = x[CETSS-42] - _ = x[CLDEMOTE-43] - _ = x[CLMUL-44] - _ = x[CLZERO-45] - _ = x[CMOV-46] - _ = x[CMPCCXADD-47] - _ = x[CMPSB_SCADBS_SHORT-48] - _ = x[CMPXCHG8-49] - _ = x[CPBOOST-50] - _ = x[CPPC-51] - _ = x[CX16-52] - _ = x[EFER_LMSLE_UNS-53] - _ = x[ENQCMD-54] - _ = x[ERMS-55] - _ = x[F16C-56] - _ = x[FLUSH_L1D-57] - _ = x[FMA3-58] - _ = x[FMA4-59] - _ = x[FP128-60] - _ = x[FP256-61] - _ = x[FSRM-62] - _ = x[FXSR-63] - _ = x[FXSROPT-64] - _ = x[GFNI-65] - _ = x[HLE-66] - _ = x[HRESET-67] - _ = x[HTT-68] - _ = x[HWA-69] - _ = x[HYBRID_CPU-70] - _ = x[HYPERVISOR-71] - _ = x[IA32_ARCH_CAP-72] - _ = x[IA32_CORE_CAP-73] - _ = x[IBPB-74] - _ = x[IBPB_BRTYPE-75] - _ = x[IBRS-76] - _ = x[IBRS_PREFERRED-77] - _ = x[IBRS_PROVIDES_SMP-78] - _ = x[IBS-79] - _ = x[IBSBRNTRGT-80] - _ = x[IBSFETCHSAM-81] - _ = x[IBSFFV-82] - _ = x[IBSOPCNT-83] - _ = x[IBSOPCNTEXT-84] - _ = x[IBSOPSAM-85] - _ = x[IBSRDWROPCNT-86] - _ = x[IBSRIPINVALIDCHK-87] - _ = x[IBS_FETCH_CTLX-88] - _ = x[IBS_OPDATA4-89] - _ = x[IBS_OPFUSE-90] - _ = x[IBS_PREVENTHOST-91] - _ = x[IBS_ZEN4-92] - _ = x[IDPRED_CTRL-93] - _ = x[INT_WBINVD-94] - _ = x[INVLPGB-95] - _ = x[KEYLOCKER-96] - _ = x[KEYLOCKERW-97] - _ = x[LAHF-98] - _ = x[LAM-99] - _ = x[LBRVIRT-100] - _ = x[LZCNT-101] - _ = x[MCAOVERFLOW-102] - _ = x[MCDT_NO-103] - _ = x[MCOMMIT-104] - _ = x[MD_CLEAR-105] - _ = x[MMX-106] - _ = x[MMXEXT-107] - _ = x[MOVBE-108] - _ = x[MOVDIR64B-109] - _ = x[MOVDIRI-110] - _ = x[MOVSB_ZL-111] - _ = x[MOVU-112] - _ = x[MPX-113] - _ = x[MSRIRC-114] - _ = x[MSRLIST-115] - _ = x[MSR_PAGEFLUSH-116] - _ = x[NRIPS-117] - _ = x[NX-118] - _ = x[OSXSAVE-119] - _ = x[PCONFIG-120] - _ = x[POPCNT-121] - _ = x[PPIN-122] - _ = x[PREFETCHI-123] - _ = x[PSFD-124] - _ = x[RDPRU-125] - _ = x[RDRAND-126] - _ = x[RDSEED-127] - _ = x[RDTSCP-128] - _ = x[RRSBA_CTRL-129] - _ = x[RTM-130] - _ = x[RTM_ALWAYS_ABORT-131] - _ = x[SBPB-132] - _ = x[SERIALIZE-133] - _ = x[SEV-134] - _ = x[SEV_64BIT-135] - _ = x[SEV_ALTERNATIVE-136] - _ = x[SEV_DEBUGSWAP-137] - _ = x[SEV_ES-138] - _ = x[SEV_RESTRICTED-139] - _ = x[SEV_SNP-140] - _ = x[SGX-141] - _ = x[SGXLC-142] - _ = x[SHA-143] - _ = x[SME-144] - _ = x[SME_COHERENT-145] - _ = x[SPEC_CTRL_SSBD-146] - _ = x[SRBDS_CTRL-147] - _ = x[SRSO_MSR_FIX-148] - _ = x[SRSO_NO-149] - _ = x[SRSO_USER_KERNEL_NO-150] - _ = x[SSE-151] - _ = x[SSE2-152] - _ = x[SSE3-153] - _ = x[SSE4-154] - _ = x[SSE42-155] - _ = x[SSE4A-156] - _ = x[SSSE3-157] - _ = x[STIBP-158] - _ = x[STIBP_ALWAYSON-159] - _ = x[STOSB_SHORT-160] - _ = x[SUCCOR-161] - _ = x[SVM-162] - _ = x[SVMDA-163] - _ = x[SVMFBASID-164] - _ = x[SVML-165] - _ = x[SVMNP-166] - _ = x[SVMPF-167] - _ = x[SVMPFT-168] - _ = x[SYSCALL-169] - _ = x[SYSEE-170] - _ = x[TBM-171] - _ = x[TDX_GUEST-172] - _ = x[TLB_FLUSH_NESTED-173] - _ = x[TME-174] - _ = x[TOPEXT-175] - _ = x[TSCRATEMSR-176] - _ = x[TSXLDTRK-177] - _ = x[VAES-178] - _ = x[VMCBCLEAN-179] - _ = x[VMPL-180] - _ = x[VMSA_REGPROT-181] - _ = x[VMX-182] - _ = x[VPCLMULQDQ-183] - _ = x[VTE-184] - _ = x[WAITPKG-185] - _ = x[WBNOINVD-186] - _ = x[WRMSRNS-187] - _ = x[X87-188] - _ = x[XGETBV1-189] - _ = x[XOP-190] - _ = x[XSAVE-191] - _ = x[XSAVEC-192] - _ = x[XSAVEOPT-193] - _ = x[XSAVES-194] - _ = x[AESARM-195] - _ = x[ARMCPUID-196] - _ = x[ASIMD-197] - _ = x[ASIMDDP-198] - _ = x[ASIMDHP-199] - _ = x[ASIMDRDM-200] - _ = x[ATOMICS-201] - _ = x[CRC32-202] - _ = x[DCPOP-203] - _ = x[EVTSTRM-204] - _ = x[FCMA-205] - _ = x[FP-206] - _ = x[FPHP-207] - _ = x[GPA-208] - _ = x[JSCVT-209] - _ = x[LRCPC-210] - _ = x[PMULL-211] - _ = x[SHA1-212] - _ = x[SHA2-213] - _ = x[SHA3-214] - _ = x[SHA512-215] - _ = x[SM3-216] - _ = x[SM4-217] - _ = x[SVE-218] - _ = x[lastID-219] + _ = x[AMXFP8-8] + _ = x[AMXTILE-9] + _ = x[APX_F-10] + _ = x[AVX-11] + _ = x[AVX10-12] + _ = x[AVX10_128-13] + _ = x[AVX10_256-14] + _ = x[AVX10_512-15] + _ = x[AVX2-16] + _ = x[AVX512BF16-17] + _ = x[AVX512BITALG-18] + _ = x[AVX512BW-19] + _ = x[AVX512CD-20] + _ = x[AVX512DQ-21] + _ = x[AVX512ER-22] + _ = x[AVX512F-23] + _ = x[AVX512FP16-24] + _ = x[AVX512IFMA-25] + _ = x[AVX512PF-26] + _ = x[AVX512VBMI-27] + _ = x[AVX512VBMI2-28] + _ = x[AVX512VL-29] + _ = x[AVX512VNNI-30] + _ = x[AVX512VP2INTERSECT-31] + _ = x[AVX512VPOPCNTDQ-32] + _ = x[AVXIFMA-33] + _ = x[AVXNECONVERT-34] + _ = x[AVXSLOW-35] + _ = x[AVXVNNI-36] + _ = x[AVXVNNIINT8-37] + _ = x[AVXVNNIINT16-38] + _ = x[BHI_CTRL-39] + _ = x[BMI1-40] + _ = x[BMI2-41] + _ = x[CETIBT-42] + _ = x[CETSS-43] + _ = x[CLDEMOTE-44] + _ = x[CLMUL-45] + _ = x[CLZERO-46] + _ = x[CMOV-47] + _ = x[CMPCCXADD-48] + _ = x[CMPSB_SCADBS_SHORT-49] + _ = x[CMPXCHG8-50] + _ = x[CPBOOST-51] + _ = x[CPPC-52] + _ = x[CX16-53] + _ = x[EFER_LMSLE_UNS-54] + _ = x[ENQCMD-55] + _ = x[ERMS-56] + _ = x[F16C-57] + _ = x[FLUSH_L1D-58] + _ = x[FMA3-59] + _ = x[FMA4-60] + _ = x[FP128-61] + _ = x[FP256-62] + _ = x[FSRM-63] + _ = x[FXSR-64] + _ = x[FXSROPT-65] + _ = x[GFNI-66] + _ = x[HLE-67] + _ = x[HRESET-68] + _ = x[HTT-69] + _ = x[HWA-70] + _ = x[HYBRID_CPU-71] + _ = x[HYPERVISOR-72] + _ = x[IA32_ARCH_CAP-73] + _ = x[IA32_CORE_CAP-74] + _ = x[IBPB-75] + _ = x[IBPB_BRTYPE-76] + _ = x[IBRS-77] + _ = x[IBRS_PREFERRED-78] + _ = x[IBRS_PROVIDES_SMP-79] + _ = x[IBS-80] + _ = x[IBSBRNTRGT-81] + _ = x[IBSFETCHSAM-82] + _ = x[IBSFFV-83] + _ = x[IBSOPCNT-84] + _ = x[IBSOPCNTEXT-85] + _ = x[IBSOPSAM-86] + _ = x[IBSRDWROPCNT-87] + _ = x[IBSRIPINVALIDCHK-88] + _ = x[IBS_FETCH_CTLX-89] + _ = x[IBS_OPDATA4-90] + _ = x[IBS_OPFUSE-91] + _ = x[IBS_PREVENTHOST-92] + _ = x[IBS_ZEN4-93] + _ = x[IDPRED_CTRL-94] + _ = x[INT_WBINVD-95] + _ = x[INVLPGB-96] + _ = x[KEYLOCKER-97] + _ = x[KEYLOCKERW-98] + _ = x[LAHF-99] + _ = x[LAM-100] + _ = x[LBRVIRT-101] + _ = x[LZCNT-102] + _ = x[MCAOVERFLOW-103] + _ = x[MCDT_NO-104] + _ = x[MCOMMIT-105] + _ = x[MD_CLEAR-106] + _ = x[MMX-107] + _ = x[MMXEXT-108] + _ = x[MOVBE-109] + _ = x[MOVDIR64B-110] + _ = x[MOVDIRI-111] + _ = x[MOVSB_ZL-112] + _ = x[MOVU-113] + _ = x[MPX-114] + _ = x[MSRIRC-115] + _ = x[MSRLIST-116] + _ = x[MSR_PAGEFLUSH-117] + _ = x[NRIPS-118] + _ = x[NX-119] + _ = x[OSXSAVE-120] + _ = x[PCONFIG-121] + _ = x[POPCNT-122] + _ = x[PPIN-123] + _ = x[PREFETCHI-124] + _ = x[PSFD-125] + _ = x[RDPRU-126] + _ = x[RDRAND-127] + _ = x[RDSEED-128] + _ = x[RDTSCP-129] + _ = x[RRSBA_CTRL-130] + _ = x[RTM-131] + _ = x[RTM_ALWAYS_ABORT-132] + _ = x[SBPB-133] + _ = x[SERIALIZE-134] + _ = x[SEV-135] + _ = x[SEV_64BIT-136] + _ = x[SEV_ALTERNATIVE-137] + _ = x[SEV_DEBUGSWAP-138] + _ = x[SEV_ES-139] + _ = x[SEV_RESTRICTED-140] + _ = x[SEV_SNP-141] + _ = x[SGX-142] + _ = x[SGXLC-143] + _ = x[SHA-144] + _ = x[SME-145] + _ = x[SME_COHERENT-146] + _ = x[SPEC_CTRL_SSBD-147] + _ = x[SRBDS_CTRL-148] + _ = x[SRSO_MSR_FIX-149] + _ = x[SRSO_NO-150] + _ = x[SRSO_USER_KERNEL_NO-151] + _ = x[SSE-152] + _ = x[SSE2-153] + _ = x[SSE3-154] + _ = x[SSE4-155] + _ = x[SSE42-156] + _ = x[SSE4A-157] + _ = x[SSSE3-158] + _ = x[STIBP-159] + _ = x[STIBP_ALWAYSON-160] + _ = x[STOSB_SHORT-161] + _ = x[SUCCOR-162] + _ = x[SVM-163] + _ = x[SVMDA-164] + _ = x[SVMFBASID-165] + _ = x[SVML-166] + _ = x[SVMNP-167] + _ = x[SVMPF-168] + _ = x[SVMPFT-169] + _ = x[SYSCALL-170] + _ = x[SYSEE-171] + _ = x[TBM-172] + _ = x[TDX_GUEST-173] + _ = x[TLB_FLUSH_NESTED-174] + _ = x[TME-175] + _ = x[TOPEXT-176] + _ = x[TSCRATEMSR-177] + _ = x[TSXLDTRK-178] + _ = x[VAES-179] + _ = x[VMCBCLEAN-180] + _ = x[VMPL-181] + _ = x[VMSA_REGPROT-182] + _ = x[VMX-183] + _ = x[VPCLMULQDQ-184] + _ = x[VTE-185] + _ = x[WAITPKG-186] + _ = x[WBNOINVD-187] + _ = x[WRMSRNS-188] + _ = x[X87-189] + _ = x[XGETBV1-190] + _ = x[XOP-191] + _ = x[XSAVE-192] + _ = x[XSAVEC-193] + _ = x[XSAVEOPT-194] + _ = x[XSAVES-195] + _ = x[AESARM-196] + _ = x[ARMCPUID-197] + _ = x[ASIMD-198] + _ = x[ASIMDDP-199] + _ = x[ASIMDHP-200] + _ = x[ASIMDRDM-201] + _ = x[ATOMICS-202] + _ = x[CRC32-203] + _ = x[DCPOP-204] + _ = x[EVTSTRM-205] + _ = x[FCMA-206] + _ = x[FP-207] + _ = x[FPHP-208] + _ = x[GPA-209] + _ = x[JSCVT-210] + _ = x[LRCPC-211] + _ = x[PMULL-212] + _ = x[SHA1-213] + _ = x[SHA2-214] + _ = x[SHA3-215] + _ = x[SHA512-216] + _ = x[SM3-217] + _ = x[SM4-218] + _ = x[SVE-219] + _ = x[lastID-220] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { @@ -270,12 +271,17 @@ func _() { _ = x[AMCC-23] _ = x[Qualcomm-24] _ = x[Marvell-25] - _ = x[lastVendor-26] + _ = x[QEMU-26] + _ = x[QNX-27] + _ = x[ACRN-28] + _ = x[SRE-29] + _ = x[Apple-30] + _ = x[lastVendor-31] } -const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor" +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor" -var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155} +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174} func (i Vendor) String() string { if i < 0 || i >= Vendor(len(_Vendor_index)-1) { diff --git a/vendor/github.com/minio/minio-go/v7/api-presigned.go b/vendor/github.com/minio/minio-go/v7/api-presigned.go index 9e85f81816777..29642200ee140 100644 --- a/vendor/github.com/minio/minio-go/v7/api-presigned.go +++ b/vendor/github.com/minio/minio-go/v7/api-presigned.go @@ -140,7 +140,7 @@ func (c *Client) PresignedPostPolicy(ctx context.Context, p *PostPolicy) (u *url } // Get credentials from the configured credentials provider. - credValues, err := c.credsProvider.Get() + credValues, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, nil, err } diff --git a/vendor/github.com/minio/minio-go/v7/api.go b/vendor/github.com/minio/minio-go/v7/api.go index 83c003e499fee..cb46816d0db32 100644 --- a/vendor/github.com/minio/minio-go/v7/api.go +++ b/vendor/github.com/minio/minio-go/v7/api.go @@ -133,7 +133,7 @@ type Options struct { // Global constants. const ( libraryName = "minio-go" - libraryVersion = "v7.0.82" + libraryVersion = "v7.0.83" ) // User Agent should always following the below style. @@ -600,9 +600,9 @@ func (c *Client) executeMethod(ctx context.Context, method string, metadata requ return nil, errors.New(c.endpointURL.String() + " is offline.") } - var retryable bool // Indicates if request can be retried. - var bodySeeker io.Seeker // Extracted seeker from io.Reader. - var reqRetry = c.maxRetries // Indicates how many times we can retry the request + var retryable bool // Indicates if request can be retried. + var bodySeeker io.Seeker // Extracted seeker from io.Reader. + reqRetry := c.maxRetries // Indicates how many times we can retry the request if metadata.contentBody != nil { // Check if body is seekable then it is retryable. @@ -808,7 +808,7 @@ func (c *Client) newRequest(ctx context.Context, method string, metadata request } // Get credentials from the configured credentials provider. - value, err := c.credsProvider.Get() + value, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, err } @@ -1018,3 +1018,15 @@ func (c *Client) isVirtualHostStyleRequest(url url.URL, bucketName string) bool // path style requests return s3utils.IsVirtualHostSupported(url, bucketName) } + +// CredContext returns the context for fetching credentials +func (c *Client) CredContext() *credentials.CredContext { + httpClient := c.httpClient + if httpClient == nil { + httpClient = http.DefaultClient + } + return &credentials.CredContext{ + Client: httpClient, + Endpoint: c.endpointURL.String(), + } +} diff --git a/vendor/github.com/minio/minio-go/v7/bucket-cache.go b/vendor/github.com/minio/minio-go/v7/bucket-cache.go index b1d3b3852cfa0..4e4305acd5b9c 100644 --- a/vendor/github.com/minio/minio-go/v7/bucket-cache.go +++ b/vendor/github.com/minio/minio-go/v7/bucket-cache.go @@ -212,7 +212,7 @@ func (c *Client) getBucketLocationRequest(ctx context.Context, bucketName string c.setUserAgent(req) // Get credentials from the configured credentials provider. - value, err := c.credsProvider.Get() + value, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, err } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go index d245bc07a3a75..cd0a641bde195 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go @@ -76,7 +76,8 @@ type AssumeRoleResult struct { type STSAssumeRole struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service + // (overrides default client in CredContext) Client *http.Client // STS endpoint to fetch STS credentials. @@ -108,16 +109,10 @@ type STSAssumeRoleOptions struct { // NewSTSAssumeRole returns a pointer to a new // Credentials object wrapping the STSAssumeRole. func NewSTSAssumeRole(stsEndpoint string, opts STSAssumeRoleOptions) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if opts.AccessKey == "" || opts.SecretKey == "" { return nil, errors.New("AssumeRole credentials access/secretkey is mandatory") } return New(&STSAssumeRole{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, Options: opts, }), nil @@ -222,10 +217,30 @@ func getAssumeRoleCredentials(clnt *http.Client, endpoint string, opts STSAssume return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSAssumeRole) Retrieve() (Value, error) { - a, err := getAssumeRoleCredentials(m.Client, m.STSEndpoint, m.Options) +// RetrieveWithCredContext retrieves credentials from the MinIO service. +// Error will be returned if the request fails, optional cred context. +func (m *STSAssumeRole) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getAssumeRoleCredentials(client, stsEndpoint, m.Options) if err != nil { return Value{}, err } @@ -241,3 +256,9 @@ func (m *STSAssumeRole) Retrieve() (Value, error) { SignerType: SignatureV4, }, nil } + +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSAssumeRole) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go index ddccfb173fe67..5ef3597d1047a 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go @@ -55,6 +55,24 @@ func NewChainCredentials(providers []Provider) *Credentials { }) } +// RetrieveWithCredContext is like Retrieve with CredContext +func (c *Chain) RetrieveWithCredContext(cc *CredContext) (Value, error) { + for _, p := range c.Providers { + creds, _ := p.RetrieveWithCredContext(cc) + // Always prioritize non-anonymous providers, if any. + if creds.AccessKeyID == "" && creds.SecretAccessKey == "" { + continue + } + c.curr = p + return creds, nil + } + // At this point we have exhausted all the providers and + // are left without any credentials return anonymous. + return Value{ + SignerType: SignatureAnonymous, + }, nil +} + // Retrieve returns the credentials value, returns no credentials(anonymous) // if no credentials provider returned any value. // diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go index 68f9b38157ec2..52aff9a57f6fa 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go @@ -18,6 +18,7 @@ package credentials import ( + "net/http" "sync" "time" ) @@ -30,6 +31,10 @@ const ( defaultExpiryWindow = 0.8 ) +// defaultCredContext is used when the credential context doesn't +// actually matter or the default context is suitable. +var defaultCredContext = &CredContext{Client: http.DefaultClient} + // A Value is the S3 credentials value for individual credential fields. type Value struct { // S3 Access key ID @@ -52,8 +57,17 @@ type Value struct { // Value. A provider is required to manage its own Expired state, and what to // be expired means. type Provider interface { + // RetrieveWithCredContext returns nil if it successfully retrieved the + // value. Error is returned if the value were not obtainable, or empty. + // optionally takes CredContext for additional context to retrieve credentials. + RetrieveWithCredContext(cc *CredContext) (Value, error) + // Retrieve returns nil if it successfully retrieved the value. // Error is returned if the value were not obtainable, or empty. + // + // Deprecated: Retrieve() exists for historical compatibility and should not + // be used. To get new credentials use the RetrieveWithCredContext function + // to ensure the proper context (i.e. HTTP client) will be used. Retrieve() (Value, error) // IsExpired returns if the credentials are no longer valid, and need @@ -61,6 +75,18 @@ type Provider interface { IsExpired() bool } +// CredContext is passed to the Retrieve function of a provider to provide +// some additional context to retrieve credentials. +type CredContext struct { + // Client specifies the HTTP client that should be used if an HTTP + // request is to be made to fetch the credentials. + Client *http.Client + + // Endpoint specifies the MinIO endpoint that will be used if no + // explicit endpoint is provided. + Endpoint string +} + // A Expiry provides shared expiration logic to be used by credentials // providers to implement expiry functionality. // @@ -146,16 +172,36 @@ func New(provider Provider) *Credentials { // // If Credentials.Expire() was called the credentials Value will be force // expired, and the next call to Get() will cause them to be refreshed. +// +// Deprecated: Get() exists for historical compatibility and should not be +// used. To get new credentials use the Credentials.GetWithContext function +// to ensure the proper context (i.e. HTTP client) will be used. func (c *Credentials) Get() (Value, error) { + return c.GetWithContext(nil) +} + +// GetWithContext returns the credentials value, or error if the +// credentials Value failed to be retrieved. +// +// Will return the cached credentials Value if it has not expired. If the +// credentials Value has expired the Provider's Retrieve() will be called +// to refresh the credentials. +// +// If Credentials.Expire() was called the credentials Value will be force +// expired, and the next call to Get() will cause them to be refreshed. +func (c *Credentials) GetWithContext(cc *CredContext) (Value, error) { if c == nil { return Value{}, nil } + if cc == nil { + cc = defaultCredContext + } c.Lock() defer c.Unlock() if c.isExpired() { - creds, err := c.provider.Retrieve() + creds, err := c.provider.RetrieveWithCredContext(cc) if err != nil { return Value{}, err } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go index b6e60d0e1657a..21ab0a38a4df0 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go @@ -37,8 +37,7 @@ func NewEnvAWS() *Credentials { return New(&EnvAWS{}) } -// Retrieve retrieves the keys from the environment. -func (e *EnvAWS) Retrieve() (Value, error) { +func (e *EnvAWS) retrieve() (Value, error) { e.retrieved = false id := os.Getenv("AWS_ACCESS_KEY_ID") @@ -65,6 +64,16 @@ func (e *EnvAWS) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves the keys from the environment. +func (e *EnvAWS) Retrieve() (Value, error) { + return e.retrieve() +} + +// RetrieveWithCredContext is like Retrieve (no-op input of Cred Context) +func (e *EnvAWS) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return e.retrieve() +} + // IsExpired returns if the credentials have been retrieved. func (e *EnvAWS) IsExpired() bool { return !e.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go index 5bfeab140ae7c..dbfbdfcef1d1b 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go @@ -38,8 +38,7 @@ func NewEnvMinio() *Credentials { return New(&EnvMinio{}) } -// Retrieve retrieves the keys from the environment. -func (e *EnvMinio) Retrieve() (Value, error) { +func (e *EnvMinio) retrieve() (Value, error) { e.retrieved = false id := os.Getenv("MINIO_ROOT_USER") @@ -62,6 +61,16 @@ func (e *EnvMinio) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves the keys from the environment. +func (e *EnvMinio) Retrieve() (Value, error) { + return e.retrieve() +} + +// RetrieveWithCredContext is like Retrieve() (no-op input cred context) +func (e *EnvMinio) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return e.retrieve() +} + // IsExpired returns if the credentials have been retrieved. func (e *EnvMinio) IsExpired() bool { return !e.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go index 541e1a72f0f1a..0c83fc7fa4c75 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go @@ -71,9 +71,7 @@ func NewFileAWSCredentials(filename, profile string) *Credentials { }) } -// Retrieve reads and extracts the shared credentials from the current -// users home directory. -func (p *FileAWSCredentials) Retrieve() (Value, error) { +func (p *FileAWSCredentials) retrieve() (Value, error) { if p.Filename == "" { p.Filename = os.Getenv("AWS_SHARED_CREDENTIALS_FILE") if p.Filename == "" { @@ -142,6 +140,17 @@ func (p *FileAWSCredentials) Retrieve() (Value, error) { }, nil } +// Retrieve reads and extracts the shared credentials from the current +// users home directory. +func (p *FileAWSCredentials) Retrieve() (Value, error) { + return p.retrieve() +} + +// RetrieveWithCredContext is like Retrieve(), cred context is no-op for File credentials +func (p *FileAWSCredentials) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return p.retrieve() +} + // loadProfiles loads from the file pointed to by shared credentials filename for profile. // The credentials retrieved from the profile will be returned or error. Error will be // returned if it fails to read from the file, or the data is invalid. diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go index 750e26ffa8bec..5805281fe9e7d 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go @@ -56,9 +56,7 @@ func NewFileMinioClient(filename, alias string) *Credentials { }) } -// Retrieve reads and extracts the shared credentials from the current -// users home directory. -func (p *FileMinioClient) Retrieve() (Value, error) { +func (p *FileMinioClient) retrieve() (Value, error) { if p.Filename == "" { if value, ok := os.LookupEnv("MINIO_SHARED_CREDENTIALS_FILE"); ok { p.Filename = value @@ -96,6 +94,17 @@ func (p *FileMinioClient) Retrieve() (Value, error) { }, nil } +// Retrieve reads and extracts the shared credentials from the current +// users home directory. +func (p *FileMinioClient) Retrieve() (Value, error) { + return p.retrieve() +} + +// RetrieveWithCredContext - is like Retrieve() +func (p *FileMinioClient) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return p.retrieve() +} + // IsExpired returns if the shared credentials have expired. func (p *FileMinioClient) IsExpired() bool { return !p.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go index ea4b3ef93755a..0ba06e710662c 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go @@ -49,7 +49,8 @@ const DefaultExpiryWindow = -1 type IAM struct { Expiry - // Required http Client to use when connecting to IAM metadata service. + // Optional http Client to use when connecting to IAM metadata service + // (overrides default client in CredContext) Client *http.Client // Custom endpoint to fetch IAM role credentials. @@ -90,17 +91,16 @@ const ( // NewIAM returns a pointer to a new Credentials object wrapping the IAM. func NewIAM(endpoint string) *Credentials { return New(&IAM{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, Endpoint: endpoint, }) } -// Retrieve retrieves credentials from the EC2 service. -// Error will be returned if the request fails, or unable to extract -// the desired -func (m *IAM) Retrieve() (Value, error) { +// RetrieveWithCredContext is like Retrieve with Cred Context +func (m *IAM) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + token := os.Getenv("AWS_CONTAINER_AUTHORIZATION_TOKEN") if token == "" { token = m.Container.AuthorizationToken @@ -144,7 +144,19 @@ func (m *IAM) Retrieve() (Value, error) { var roleCreds ec2RoleCredRespBody var err error + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + endpoint := m.Endpoint + if endpoint == "" { + endpoint = cc.Endpoint + } + switch { case identityFile != "": if len(endpoint) == 0 { @@ -160,7 +172,7 @@ func (m *IAM) Retrieve() (Value, error) { } creds := &STSWebIdentity{ - Client: m.Client, + Client: client, STSEndpoint: endpoint, GetWebIDTokenExpiry: func() (*WebIdentityToken, error) { token, err := os.ReadFile(identityFile) @@ -174,7 +186,7 @@ func (m *IAM) Retrieve() (Value, error) { roleSessionName: roleSessionName, } - stsWebIdentityCreds, err := creds.Retrieve() + stsWebIdentityCreds, err := creds.RetrieveWithCredContext(cc) if err == nil { m.SetExpiration(creds.Expiration(), DefaultExpiryWindow) } @@ -185,11 +197,11 @@ func (m *IAM) Retrieve() (Value, error) { endpoint = fmt.Sprintf("%s%s", DefaultECSRoleEndpoint, relativeURI) } - roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token) + roleCreds, err = getEcsTaskCredentials(client, endpoint, token) case tokenFile != "" && fullURI != "": endpoint = fullURI - roleCreds, err = getEKSPodIdentityCredentials(m.Client, endpoint, tokenFile) + roleCreds, err = getEKSPodIdentityCredentials(client, endpoint, tokenFile) case fullURI != "": if len(endpoint) == 0 { @@ -203,10 +215,10 @@ func (m *IAM) Retrieve() (Value, error) { } } - roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token) + roleCreds, err = getEcsTaskCredentials(client, endpoint, token) default: - roleCreds, err = getCredentials(m.Client, endpoint) + roleCreds, err = getCredentials(client, endpoint) } if err != nil { @@ -224,6 +236,13 @@ func (m *IAM) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves credentials from the EC2 service. +// Error will be returned if the request fails, or unable to extract +// the desired +func (m *IAM) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} + // A ec2RoleCredRespBody provides the shape for unmarshaling credential // request responses. type ec2RoleCredRespBody struct { diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go index 7dde00b0a1659..d90c98c84d552 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go @@ -59,6 +59,11 @@ func (s *Static) Retrieve() (Value, error) { return s.Value, nil } +// RetrieveWithCredContext returns the static credentials. +func (s *Static) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return s.Retrieve() +} + // IsExpired returns if the credentials are expired. // // For Static, the credentials never expired. diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go index 62bfbb6b02c06..ef6f436b84b0d 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go @@ -72,7 +72,8 @@ type ClientGrantsToken struct { type STSClientGrants struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // MinIO endpoint to fetch STS credentials. @@ -90,16 +91,10 @@ type STSClientGrants struct { // NewSTSClientGrants returns a pointer to a new // Credentials object wrapping the STSClientGrants. func NewSTSClientGrants(stsEndpoint string, getClientGrantsTokenExpiry func() (*ClientGrantsToken, error)) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if getClientGrantsTokenExpiry == nil { return nil, errors.New("Client grants access token and expiry retrieval function should be defined") } return New(&STSClientGrants{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, GetClientGrantsTokenExpiry: getClientGrantsTokenExpiry, }), nil @@ -162,10 +157,29 @@ func getClientGrantsCredentials(clnt *http.Client, endpoint string, return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSClientGrants) Retrieve() (Value, error) { - a, err := getClientGrantsCredentials(m.Client, m.STSEndpoint, m.GetClientGrantsTokenExpiry) +// RetrieveWithCredContext is like Retrieve() with cred context +func (m *STSClientGrants) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getClientGrantsCredentials(client, stsEndpoint, m.GetClientGrantsTokenExpiry) if err != nil { return Value{}, err } @@ -181,3 +195,9 @@ func (m *STSClientGrants) Retrieve() (Value, error) { SignerType: SignatureV4, }, nil } + +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSClientGrants) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go index 75e1a77d322a9..0021f9315b6e0 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go @@ -53,6 +53,8 @@ type AssumeRoleWithCustomTokenResponse struct { type CustomTokenIdentity struct { Expiry + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // MinIO server STS endpoint to fetch STS credentials. @@ -69,9 +71,21 @@ type CustomTokenIdentity struct { RequestedExpiry time.Duration } -// Retrieve - to satisfy Provider interface; fetches credentials from MinIO. -func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { - u, err := url.Parse(c.STSEndpoint) +// RetrieveWithCredContext with Retrieve optionally cred context +func (c *CustomTokenIdentity) RetrieveWithCredContext(cc *CredContext) (value Value, err error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := c.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + u, err := url.Parse(stsEndpoint) if err != nil { return value, err } @@ -92,7 +106,15 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { return value, err } - resp, err := c.Client.Do(req) + client := c.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + resp, err := client.Do(req) if err != nil { return value, err } @@ -118,11 +140,15 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { }, nil } +// Retrieve - to satisfy Provider interface; fetches credentials from MinIO. +func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { + return c.RetrieveWithCredContext(nil) +} + // NewCustomTokenCredentials - returns credentials using the // AssumeRoleWithCustomToken STS API. func NewCustomTokenCredentials(stsEndpoint, token, roleArn string, optFuncs ...CustomTokenOpt) (*Credentials, error) { c := CustomTokenIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, Token: token, RoleArn: roleArn, diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go index b8df289f20391..e63997e6ef266 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go @@ -20,6 +20,7 @@ package credentials import ( "bytes" "encoding/xml" + "errors" "fmt" "io" "net/http" @@ -55,7 +56,8 @@ type LDAPIdentityResult struct { type LDAPIdentity struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // Exported STS endpoint to fetch STS credentials. @@ -77,7 +79,6 @@ type LDAPIdentity struct { // Identity. func NewLDAPIdentity(stsEndpoint, ldapUsername, ldapPassword string, optFuncs ...LDAPIdentityOpt) (*Credentials, error) { l := LDAPIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, LDAPUsername: ldapUsername, LDAPPassword: ldapPassword, @@ -113,7 +114,6 @@ func LDAPIdentityExpiryOpt(d time.Duration) LDAPIdentityOpt { // Deprecated: Use the `LDAPIdentityPolicyOpt` with `NewLDAPIdentity` instead. func NewLDAPIdentityWithSessionPolicy(stsEndpoint, ldapUsername, ldapPassword, policy string) (*Credentials, error) { return New(&LDAPIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, LDAPUsername: ldapUsername, LDAPPassword: ldapPassword, @@ -121,10 +121,22 @@ func NewLDAPIdentityWithSessionPolicy(stsEndpoint, ldapUsername, ldapPassword, p }), nil } -// Retrieve gets the credential by calling the MinIO STS API for +// RetrieveWithCredContext gets the credential by calling the MinIO STS API for // LDAP on the configured stsEndpoint. -func (k *LDAPIdentity) Retrieve() (value Value, err error) { - u, err := url.Parse(k.STSEndpoint) +func (k *LDAPIdentity) RetrieveWithCredContext(cc *CredContext) (value Value, err error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := k.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + u, err := url.Parse(stsEndpoint) if err != nil { return value, err } @@ -148,7 +160,15 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) { req.Header.Set("Content-Type", "application/x-www-form-urlencoded") - resp, err := k.Client.Do(req) + client := k.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + resp, err := client.Do(req) if err != nil { return value, err } @@ -188,3 +208,9 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) { SignerType: SignatureV4, }, nil } + +// Retrieve gets the credential by calling the MinIO STS API for +// LDAP on the configured stsEndpoint. +func (k *LDAPIdentity) Retrieve() (value Value, err error) { + return k.RetrieveWithCredContext(defaultCredContext) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go index 10083502d1d22..c904bbeac7862 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go @@ -20,8 +20,8 @@ import ( "crypto/tls" "encoding/xml" "errors" + "fmt" "io" - "net" "net/http" "net/url" "strconv" @@ -36,7 +36,12 @@ type CertificateIdentityOption func(*STSCertificateIdentity) // CertificateIdentityWithTransport returns a CertificateIdentityOption that // customizes the STSCertificateIdentity with the given http.RoundTripper. func CertificateIdentityWithTransport(t http.RoundTripper) CertificateIdentityOption { - return CertificateIdentityOption(func(i *STSCertificateIdentity) { i.Client.Transport = t }) + return CertificateIdentityOption(func(i *STSCertificateIdentity) { + if i.Client == nil { + i.Client = &http.Client{} + } + i.Client.Transport = t + }) } // CertificateIdentityWithExpiry returns a CertificateIdentityOption that @@ -53,6 +58,10 @@ func CertificateIdentityWithExpiry(livetime time.Duration) CertificateIdentityOp type STSCertificateIdentity struct { Expiry + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) + Client *http.Client + // STSEndpoint is the base URL endpoint of the STS API. // For example, https://minio.local:9000 STSEndpoint string @@ -68,50 +77,18 @@ type STSCertificateIdentity struct { // The default livetime is one hour. S3CredentialLivetime time.Duration - // Client is the HTTP client used to authenticate and fetch - // S3 credentials. - // - // A custom TLS client configuration can be specified by - // using a custom http.Transport: - // Client: http.Client { - // Transport: &http.Transport{ - // TLSClientConfig: &tls.Config{}, - // }, - // } - Client http.Client + // Certificate is the client certificate that is used for + // STS authentication. + Certificate tls.Certificate } -var _ Provider = (*STSWebIdentity)(nil) // compiler check - // NewSTSCertificateIdentity returns a STSCertificateIdentity that authenticates // to the given STS endpoint with the given TLS certificate and retrieves and // rotates S3 credentials. func NewSTSCertificateIdentity(endpoint string, certificate tls.Certificate, options ...CertificateIdentityOption) (*Credentials, error) { - if endpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } - if _, err := url.Parse(endpoint); err != nil { - return nil, err - } identity := &STSCertificateIdentity{ STSEndpoint: endpoint, - Client: http.Client{ - Transport: &http.Transport{ - Proxy: http.ProxyFromEnvironment, - DialContext: (&net.Dialer{ - Timeout: 30 * time.Second, - KeepAlive: 30 * time.Second, - }).DialContext, - ForceAttemptHTTP2: true, - MaxIdleConns: 100, - IdleConnTimeout: 90 * time.Second, - TLSHandshakeTimeout: 10 * time.Second, - ExpectContinueTimeout: 5 * time.Second, - TLSClientConfig: &tls.Config{ - Certificates: []tls.Certificate{certificate}, - }, - }, - }, + Certificate: certificate, } for _, option := range options { option(identity) @@ -119,10 +96,21 @@ func NewSTSCertificateIdentity(endpoint string, certificate tls.Certificate, opt return New(identity), nil } -// Retrieve fetches a new set of S3 credentials from the configured -// STS API endpoint. -func (i *STSCertificateIdentity) Retrieve() (Value, error) { - endpointURL, err := url.Parse(i.STSEndpoint) +// RetrieveWithCredContext is Retrieve with cred context +func (i *STSCertificateIdentity) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := i.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + endpointURL, err := url.Parse(stsEndpoint) if err != nil { return Value{}, err } @@ -145,7 +133,28 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) { } req.Form.Add("DurationSeconds", strconv.FormatUint(uint64(livetime.Seconds()), 10)) - resp, err := i.Client.Do(req) + client := i.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + tr, ok := client.Transport.(*http.Transport) + if !ok { + return Value{}, fmt.Errorf("CredContext should contain an http.Transport value") + } + + // Clone the HTTP transport (patch the TLS client certificate) + trCopy := tr.Clone() + trCopy.TLSClientConfig.Certificates = []tls.Certificate{i.Certificate} + + // Clone the HTTP client (patch the HTTP transport) + clientCopy := *client + clientCopy.Transport = trCopy + + resp, err := clientCopy.Do(req) if err != nil { return Value{}, err } @@ -193,6 +202,11 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) { }, nil } +// Retrieve fetches a new set of S3 credentials from the configured STS API endpoint. +func (i *STSCertificateIdentity) Retrieve() (Value, error) { + return i.RetrieveWithCredContext(defaultCredContext) +} + // Expiration returns the expiration time of the current S3 credentials. func (i *STSCertificateIdentity) Expiration() time.Time { return i.expiration } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go index 8c06bac60db7d..235258893018e 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go @@ -69,7 +69,8 @@ type WebIdentityToken struct { type STSWebIdentity struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // Exported STS endpoint to fetch STS credentials. @@ -97,16 +98,10 @@ type STSWebIdentity struct { // NewSTSWebIdentity returns a pointer to a new // Credentials object wrapping the STSWebIdentity. func NewSTSWebIdentity(stsEndpoint string, getWebIDTokenExpiry func() (*WebIdentityToken, error), opts ...func(*STSWebIdentity)) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if getWebIDTokenExpiry == nil { return nil, errors.New("Web ID token and expiry retrieval function should be defined") } i := &STSWebIdentity{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, GetWebIDTokenExpiry: getWebIDTokenExpiry, } @@ -219,10 +214,29 @@ func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSession return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSWebIdentity) Retrieve() (Value, error) { - a, err := getWebIdentityCredentials(m.Client, m.STSEndpoint, m.RoleARN, m.roleSessionName, m.Policy, m.GetWebIDTokenExpiry) +// RetrieveWithCredContext is like Retrieve with optional cred context. +func (m *STSWebIdentity) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getWebIdentityCredentials(client, stsEndpoint, m.RoleARN, m.roleSessionName, m.Policy, m.GetWebIDTokenExpiry) if err != nil { return Value{}, err } @@ -239,6 +253,12 @@ func (m *STSWebIdentity) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSWebIdentity) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} + // Expiration returns the expiration time of the credentials func (m *STSWebIdentity) Expiration() time.Time { return m.expiration diff --git a/vendor/github.com/minio/minio-go/v7/retry.go b/vendor/github.com/minio/minio-go/v7/retry.go index 4cc45920c4acb..ed954017ca29c 100644 --- a/vendor/github.com/minio/minio-go/v7/retry.go +++ b/vendor/github.com/minio/minio-go/v7/retry.go @@ -112,6 +112,7 @@ func isS3CodeRetryable(s3Code string) (ok bool) { // List of HTTP status codes which are retryable. var retryableHTTPStatusCodes = map[int]struct{}{ + http.StatusRequestTimeout: {}, 429: {}, // http.StatusTooManyRequests is not part of the Go 1.5 library, yet 499: {}, // client closed request, retry. A non-standard status code introduced by nginx. http.StatusInternalServerError: {}, diff --git a/vendor/go.opentelemetry.io/contrib/detectors/gcp/version.go b/vendor/go.opentelemetry.io/contrib/detectors/gcp/version.go index 1acc898319839..b2c2fe0fa80a2 100644 --- a/vendor/go.opentelemetry.io/contrib/detectors/gcp/version.go +++ b/vendor/go.opentelemetry.io/contrib/detectors/gcp/version.go @@ -5,7 +5,7 @@ package gcp // import "go.opentelemetry.io/contrib/detectors/gcp" // Version is the current release version of the GCP resource detector. func Version() string { - return "1.29.0" + return "1.33.0" // This string is updated by the pre_release.sh script during release } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go index 18436eaedffd8..9e87fb4bb192d 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go @@ -51,11 +51,11 @@ type config struct { tracer trace.Tracer meter metric.Meter - rpcDuration metric.Float64Histogram - rpcRequestSize metric.Int64Histogram - rpcResponseSize metric.Int64Histogram - rpcRequestsPerRPC metric.Int64Histogram - rpcResponsesPerRPC metric.Int64Histogram + rpcDuration metric.Float64Histogram + rpcInBytes metric.Int64Histogram + rpcOutBytes metric.Int64Histogram + rpcInMessages metric.Int64Histogram + rpcOutMessages metric.Int64Histogram } // Option applies an option value for a config. @@ -96,46 +96,64 @@ func newConfig(opts []Option, role string) *config { } } - c.rpcRequestSize, err = c.meter.Int64Histogram("rpc."+role+".request.size", + rpcRequestSize, err := c.meter.Int64Histogram("rpc."+role+".request.size", metric.WithDescription("Measures size of RPC request messages (uncompressed)."), metric.WithUnit("By")) if err != nil { otel.Handle(err) - if c.rpcRequestSize == nil { - c.rpcRequestSize = noop.Int64Histogram{} + if rpcRequestSize == nil { + rpcRequestSize = noop.Int64Histogram{} } } - c.rpcResponseSize, err = c.meter.Int64Histogram("rpc."+role+".response.size", + rpcResponseSize, err := c.meter.Int64Histogram("rpc."+role+".response.size", metric.WithDescription("Measures size of RPC response messages (uncompressed)."), metric.WithUnit("By")) if err != nil { otel.Handle(err) - if c.rpcResponseSize == nil { - c.rpcResponseSize = noop.Int64Histogram{} + if rpcResponseSize == nil { + rpcResponseSize = noop.Int64Histogram{} } } - c.rpcRequestsPerRPC, err = c.meter.Int64Histogram("rpc."+role+".requests_per_rpc", + rpcRequestsPerRPC, err := c.meter.Int64Histogram("rpc."+role+".requests_per_rpc", metric.WithDescription("Measures the number of messages received per RPC. Should be 1 for all non-streaming RPCs."), metric.WithUnit("{count}")) if err != nil { otel.Handle(err) - if c.rpcRequestsPerRPC == nil { - c.rpcRequestsPerRPC = noop.Int64Histogram{} + if rpcRequestsPerRPC == nil { + rpcRequestsPerRPC = noop.Int64Histogram{} } } - c.rpcResponsesPerRPC, err = c.meter.Int64Histogram("rpc."+role+".responses_per_rpc", + rpcResponsesPerRPC, err := c.meter.Int64Histogram("rpc."+role+".responses_per_rpc", metric.WithDescription("Measures the number of messages received per RPC. Should be 1 for all non-streaming RPCs."), metric.WithUnit("{count}")) if err != nil { otel.Handle(err) - if c.rpcResponsesPerRPC == nil { - c.rpcResponsesPerRPC = noop.Int64Histogram{} + if rpcResponsesPerRPC == nil { + rpcResponsesPerRPC = noop.Int64Histogram{} } } + switch role { + case "client": + c.rpcInBytes = rpcResponseSize + c.rpcInMessages = rpcResponsesPerRPC + c.rpcOutBytes = rpcRequestSize + c.rpcOutMessages = rpcRequestsPerRPC + case "server": + c.rpcInBytes = rpcRequestSize + c.rpcInMessages = rpcRequestsPerRPC + c.rpcOutBytes = rpcResponseSize + c.rpcOutMessages = rpcResponsesPerRPC + default: + c.rpcInBytes = noop.Int64Histogram{} + c.rpcInMessages = noop.Int64Histogram{} + c.rpcOutBytes = noop.Int64Histogram{} + c.rpcOutMessages = noop.Int64Histogram{} + } + return c } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go index fbcbfb84e047e..c01cb897cd307 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go @@ -13,21 +13,22 @@ import ( "google.golang.org/grpc/stats" "google.golang.org/grpc/status" - "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" "go.opentelemetry.io/otel/metric" semconv "go.opentelemetry.io/otel/semconv/v1.17.0" "go.opentelemetry.io/otel/trace" + + "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal" ) type gRPCContextKey struct{} type gRPCContext struct { - messagesReceived int64 - messagesSent int64 - metricAttrs []attribute.KeyValue - record bool + inMessages int64 + outMessages int64 + metricAttrs []attribute.KeyValue + record bool } type serverHandler struct { @@ -150,8 +151,8 @@ func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool case *stats.Begin: case *stats.InPayload: if gctx != nil { - messageId = atomic.AddInt64(&gctx.messagesReceived, 1) - c.rpcRequestSize.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) + messageId = atomic.AddInt64(&gctx.inMessages, 1) + c.rpcInBytes.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) } if c.ReceivedEvent { @@ -166,8 +167,8 @@ func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool } case *stats.OutPayload: if gctx != nil { - messageId = atomic.AddInt64(&gctx.messagesSent, 1) - c.rpcResponseSize.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) + messageId = atomic.AddInt64(&gctx.outMessages, 1) + c.rpcOutBytes.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) } if c.SentEvent { @@ -213,8 +214,8 @@ func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool c.rpcDuration.Record(ctx, elapsedTime, recordOpts...) if gctx != nil { - c.rpcRequestsPerRPC.Record(ctx, atomic.LoadInt64(&gctx.messagesReceived), recordOpts...) - c.rpcResponsesPerRPC.Record(ctx, atomic.LoadInt64(&gctx.messagesSent), recordOpts...) + c.rpcInMessages.Record(ctx, atomic.LoadInt64(&gctx.inMessages), recordOpts...) + c.rpcOutMessages.Record(ctx, atomic.LoadInt64(&gctx.outMessages), recordOpts...) } default: return diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go index 04f425edfefea..25a3a86296af1 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go @@ -5,7 +5,7 @@ package otelgrpc // import "go.opentelemetry.io/contrib/instrumentation/google.g // Version is the current release version of the gRPC instrumentation. func Version() string { - return "0.54.0" + return "0.58.0" // This string is updated by the pre_release.sh script during release } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/client.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/client.go index 6aae83bfd2080..b25641c55d348 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/client.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/client.go @@ -18,7 +18,7 @@ var DefaultClient = &http.Client{Transport: NewTransport(http.DefaultTransport)} // Get is a convenient replacement for http.Get that adds a span around the request. func Get(ctx context.Context, targetURL string) (resp *http.Response, err error) { - req, err := http.NewRequestWithContext(ctx, "GET", targetURL, nil) + req, err := http.NewRequestWithContext(ctx, http.MethodGet, targetURL, nil) if err != nil { return nil, err } @@ -27,7 +27,7 @@ func Get(ctx context.Context, targetURL string) (resp *http.Response, err error) // Head is a convenient replacement for http.Head that adds a span around the request. func Head(ctx context.Context, targetURL string) (resp *http.Response, err error) { - req, err := http.NewRequestWithContext(ctx, "HEAD", targetURL, nil) + req, err := http.NewRequestWithContext(ctx, http.MethodHead, targetURL, nil) if err != nil { return nil, err } @@ -36,7 +36,7 @@ func Head(ctx context.Context, targetURL string) (resp *http.Response, err error // Post is a convenient replacement for http.Post that adds a span around the request. func Post(ctx context.Context, targetURL, contentType string, body io.Reader) (resp *http.Response, err error) { - req, err := http.NewRequestWithContext(ctx, "POST", targetURL, body) + req, err := http.NewRequestWithContext(ctx, http.MethodPost, targetURL, body) if err != nil { return nil, err } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/common.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/common.go index 5d6e6156b7beb..a83a026274a11 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/common.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/common.go @@ -18,13 +18,6 @@ const ( WriteErrorKey = attribute.Key("http.write_error") // if an error occurred while writing a reply, the string of the error (io.EOF is not recorded) ) -// Client HTTP metrics. -const ( - clientRequestSize = "http.client.request.size" // Outgoing request bytes total - clientResponseSize = "http.client.response.size" // Outgoing response bytes total - clientDuration = "http.client.duration" // Outgoing end to end duration, milliseconds -) - // Filter is a predicate used to determine whether a given http.request should // be traced. A Filter must return true if the request should be traced. type Filter func(*http.Request) bool diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/handler.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/handler.go index 33580a35b774b..e555a475f13d9 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/handler.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/handler.go @@ -81,12 +81,6 @@ func (h *middleware) configure(c *config) { h.semconv = semconv.NewHTTPServer(c.Meter) } -func handleErr(err error) { - if err != nil { - otel.Handle(err) - } -} - // serveHTTP sets up tracing and calls the given next http.Handler with the span // context injected into the request context. func (h *middleware) serveHTTP(w http.ResponseWriter, r *http.Request, next http.Handler) { @@ -123,6 +117,11 @@ func (h *middleware) serveHTTP(w http.ResponseWriter, r *http.Request, next http } } + if startTime := StartTimeFromContext(ctx); !startTime.IsZero() { + opts = append(opts, trace.WithTimestamp(startTime)) + requestStartTime = startTime + } + ctx, span := tracer.Start(ctx, h.spanNameFormatter(h.operation, r), opts...) defer span.End() @@ -190,14 +189,18 @@ func (h *middleware) serveHTTP(w http.ResponseWriter, r *http.Request, next http // Use floating point division here for higher precision (instead of Millisecond method). elapsedTime := float64(time.Since(requestStartTime)) / float64(time.Millisecond) - h.semconv.RecordMetrics(ctx, semconv.MetricData{ - ServerName: h.server, - Req: r, - StatusCode: statusCode, - AdditionalAttributes: labeler.Get(), - RequestSize: bw.BytesRead(), - ResponseSize: bytesWritten, - ElapsedTime: elapsedTime, + h.semconv.RecordMetrics(ctx, semconv.ServerMetricData{ + ServerName: h.server, + ResponseSize: bytesWritten, + MetricAttributes: semconv.MetricAttributes{ + Req: r, + StatusCode: statusCode, + AdditionalAttributes: labeler.Get(), + }, + MetricData: semconv.MetricData{ + RequestSize: bw.BytesRead(), + ElapsedTime: elapsedTime, + }, }) } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request/resp_writer_wrapper.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request/resp_writer_wrapper.go index aea171fb260b5..fbc344cbdda36 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request/resp_writer_wrapper.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request/resp_writer_wrapper.go @@ -44,7 +44,9 @@ func (w *RespWriterWrapper) Write(p []byte) (int, error) { w.mu.Lock() defer w.mu.Unlock() - w.writeHeader(http.StatusOK) + if !w.wroteHeader { + w.writeHeader(http.StatusOK) + } n, err := w.ResponseWriter.Write(p) n1 := int64(n) @@ -80,7 +82,12 @@ func (w *RespWriterWrapper) writeHeader(statusCode int) { // Flush implements [http.Flusher]. func (w *RespWriterWrapper) Flush() { - w.WriteHeader(http.StatusOK) + w.mu.Lock() + defer w.mu.Unlock() + + if !w.wroteHeader { + w.writeHeader(http.StatusOK) + } if f, ok := w.ResponseWriter.(http.Flusher); ok { f.Flush() diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/env.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/env.go index 9cae4cab86af1..3b036f8a37b24 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/env.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/env.go @@ -9,6 +9,7 @@ import ( "net/http" "os" "strings" + "sync" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" @@ -50,9 +51,9 @@ type HTTPServer struct { // The req Host will be used to determine the server instead. func (s HTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { if s.duplicate { - return append(oldHTTPServer{}.RequestTraceAttrs(server, req), newHTTPServer{}.RequestTraceAttrs(server, req)...) + return append(OldHTTPServer{}.RequestTraceAttrs(server, req), CurrentHTTPServer{}.RequestTraceAttrs(server, req)...) } - return oldHTTPServer{}.RequestTraceAttrs(server, req) + return OldHTTPServer{}.RequestTraceAttrs(server, req) } // ResponseTraceAttrs returns trace attributes for telemetry from an HTTP response. @@ -60,14 +61,14 @@ func (s HTTPServer) RequestTraceAttrs(server string, req *http.Request) []attrib // If any of the fields in the ResponseTelemetry are not set the attribute will be omitted. func (s HTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { if s.duplicate { - return append(oldHTTPServer{}.ResponseTraceAttrs(resp), newHTTPServer{}.ResponseTraceAttrs(resp)...) + return append(OldHTTPServer{}.ResponseTraceAttrs(resp), CurrentHTTPServer{}.ResponseTraceAttrs(resp)...) } - return oldHTTPServer{}.ResponseTraceAttrs(resp) + return OldHTTPServer{}.ResponseTraceAttrs(resp) } // Route returns the attribute for the route. func (s HTTPServer) Route(route string) attribute.KeyValue { - return oldHTTPServer{}.Route(route) + return OldHTTPServer{}.Route(route) } // Status returns a span status code and message for an HTTP status code @@ -83,29 +84,46 @@ func (s HTTPServer) Status(code int) (codes.Code, string) { return codes.Unset, "" } -type MetricData struct { - ServerName string +type ServerMetricData struct { + ServerName string + ResponseSize int64 + + MetricData + MetricAttributes +} + +type MetricAttributes struct { Req *http.Request StatusCode int AdditionalAttributes []attribute.KeyValue +} - RequestSize int64 - ResponseSize int64 - ElapsedTime float64 +type MetricData struct { + RequestSize int64 + ElapsedTime float64 +} + +var metricAddOptionPool = &sync.Pool{ + New: func() interface{} { + return &[]metric.AddOption{} + }, } -func (s HTTPServer) RecordMetrics(ctx context.Context, md MetricData) { +func (s HTTPServer) RecordMetrics(ctx context.Context, md ServerMetricData) { if s.requestBytesCounter == nil || s.responseBytesCounter == nil || s.serverLatencyMeasure == nil { - // This will happen if an HTTPServer{} is used insted of NewHTTPServer. + // This will happen if an HTTPServer{} is used instead of NewHTTPServer. return } - attributes := oldHTTPServer{}.MetricAttributes(md.ServerName, md.Req, md.StatusCode, md.AdditionalAttributes) + attributes := OldHTTPServer{}.MetricAttributes(md.ServerName, md.Req, md.StatusCode, md.AdditionalAttributes) o := metric.WithAttributeSet(attribute.NewSet(attributes...)) - addOpts := []metric.AddOption{o} // Allocate vararg slice once. - s.requestBytesCounter.Add(ctx, md.RequestSize, addOpts...) - s.responseBytesCounter.Add(ctx, md.ResponseSize, addOpts...) + addOpts := metricAddOptionPool.Get().(*[]metric.AddOption) + *addOpts = append(*addOpts, o) + s.requestBytesCounter.Add(ctx, md.RequestSize, *addOpts...) + s.responseBytesCounter.Add(ctx, md.ResponseSize, *addOpts...) s.serverLatencyMeasure.Record(ctx, md.ElapsedTime, o) + *addOpts = (*addOpts)[:0] + metricAddOptionPool.Put(addOpts) // TODO: Duplicate Metrics } @@ -116,34 +134,43 @@ func NewHTTPServer(meter metric.Meter) HTTPServer { server := HTTPServer{ duplicate: duplicate, } - server.requestBytesCounter, server.responseBytesCounter, server.serverLatencyMeasure = oldHTTPServer{}.createMeasures(meter) + server.requestBytesCounter, server.responseBytesCounter, server.serverLatencyMeasure = OldHTTPServer{}.createMeasures(meter) return server } type HTTPClient struct { duplicate bool + + // old metrics + requestBytesCounter metric.Int64Counter + responseBytesCounter metric.Int64Counter + latencyMeasure metric.Float64Histogram } -func NewHTTPClient() HTTPClient { +func NewHTTPClient(meter metric.Meter) HTTPClient { env := strings.ToLower(os.Getenv("OTEL_SEMCONV_STABILITY_OPT_IN")) - return HTTPClient{duplicate: env == "http/dup"} + client := HTTPClient{ + duplicate: env == "http/dup", + } + client.requestBytesCounter, client.responseBytesCounter, client.latencyMeasure = OldHTTPClient{}.createMeasures(meter) + return client } // RequestTraceAttrs returns attributes for an HTTP request made by a client. func (c HTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { if c.duplicate { - return append(oldHTTPClient{}.RequestTraceAttrs(req), newHTTPClient{}.RequestTraceAttrs(req)...) + return append(OldHTTPClient{}.RequestTraceAttrs(req), CurrentHTTPClient{}.RequestTraceAttrs(req)...) } - return oldHTTPClient{}.RequestTraceAttrs(req) + return OldHTTPClient{}.RequestTraceAttrs(req) } // ResponseTraceAttrs returns metric attributes for an HTTP request made by a client. func (c HTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { if c.duplicate { - return append(oldHTTPClient{}.ResponseTraceAttrs(resp), newHTTPClient{}.ResponseTraceAttrs(resp)...) + return append(OldHTTPClient{}.ResponseTraceAttrs(resp), CurrentHTTPClient{}.ResponseTraceAttrs(resp)...) } - return oldHTTPClient{}.ResponseTraceAttrs(resp) + return OldHTTPClient{}.ResponseTraceAttrs(resp) } func (c HTTPClient) Status(code int) (codes.Code, string) { @@ -158,8 +185,53 @@ func (c HTTPClient) Status(code int) (codes.Code, string) { func (c HTTPClient) ErrorType(err error) attribute.KeyValue { if c.duplicate { - return newHTTPClient{}.ErrorType(err) + return CurrentHTTPClient{}.ErrorType(err) } return attribute.KeyValue{} } + +type MetricOpts struct { + measurement metric.MeasurementOption + addOptions metric.AddOption +} + +func (o MetricOpts) MeasurementOption() metric.MeasurementOption { + return o.measurement +} + +func (o MetricOpts) AddOptions() metric.AddOption { + return o.addOptions +} + +func (c HTTPClient) MetricOptions(ma MetricAttributes) MetricOpts { + attributes := OldHTTPClient{}.MetricAttributes(ma.Req, ma.StatusCode, ma.AdditionalAttributes) + // TODO: Duplicate Metrics + set := metric.WithAttributeSet(attribute.NewSet(attributes...)) + return MetricOpts{ + measurement: set, + addOptions: set, + } +} + +func (s HTTPClient) RecordMetrics(ctx context.Context, md MetricData, opts MetricOpts) { + if s.requestBytesCounter == nil || s.latencyMeasure == nil { + // This will happen if an HTTPClient{} is used instead of NewHTTPClient(). + return + } + + s.requestBytesCounter.Add(ctx, md.RequestSize, opts.AddOptions()) + s.latencyMeasure.Record(ctx, md.ElapsedTime, opts.MeasurementOption()) + + // TODO: Duplicate Metrics +} + +func (s HTTPClient) RecordResponseSize(ctx context.Context, responseData int64, opts metric.AddOption) { + if s.responseBytesCounter == nil { + // This will happen if an HTTPClient{} is used instead of NewHTTPClient(). + return + } + + s.responseBytesCounter.Add(ctx, responseData, opts) + // TODO: Duplicate Metrics +} diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/httpconv.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/httpconv.go index 745b8c67bc40c..dc9ec7bc39edd 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/httpconv.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/httpconv.go @@ -14,7 +14,7 @@ import ( semconvNew "go.opentelemetry.io/otel/semconv/v1.26.0" ) -type newHTTPServer struct{} +type CurrentHTTPServer struct{} // TraceRequest returns trace attributes for an HTTP request received by a // server. @@ -32,18 +32,18 @@ type newHTTPServer struct{} // // If the primary server name is not known, server should be an empty string. // The req Host will be used to determine the server instead. -func (n newHTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { +func (n CurrentHTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { count := 3 // ServerAddress, Method, Scheme var host string var p int if server == "" { - host, p = splitHostPort(req.Host) + host, p = SplitHostPort(req.Host) } else { // Prioritize the primary server name. - host, p = splitHostPort(server) + host, p = SplitHostPort(server) if p < 0 { - _, p = splitHostPort(req.Host) + _, p = SplitHostPort(req.Host) } } @@ -59,7 +59,7 @@ func (n newHTTPServer) RequestTraceAttrs(server string, req *http.Request) []att scheme := n.scheme(req.TLS != nil) - if peer, peerPort := splitHostPort(req.RemoteAddr); peer != "" { + if peer, peerPort := SplitHostPort(req.RemoteAddr); peer != "" { // The Go HTTP server sets RemoteAddr to "IP:port", this will not be a // file-path that would be interpreted with a sock family. count++ @@ -104,7 +104,7 @@ func (n newHTTPServer) RequestTraceAttrs(server string, req *http.Request) []att attrs = append(attrs, methodOriginal) } - if peer, peerPort := splitHostPort(req.RemoteAddr); peer != "" { + if peer, peerPort := SplitHostPort(req.RemoteAddr); peer != "" { // The Go HTTP server sets RemoteAddr to "IP:port", this will not be a // file-path that would be interpreted with a sock family. attrs = append(attrs, semconvNew.NetworkPeerAddress(peer)) @@ -135,7 +135,7 @@ func (n newHTTPServer) RequestTraceAttrs(server string, req *http.Request) []att return attrs } -func (n newHTTPServer) method(method string) (attribute.KeyValue, attribute.KeyValue) { +func (n CurrentHTTPServer) method(method string) (attribute.KeyValue, attribute.KeyValue) { if method == "" { return semconvNew.HTTPRequestMethodGet, attribute.KeyValue{} } @@ -150,7 +150,7 @@ func (n newHTTPServer) method(method string) (attribute.KeyValue, attribute.KeyV return semconvNew.HTTPRequestMethodGet, orig } -func (n newHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive +func (n CurrentHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive if https { return semconvNew.URLScheme("https") } @@ -160,7 +160,7 @@ func (n newHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive // TraceResponse returns trace attributes for telemetry from an HTTP response. // // If any of the fields in the ResponseTelemetry are not set the attribute will be omitted. -func (n newHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { +func (n CurrentHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { var count int if resp.ReadBytes > 0 { @@ -195,14 +195,14 @@ func (n newHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.Ke } // Route returns the attribute for the route. -func (n newHTTPServer) Route(route string) attribute.KeyValue { +func (n CurrentHTTPServer) Route(route string) attribute.KeyValue { return semconvNew.HTTPRoute(route) } -type newHTTPClient struct{} +type CurrentHTTPClient struct{} // RequestTraceAttrs returns trace attributes for an HTTP request made by a client. -func (n newHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { +func (n CurrentHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { /* below attributes are returned: - http.request.method @@ -222,7 +222,7 @@ func (n newHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue var requestHost string var requestPort int for _, hostport := range []string{urlHost, req.Header.Get("Host")} { - requestHost, requestPort = splitHostPort(hostport) + requestHost, requestPort = SplitHostPort(hostport) if requestHost != "" || requestPort > 0 { break } @@ -284,7 +284,7 @@ func (n newHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue } // ResponseTraceAttrs returns trace attributes for an HTTP response made by a client. -func (n newHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { +func (n CurrentHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { /* below attributes are returned: - http.response.status_code @@ -311,7 +311,7 @@ func (n newHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyVa return attrs } -func (n newHTTPClient) ErrorType(err error) attribute.KeyValue { +func (n CurrentHTTPClient) ErrorType(err error) attribute.KeyValue { t := reflect.TypeOf(err) var value string if t.PkgPath() == "" && t.Name() == "" { @@ -328,7 +328,7 @@ func (n newHTTPClient) ErrorType(err error) attribute.KeyValue { return semconvNew.ErrorTypeKey.String(value) } -func (n newHTTPClient) method(method string) (attribute.KeyValue, attribute.KeyValue) { +func (n CurrentHTTPClient) method(method string) (attribute.KeyValue, attribute.KeyValue) { if method == "" { return semconvNew.HTTPRequestMethodGet, attribute.KeyValue{} } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/util.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/util.go index e6e14924f5790..93e8d0f94c115 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/util.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/util.go @@ -14,14 +14,14 @@ import ( semconvNew "go.opentelemetry.io/otel/semconv/v1.26.0" ) -// splitHostPort splits a network address hostport of the form "host", +// SplitHostPort splits a network address hostport of the form "host", // "host%zone", "[host]", "[host%zone], "host:port", "host%zone:port", // "[host]:port", "[host%zone]:port", or ":port" into host or host%zone and // port. // // An empty host is returned if it is not provided or unparsable. A negative // port is returned if it is not provided or unparsable. -func splitHostPort(hostport string) (host string, port int) { +func SplitHostPort(hostport string) (host string, port int) { port = -1 if strings.HasPrefix(hostport, "[") { diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/v1.20.0.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/v1.20.0.go index c999b05e675b2..c042249dd7249 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/v1.20.0.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/v1.20.0.go @@ -17,7 +17,7 @@ import ( semconv "go.opentelemetry.io/otel/semconv/v1.20.0" ) -type oldHTTPServer struct{} +type OldHTTPServer struct{} // RequestTraceAttrs returns trace attributes for an HTTP request received by a // server. @@ -35,14 +35,14 @@ type oldHTTPServer struct{} // // If the primary server name is not known, server should be an empty string. // The req Host will be used to determine the server instead. -func (o oldHTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { +func (o OldHTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { return semconvutil.HTTPServerRequest(server, req) } // ResponseTraceAttrs returns trace attributes for telemetry from an HTTP response. // // If any of the fields in the ResponseTelemetry are not set the attribute will be omitted. -func (o oldHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { +func (o OldHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { attributes := []attribute.KeyValue{} if resp.ReadBytes > 0 { @@ -67,7 +67,7 @@ func (o oldHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.Ke } // Route returns the attribute for the route. -func (o oldHTTPServer) Route(route string) attribute.KeyValue { +func (o OldHTTPServer) Route(route string) attribute.KeyValue { return semconv.HTTPRoute(route) } @@ -84,7 +84,7 @@ const ( serverDuration = "http.server.duration" // Incoming end to end duration, milliseconds ) -func (h oldHTTPServer) createMeasures(meter metric.Meter) (metric.Int64Counter, metric.Int64Counter, metric.Float64Histogram) { +func (h OldHTTPServer) createMeasures(meter metric.Meter) (metric.Int64Counter, metric.Int64Counter, metric.Float64Histogram) { if meter == nil { return noop.Int64Counter{}, noop.Int64Counter{}, noop.Float64Histogram{} } @@ -113,17 +113,17 @@ func (h oldHTTPServer) createMeasures(meter metric.Meter) (metric.Int64Counter, return requestBytesCounter, responseBytesCounter, serverLatencyMeasure } -func (o oldHTTPServer) MetricAttributes(server string, req *http.Request, statusCode int, additionalAttributes []attribute.KeyValue) []attribute.KeyValue { +func (o OldHTTPServer) MetricAttributes(server string, req *http.Request, statusCode int, additionalAttributes []attribute.KeyValue) []attribute.KeyValue { n := len(additionalAttributes) + 3 var host string var p int if server == "" { - host, p = splitHostPort(req.Host) + host, p = SplitHostPort(req.Host) } else { // Prioritize the primary server name. - host, p = splitHostPort(server) + host, p = SplitHostPort(server) if p < 0 { - _, p = splitHostPort(req.Host) + _, p = SplitHostPort(req.Host) } } hostPort := requiredHTTPPort(req.TLS != nil, p) @@ -144,7 +144,7 @@ func (o oldHTTPServer) MetricAttributes(server string, req *http.Request, status attributes := slices.Grow(additionalAttributes, n) attributes = append(attributes, - o.methodMetric(req.Method), + standardizeHTTPMethodMetric(req.Method), o.scheme(req.TLS != nil), semconv.NetHostName(host)) @@ -164,29 +164,111 @@ func (o oldHTTPServer) MetricAttributes(server string, req *http.Request, status return attributes } -func (o oldHTTPServer) methodMetric(method string) attribute.KeyValue { - method = strings.ToUpper(method) - switch method { - case http.MethodConnect, http.MethodDelete, http.MethodGet, http.MethodHead, http.MethodOptions, http.MethodPatch, http.MethodPost, http.MethodPut, http.MethodTrace: - default: - method = "_OTHER" - } - return semconv.HTTPMethod(method) -} - -func (o oldHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive +func (o OldHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive if https { return semconv.HTTPSchemeHTTPS } return semconv.HTTPSchemeHTTP } -type oldHTTPClient struct{} +type OldHTTPClient struct{} -func (o oldHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { +func (o OldHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { return semconvutil.HTTPClientRequest(req) } -func (o oldHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { +func (o OldHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { return semconvutil.HTTPClientResponse(resp) } + +func (o OldHTTPClient) MetricAttributes(req *http.Request, statusCode int, additionalAttributes []attribute.KeyValue) []attribute.KeyValue { + /* The following semantic conventions are returned if present: + http.method string + http.status_code int + net.peer.name string + net.peer.port int + */ + + n := 2 // method, peer name. + var h string + if req.URL != nil { + h = req.URL.Host + } + var requestHost string + var requestPort int + for _, hostport := range []string{h, req.Header.Get("Host")} { + requestHost, requestPort = SplitHostPort(hostport) + if requestHost != "" || requestPort > 0 { + break + } + } + + port := requiredHTTPPort(req.URL != nil && req.URL.Scheme == "https", requestPort) + if port > 0 { + n++ + } + + if statusCode > 0 { + n++ + } + + attributes := slices.Grow(additionalAttributes, n) + attributes = append(attributes, + standardizeHTTPMethodMetric(req.Method), + semconv.NetPeerName(requestHost), + ) + + if port > 0 { + attributes = append(attributes, semconv.NetPeerPort(port)) + } + + if statusCode > 0 { + attributes = append(attributes, semconv.HTTPStatusCode(statusCode)) + } + return attributes +} + +// Client HTTP metrics. +const ( + clientRequestSize = "http.client.request.size" // Incoming request bytes total + clientResponseSize = "http.client.response.size" // Incoming response bytes total + clientDuration = "http.client.duration" // Incoming end to end duration, milliseconds +) + +func (o OldHTTPClient) createMeasures(meter metric.Meter) (metric.Int64Counter, metric.Int64Counter, metric.Float64Histogram) { + if meter == nil { + return noop.Int64Counter{}, noop.Int64Counter{}, noop.Float64Histogram{} + } + requestBytesCounter, err := meter.Int64Counter( + clientRequestSize, + metric.WithUnit("By"), + metric.WithDescription("Measures the size of HTTP request messages."), + ) + handleErr(err) + + responseBytesCounter, err := meter.Int64Counter( + clientResponseSize, + metric.WithUnit("By"), + metric.WithDescription("Measures the size of HTTP response messages."), + ) + handleErr(err) + + latencyMeasure, err := meter.Float64Histogram( + clientDuration, + metric.WithUnit("ms"), + metric.WithDescription("Measures the duration of outbound HTTP requests."), + ) + handleErr(err) + + return requestBytesCounter, responseBytesCounter, latencyMeasure +} + +func standardizeHTTPMethodMetric(method string) attribute.KeyValue { + method = strings.ToUpper(method) + switch method { + case http.MethodConnect, http.MethodDelete, http.MethodGet, http.MethodHead, http.MethodOptions, http.MethodPatch, http.MethodPost, http.MethodPut, http.MethodTrace: + default: + method = "_OTHER" + } + return semconv.HTTPMethod(method) +} diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/start_time_context.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/start_time_context.go new file mode 100644 index 0000000000000..9476ef01b0155 --- /dev/null +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/start_time_context.go @@ -0,0 +1,29 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package otelhttp // import "go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp" + +import ( + "context" + "time" +) + +type startTimeContextKeyType int + +const startTimeContextKey startTimeContextKeyType = 0 + +// ContextWithStartTime returns a new context with the provided start time. The +// start time will be used for metrics and traces emitted by the +// instrumentation. Only one labeller can be injected into the context. +// Injecting it multiple times will override the previous calls. +func ContextWithStartTime(parent context.Context, start time.Time) context.Context { + return context.WithValue(parent, startTimeContextKey, start) +} + +// StartTimeFromContext retrieves a time.Time from the provided context if one +// is available. If no start time was found in the provided context, a new, +// zero start time is returned and the second return value is false. +func StartTimeFromContext(ctx context.Context) time.Time { + t, _ := ctx.Value(startTimeContextKey).(time.Time) + return t +} diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/transport.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/transport.go index b4119d3438b7d..39681ad4b0980 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/transport.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/transport.go @@ -13,11 +13,9 @@ import ( "go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request" "go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv" - "go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconvutil" "go.opentelemetry.io/otel" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" - "go.opentelemetry.io/otel/metric" "go.opentelemetry.io/otel/propagation" "go.opentelemetry.io/otel/trace" @@ -29,7 +27,6 @@ type Transport struct { rt http.RoundTripper tracer trace.Tracer - meter metric.Meter propagators propagation.TextMapPropagator spanStartOptions []trace.SpanStartOption filters []Filter @@ -37,10 +34,7 @@ type Transport struct { clientTrace func(context.Context) *httptrace.ClientTrace metricAttributesFn func(*http.Request) []attribute.KeyValue - semconv semconv.HTTPClient - requestBytesCounter metric.Int64Counter - responseBytesCounter metric.Int64Counter - latencyMeasure metric.Float64Histogram + semconv semconv.HTTPClient } var _ http.RoundTripper = &Transport{} @@ -57,8 +51,7 @@ func NewTransport(base http.RoundTripper, opts ...Option) *Transport { } t := Transport{ - rt: base, - semconv: semconv.NewHTTPClient(), + rt: base, } defaultOpts := []Option{ @@ -68,46 +61,21 @@ func NewTransport(base http.RoundTripper, opts ...Option) *Transport { c := newConfig(append(defaultOpts, opts...)...) t.applyConfig(c) - t.createMeasures() return &t } func (t *Transport) applyConfig(c *config) { t.tracer = c.Tracer - t.meter = c.Meter t.propagators = c.Propagators t.spanStartOptions = c.SpanStartOptions t.filters = c.Filters t.spanNameFormatter = c.SpanNameFormatter t.clientTrace = c.ClientTrace + t.semconv = semconv.NewHTTPClient(c.Meter) t.metricAttributesFn = c.MetricAttributesFn } -func (t *Transport) createMeasures() { - var err error - t.requestBytesCounter, err = t.meter.Int64Counter( - clientRequestSize, - metric.WithUnit("By"), - metric.WithDescription("Measures the size of HTTP request messages."), - ) - handleErr(err) - - t.responseBytesCounter, err = t.meter.Int64Counter( - clientResponseSize, - metric.WithUnit("By"), - metric.WithDescription("Measures the size of HTTP response messages."), - ) - handleErr(err) - - t.latencyMeasure, err = t.meter.Float64Histogram( - clientDuration, - metric.WithUnit("ms"), - metric.WithDescription("Measures the duration of outbound HTTP requests."), - ) - handleErr(err) -} - func defaultTransportFormatter(_ string, r *http.Request) string { return "HTTP " + r.Method } @@ -177,16 +145,15 @@ func (t *Transport) RoundTrip(r *http.Request) (*http.Response, error) { } // metrics - metricAttrs := append(append(labeler.Get(), semconvutil.HTTPClientRequestMetrics(r)...), t.metricAttributesFromRequest(r)...) - if res.StatusCode > 0 { - metricAttrs = append(metricAttrs, semconv.HTTPStatusCode(res.StatusCode)) - } - o := metric.WithAttributeSet(attribute.NewSet(metricAttrs...)) + metricOpts := t.semconv.MetricOptions(semconv.MetricAttributes{ + Req: r, + StatusCode: res.StatusCode, + AdditionalAttributes: append(labeler.Get(), t.metricAttributesFromRequest(r)...), + }) - t.requestBytesCounter.Add(ctx, bw.BytesRead(), o) // For handling response bytes we leverage a callback when the client reads the http response readRecordFunc := func(n int64) { - t.responseBytesCounter.Add(ctx, n, o) + t.semconv.RecordResponseSize(ctx, n, metricOpts.AddOptions()) } // traces @@ -198,9 +165,12 @@ func (t *Transport) RoundTrip(r *http.Request) (*http.Response, error) { // Use floating point division here for higher precision (instead of Millisecond method). elapsedTime := float64(time.Since(requestStartTime)) / float64(time.Millisecond) - t.latencyMeasure.Record(ctx, elapsedTime, o) + t.semconv.RecordMetrics(ctx, semconv.MetricData{ + RequestSize: bw.BytesRead(), + ElapsedTime: elapsedTime, + }, metricOpts) - return res, err + return res, nil } func (t *Transport) metricAttributesFromRequest(r *http.Request) []attribute.KeyValue { diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/version.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/version.go index 502c1bdafc791..353e43b91fd88 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/version.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/version.go @@ -5,7 +5,7 @@ package otelhttp // import "go.opentelemetry.io/contrib/instrumentation/net/http // Version is the current release version of the otelhttp instrumentation. func Version() string { - return "0.54.0" + return "0.58.0" // This string is updated by the pre_release.sh script during release } diff --git a/vendor/go.opentelemetry.io/otel/sdk/instrumentation/scope.go b/vendor/go.opentelemetry.io/otel/sdk/instrumentation/scope.go index 728115045bb4e..34852a47b2195 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/instrumentation/scope.go +++ b/vendor/go.opentelemetry.io/otel/sdk/instrumentation/scope.go @@ -3,6 +3,8 @@ package instrumentation // import "go.opentelemetry.io/otel/sdk/instrumentation" +import "go.opentelemetry.io/otel/attribute" + // Scope represents the instrumentation scope. type Scope struct { // Name is the name of the instrumentation scope. This should be the @@ -12,4 +14,6 @@ type Scope struct { Version string // SchemaURL of the telemetry emitted by the scope. SchemaURL string + // Attributes of the telemetry emitted by the scope. + Attributes attribute.Set } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/config.go b/vendor/go.opentelemetry.io/otel/sdk/metric/config.go index bbe7bf671fd0f..203cd9d65080b 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/config.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/config.go @@ -5,17 +5,22 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" import ( "context" - "fmt" + "errors" + "os" + "strings" "sync" + "go.opentelemetry.io/otel" + "go.opentelemetry.io/otel/sdk/metric/exemplar" "go.opentelemetry.io/otel/sdk/resource" ) // config contains configuration options for a MeterProvider. type config struct { - res *resource.Resource - readers []Reader - views []View + res *resource.Resource + readers []Reader + views []View + exemplarFilter exemplar.Filter } // readerSignals returns a force-flush and shutdown function for a @@ -39,25 +44,13 @@ func (c config) readerSignals() (forceFlush, shutdown func(context.Context) erro // value. func unify(funcs []func(context.Context) error) func(context.Context) error { return func(ctx context.Context) error { - var errs []error + var err error for _, f := range funcs { - if err := f(ctx); err != nil { - errs = append(errs, err) + if e := f(ctx); e != nil { + err = errors.Join(err, e) } } - return unifyErrors(errs) - } -} - -// unifyErrors combines multiple errors into a single error. -func unifyErrors(errs []error) error { - switch len(errs) { - case 0: - return nil - case 1: - return errs[0] - default: - return fmt.Errorf("%v", errs) + return err } } @@ -75,7 +68,13 @@ func unifyShutdown(funcs []func(context.Context) error) func(context.Context) er // newConfig returns a config configured with options. func newConfig(options []Option) config { - conf := config{res: resource.Default()} + conf := config{ + res: resource.Default(), + exemplarFilter: exemplar.TraceBasedFilter, + } + for _, o := range meterProviderOptionsFromEnv() { + conf = o.apply(conf) + } for _, o := range options { conf = o.apply(conf) } @@ -103,7 +102,11 @@ func (o optionFunc) apply(conf config) config { // go.opentelemetry.io/otel/sdk/resource package will be used. func WithResource(res *resource.Resource) Option { return optionFunc(func(conf config) config { - conf.res = res + var err error + conf.res, err = resource.Merge(resource.Environment(), res) + if err != nil { + otel.Handle(err) + } return conf }) } @@ -135,3 +138,35 @@ func WithView(views ...View) Option { return cfg }) } + +// WithExemplarFilter configures the exemplar filter. +// +// The exemplar filter determines which measurements are offered to the +// exemplar reservoir, but the exemplar reservoir makes the final decision of +// whether to store an exemplar. +// +// By default, the [exemplar.SampledFilter] +// is used. Exemplars can be entirely disabled by providing the +// [exemplar.AlwaysOffFilter]. +func WithExemplarFilter(filter exemplar.Filter) Option { + return optionFunc(func(cfg config) config { + cfg.exemplarFilter = filter + return cfg + }) +} + +func meterProviderOptionsFromEnv() []Option { + var opts []Option + // https://github.com/open-telemetry/opentelemetry-specification/blob/d4b241f451674e8f611bb589477680341006ad2b/specification/configuration/sdk-environment-variables.md#exemplar + const filterEnvKey = "OTEL_METRICS_EXEMPLAR_FILTER" + + switch strings.ToLower(strings.TrimSpace(os.Getenv(filterEnvKey))) { + case "always_on": + opts = append(opts, WithExemplarFilter(exemplar.AlwaysOnFilter)) + case "always_off": + opts = append(opts, WithExemplarFilter(exemplar.AlwaysOffFilter)) + case "trace_based": + opts = append(opts, WithExemplarFilter(exemplar.TraceBasedFilter)) + } + return opts +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar.go index 82619da78ec15..0335b8ae48e23 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar.go @@ -4,51 +4,49 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" import ( - "os" "runtime" - "slices" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" - "go.opentelemetry.io/otel/sdk/metric/internal/x" + "go.opentelemetry.io/otel/attribute" + "go.opentelemetry.io/otel/sdk/metric/exemplar" + "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" ) -// reservoirFunc returns the appropriately configured exemplar reservoir -// creation func based on the passed InstrumentKind and user defined -// environment variables. -// -// Note: This will only return non-nil values when the experimental exemplar -// feature is enabled and the OTEL_METRICS_EXEMPLAR_FILTER environment variable -// is not set to always_off. -func reservoirFunc[N int64 | float64](agg Aggregation) func() exemplar.FilteredReservoir[N] { - if !x.Exemplars.Enabled() { - return nil - } - // https://github.com/open-telemetry/opentelemetry-specification/blob/d4b241f451674e8f611bb589477680341006ad2b/specification/configuration/sdk-environment-variables.md#exemplar - const filterEnvKey = "OTEL_METRICS_EXEMPLAR_FILTER" +// ExemplarReservoirProviderSelector selects the +// [exemplar.ReservoirProvider] to use +// based on the [Aggregation] of the metric. +type ExemplarReservoirProviderSelector func(Aggregation) exemplar.ReservoirProvider - var filter exemplar.Filter - - switch os.Getenv(filterEnvKey) { - case "always_on": - filter = exemplar.AlwaysOnFilter - case "always_off": - return exemplar.Drop - case "trace_based": - fallthrough - default: - filter = exemplar.SampledFilter +// reservoirFunc returns the appropriately configured exemplar reservoir +// creation func based on the passed InstrumentKind and filter configuration. +func reservoirFunc[N int64 | float64](provider exemplar.ReservoirProvider, filter exemplar.Filter) func(attribute.Set) aggregate.FilteredExemplarReservoir[N] { + return func(attrs attribute.Set) aggregate.FilteredExemplarReservoir[N] { + return aggregate.NewFilteredExemplarReservoir[N](filter, provider(attrs)) } +} +// DefaultExemplarReservoirProviderSelector returns the default +// [exemplar.ReservoirProvider] for the +// provided [Aggregation]. +// +// For explicit bucket histograms with more than 1 bucket, it uses the +// [exemplar.HistogramReservoirProvider]. +// For exponential histograms, it uses the +// [exemplar.FixedSizeReservoirProvider] +// with a size of min(20, max_buckets). +// For all other aggregations, it uses the +// [exemplar.FixedSizeReservoirProvider] +// with a size equal to the number of CPUs. +// +// Exemplar default reservoirs MAY change in a minor version bump. No +// guarantees are made on the shape or statistical properties of returned +// exemplars. +func DefaultExemplarReservoirProviderSelector(agg Aggregation) exemplar.ReservoirProvider { // https://github.com/open-telemetry/opentelemetry-specification/blob/d4b241f451674e8f611bb589477680341006ad2b/specification/metrics/sdk.md#exemplar-defaults // Explicit bucket histogram aggregation with more than 1 bucket will // use AlignedHistogramBucketExemplarReservoir. a, ok := agg.(AggregationExplicitBucketHistogram) if ok && len(a.Boundaries) > 0 { - cp := slices.Clone(a.Boundaries) - return func() exemplar.FilteredReservoir[N] { - bounds := cp - return exemplar.NewFilteredReservoir[N](filter, exemplar.Histogram(bounds)) - } + return exemplar.HistogramReservoirProvider(a.Boundaries) } var n int @@ -75,7 +73,5 @@ func reservoirFunc[N int64 | float64](agg Aggregation) func() exemplar.FilteredR } } - return func() exemplar.FilteredReservoir[N] { - return exemplar.NewFilteredReservoir[N](filter, exemplar.FixedSize(n)) - } + return exemplar.FixedSizeReservoirProvider(n) } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/README.md b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/README.md new file mode 100644 index 0000000000000..d1025f5eb894d --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/README.md @@ -0,0 +1,3 @@ +# Metric SDK Exemplars + +[![PkgGoDev](https://pkg.go.dev/badge/go.opentelemetry.io/otel/sdk/metric/exemplar)](https://pkg.go.dev/go.opentelemetry.io/otel/sdk/metric/exemplar) diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/doc.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/doc.go similarity index 93% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/doc.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/doc.go index 5394f48e0dfb9..9f238937688db 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/doc.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/doc.go @@ -3,4 +3,4 @@ // Package exemplar provides an implementation of the OpenTelemetry exemplar // reservoir to be used in metric collection pipelines. -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/exemplar.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/exemplar.go similarity index 98% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/exemplar.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/exemplar.go index fcaa6a4697ca8..1ab69467868ac 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/exemplar.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/exemplar.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "time" diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filter.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/filter.go similarity index 75% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filter.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/filter.go index 152a069a09e94..b595e2acef3d6 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filter.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/filter.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "context" @@ -16,10 +16,10 @@ import ( // Reservoir in making a sampling decision. type Filter func(context.Context) bool -// SampledFilter is a [Filter] that will only offer measurements +// TraceBasedFilter is a [Filter] that will only offer measurements // if the passed context associated with the measurement contains a sampled // [go.opentelemetry.io/otel/trace.SpanContext]. -func SampledFilter(ctx context.Context) bool { +func TraceBasedFilter(ctx context.Context) bool { return trace.SpanContextFromContext(ctx).IsSampled() } @@ -27,3 +27,8 @@ func SampledFilter(ctx context.Context) bool { func AlwaysOnFilter(ctx context.Context) bool { return true } + +// AlwaysOffFilter is a [Filter] that never offers measurements. +func AlwaysOffFilter(ctx context.Context) bool { + return false +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/rand.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/fixed_size_reservoir.go similarity index 73% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/rand.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/fixed_size_reservoir.go index 199a2608f7180..d4aab0aad4f83 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/rand.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/fixed_size_reservoir.go @@ -1,31 +1,69 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "context" "math" "math/rand" - "sync" "time" "go.opentelemetry.io/otel/attribute" ) -var ( +// FixedSizeReservoirProvider returns a provider of [FixedSizeReservoir]. +func FixedSizeReservoirProvider(k int) ReservoirProvider { + return func(_ attribute.Set) Reservoir { + return NewFixedSizeReservoir(k) + } +} + +// NewFixedSizeReservoir returns a [FixedSizeReservoir] that samples at most +// k exemplars. If there are k or less measurements made, the Reservoir will +// sample each one. If there are more than k, the Reservoir will then randomly +// sample all additional measurement with a decreasing probability. +func NewFixedSizeReservoir(k int) *FixedSizeReservoir { + return newFixedSizeReservoir(newStorage(k)) +} + +var _ Reservoir = &FixedSizeReservoir{} + +// FixedSizeReservoir is a [Reservoir] that samples at most k exemplars. If +// there are k or less measurements made, the Reservoir will sample each one. +// If there are more than k, the Reservoir will then randomly sample all +// additional measurement with a decreasing probability. +type FixedSizeReservoir struct { + *storage + + // count is the number of measurement seen. + count int64 + // next is the next count that will store a measurement at a random index + // once the reservoir has been filled. + next int64 + // w is the largest random number in a distribution that is used to compute + // the next next. + w float64 + // rng is used to make sampling decisions. // // Do not use crypto/rand. There is no reason for the decrease in performance // given this is not a security sensitive decision. - rng = rand.New(rand.NewSource(time.Now().UnixNano())) - // Ensure concurrent safe accecess to rng and its underlying source. - rngMu sync.Mutex -) + rng *rand.Rand +} -// random returns, as a float64, a uniform pseudo-random number in the open -// interval (0.0,1.0). -func random() float64 { +func newFixedSizeReservoir(s *storage) *FixedSizeReservoir { + r := &FixedSizeReservoir{ + storage: s, + rng: rand.New(rand.NewSource(time.Now().UnixNano())), + } + r.reset() + return r +} + +// randomFloat64 returns, as a float64, a uniform pseudo-random number in the +// open interval (0.0,1.0). +func (r *FixedSizeReservoir) randomFloat64() float64 { // TODO: This does not return a uniform number. rng.Float64 returns a // uniformly random int in [0,2^53) that is divided by 2^53. Meaning it // returns multiples of 2^-53, and not all floating point numbers between 0 @@ -43,40 +81,25 @@ func random() float64 { // // There are likely many other methods to explore here as well. - rngMu.Lock() - defer rngMu.Unlock() - - f := rng.Float64() + f := r.rng.Float64() for f == 0 { - f = rng.Float64() + f = r.rng.Float64() } return f } -// FixedSize returns a [Reservoir] that samples at most k exemplars. If there -// are k or less measurements made, the Reservoir will sample each one. If -// there are more than k, the Reservoir will then randomly sample all -// additional measurement with a decreasing probability. -func FixedSize(k int) Reservoir { - r := &randRes{storage: newStorage(k)} - r.reset() - return r -} - -type randRes struct { - *storage - - // count is the number of measurement seen. - count int64 - // next is the next count that will store a measurement at a random index - // once the reservoir has been filled. - next int64 - // w is the largest random number in a distribution that is used to compute - // the next next. - w float64 -} - -func (r *randRes) Offer(ctx context.Context, t time.Time, n Value, a []attribute.KeyValue) { +// Offer accepts the parameters associated with a measurement. The +// parameters will be stored as an exemplar if the Reservoir decides to +// sample the measurement. +// +// The passed ctx needs to contain any baggage or span that were active +// when the measurement was made. This information may be used by the +// Reservoir in making a sampling decision. +// +// The time t is the time when the measurement was made. The v and a +// parameters are the value and dropped (filtered) attributes of the +// measurement respectively. +func (r *FixedSizeReservoir) Offer(ctx context.Context, t time.Time, n Value, a []attribute.KeyValue) { // The following algorithm is "Algorithm L" from Li, Kim-Hung (4 December // 1994). "Reservoir-Sampling Algorithms of Time Complexity // O(n(1+log(N/n)))". ACM Transactions on Mathematical Software. 20 (4): @@ -123,7 +146,7 @@ func (r *randRes) Offer(ctx context.Context, t time.Time, n Value, a []attribute } else { if r.count == r.next { // Overwrite a random existing measurement with the one offered. - idx := int(rng.Int63n(int64(cap(r.store)))) + idx := int(r.rng.Int63n(int64(cap(r.store)))) r.store[idx] = newMeasurement(ctx, t, n, a) r.advance() } @@ -132,7 +155,7 @@ func (r *randRes) Offer(ctx context.Context, t time.Time, n Value, a []attribute } // reset resets r to the initial state. -func (r *randRes) reset() { +func (r *FixedSizeReservoir) reset() { // This resets the number of exemplars known. r.count = 0 // Random index inserts should only happen after the storage is full. @@ -147,14 +170,14 @@ func (r *randRes) reset() { // This maps the uniform random number in (0,1) to a geometric distribution // over the same interval. The mean of the distribution is inversely // proportional to the storage capacity. - r.w = math.Exp(math.Log(random()) / float64(cap(r.store))) + r.w = math.Exp(math.Log(r.randomFloat64()) / float64(cap(r.store))) r.advance() } // advance updates the count at which the offered measurement will overwrite an // existing exemplar. -func (r *randRes) advance() { +func (r *FixedSizeReservoir) advance() { // Calculate the next value in the random number series. // // The current value of r.w is based on the max of a distribution of random @@ -167,7 +190,7 @@ func (r *randRes) advance() { // therefore the next r.w will be based on the same distribution (i.e. // `max(u_1,u_2,...,u_k)`). Therefore, we can sample the next r.w by // computing the next random number `u` and take r.w as `w * u^(1/k)`. - r.w *= math.Exp(math.Log(random()) / float64(cap(r.store))) + r.w *= math.Exp(math.Log(r.randomFloat64()) / float64(cap(r.store))) // Use the new random number in the series to calculate the count of the // next measurement that will be stored. // @@ -178,10 +201,13 @@ func (r *randRes) advance() { // // Important to note, the new r.next will always be at least 1 more than // the last r.next. - r.next += int64(math.Log(random())/math.Log(1-r.w)) + 1 + r.next += int64(math.Log(r.randomFloat64())/math.Log(1-r.w)) + 1 } -func (r *randRes) Collect(dest *[]Exemplar) { +// Collect returns all the held exemplars. +// +// The Reservoir state is preserved after this call. +func (r *FixedSizeReservoir) Collect(dest *[]Exemplar) { r.storage.Collect(dest) // Call reset here even though it will reset r.count and restart the random // number series. This will persist any old exemplars as long as no new diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/histogram_reservoir.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/histogram_reservoir.go new file mode 100644 index 0000000000000..3b76cf305a426 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/histogram_reservoir.go @@ -0,0 +1,70 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" + +import ( + "context" + "slices" + "sort" + "time" + + "go.opentelemetry.io/otel/attribute" +) + +// HistogramReservoirProvider is a provider of [HistogramReservoir]. +func HistogramReservoirProvider(bounds []float64) ReservoirProvider { + cp := slices.Clone(bounds) + slices.Sort(cp) + return func(_ attribute.Set) Reservoir { + return NewHistogramReservoir(cp) + } +} + +// NewHistogramReservoir returns a [HistogramReservoir] that samples the last +// measurement that falls within a histogram bucket. The histogram bucket +// upper-boundaries are define by bounds. +// +// The passed bounds must be sorted before calling this function. +func NewHistogramReservoir(bounds []float64) *HistogramReservoir { + return &HistogramReservoir{ + bounds: bounds, + storage: newStorage(len(bounds) + 1), + } +} + +var _ Reservoir = &HistogramReservoir{} + +// HistogramReservoir is a [Reservoir] that samples the last measurement that +// falls within a histogram bucket. The histogram bucket upper-boundaries are +// define by bounds. +type HistogramReservoir struct { + *storage + + // bounds are bucket bounds in ascending order. + bounds []float64 +} + +// Offer accepts the parameters associated with a measurement. The +// parameters will be stored as an exemplar if the Reservoir decides to +// sample the measurement. +// +// The passed ctx needs to contain any baggage or span that were active +// when the measurement was made. This information may be used by the +// Reservoir in making a sampling decision. +// +// The time t is the time when the measurement was made. The v and a +// parameters are the value and dropped (filtered) attributes of the +// measurement respectively. +func (r *HistogramReservoir) Offer(ctx context.Context, t time.Time, v Value, a []attribute.KeyValue) { + var x float64 + switch v.Type() { + case Int64ValueType: + x = float64(v.Int64()) + case Float64ValueType: + x = v.Float64() + default: + panic("unknown value type") + } + r.store[sort.SearchFloat64s(r.bounds, x)] = newMeasurement(ctx, t, v, a) +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/reservoir.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/reservoir.go similarity index 73% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/reservoir.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/reservoir.go index 80fa59554f201..ba5cd1a6b3d7e 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/reservoir.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/reservoir.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "context" @@ -30,3 +30,11 @@ type Reservoir interface { // The Reservoir state is preserved after this call. Collect(dest *[]Exemplar) } + +// ReservoirProvider creates new [Reservoir]s. +// +// The attributes provided are attributes which are kept by the aggregation, and +// are exclusive with attributes passed to Offer. The combination of these +// attributes and the attributes passed to Offer is the complete set of +// attributes a measurement was made with. +type ReservoirProvider func(attr attribute.Set) Reservoir diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/storage.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/storage.go similarity index 94% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/storage.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/storage.go index 10b2976f7969a..0e2e26dfb18db 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/storage.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/storage.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "context" @@ -35,7 +35,7 @@ func (r *storage) Collect(dest *[]Exemplar) { continue } - m.Exemplar(&(*dest)[n]) + m.exemplar(&(*dest)[n]) n++ } *dest = (*dest)[:n] @@ -66,8 +66,8 @@ func newMeasurement(ctx context.Context, ts time.Time, v Value, droppedAttr []at } } -// Exemplar returns m as an [Exemplar]. -func (m measurement) Exemplar(dest *Exemplar) { +// exemplar returns m as an [Exemplar]. +func (m measurement) exemplar(dest *Exemplar) { dest.FilteredAttributes = m.FilteredAttributes dest.Time = m.Time dest.Value = m.Value diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/value.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/value.go similarity index 91% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/value.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/value.go index 1957d6b1e3a37..590b089a806cc 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/value.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/value.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import "math" @@ -28,7 +28,8 @@ type Value struct { func NewValue[N int64 | float64](value N) Value { switch v := any(value).(type) { case int64: - return Value{t: Int64ValueType, val: uint64(v)} + // This can be later converted back to int64 (overflow not checked). + return Value{t: Int64ValueType, val: uint64(v)} // nolint:gosec case float64: return Value{t: Float64ValueType, val: math.Float64bits(v)} } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/exporter.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exporter.go index 1a3cccb67755e..1969cb42cf441 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/exporter.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exporter.go @@ -5,14 +5,14 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" import ( "context" - "fmt" + "errors" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) // ErrExporterShutdown is returned if Export or Shutdown are called after an // Exporter has been Shutdown. -var ErrExporterShutdown = fmt.Errorf("exporter is shutdown") +var ErrExporterShutdown = errors.New("exporter is shutdown") // Exporter handles the delivery of metric data to external receivers. This is // the final component in the metric push pipeline. diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/instrument.go b/vendor/go.opentelemetry.io/otel/sdk/metric/instrument.go index b52a330b3bc10..c33e1a28cb41b 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/instrument.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/instrument.go @@ -16,6 +16,7 @@ import ( "go.opentelemetry.io/otel/metric/embedded" "go.opentelemetry.io/otel/sdk/instrumentation" "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" + "go.opentelemetry.io/otel/sdk/metric/internal/x" ) var zeroScope instrumentation.Scope @@ -144,6 +145,12 @@ type Stream struct { // Use NewAllowKeysFilter from "go.opentelemetry.io/otel/attribute" to // provide an allow-list of attribute keys here. AttributeFilter attribute.Filter + // ExemplarReservoirProvider selects the + // [go.opentelemetry.io/otel/sdk/metric/exemplar.ReservoirProvider] based + // on the [Aggregation]. + // + // If unspecified, [DefaultExemplarReservoirProviderSelector] is used. + ExemplarReservoirProviderSelector ExemplarReservoirProviderSelector } // instID are the identifying properties of a instrument. @@ -184,6 +191,7 @@ var ( _ metric.Int64UpDownCounter = (*int64Inst)(nil) _ metric.Int64Histogram = (*int64Inst)(nil) _ metric.Int64Gauge = (*int64Inst)(nil) + _ x.EnabledInstrument = (*int64Inst)(nil) ) func (i *int64Inst) Add(ctx context.Context, val int64, opts ...metric.AddOption) { @@ -196,6 +204,10 @@ func (i *int64Inst) Record(ctx context.Context, val int64, opts ...metric.Record i.aggregate(ctx, val, c.Attributes()) } +func (i *int64Inst) Enabled(_ context.Context) bool { + return len(i.measures) != 0 +} + func (i *int64Inst) aggregate(ctx context.Context, val int64, s attribute.Set) { // nolint:revive // okay to shadow pkg with method. for _, in := range i.measures { in(ctx, val, s) @@ -216,6 +228,7 @@ var ( _ metric.Float64UpDownCounter = (*float64Inst)(nil) _ metric.Float64Histogram = (*float64Inst)(nil) _ metric.Float64Gauge = (*float64Inst)(nil) + _ x.EnabledInstrument = (*float64Inst)(nil) ) func (i *float64Inst) Add(ctx context.Context, val float64, opts ...metric.AddOption) { @@ -228,14 +241,18 @@ func (i *float64Inst) Record(ctx context.Context, val float64, opts ...metric.Re i.aggregate(ctx, val, c.Attributes()) } +func (i *float64Inst) Enabled(_ context.Context) bool { + return len(i.measures) != 0 +} + func (i *float64Inst) aggregate(ctx context.Context, val float64, s attribute.Set) { for _, in := range i.measures { in(ctx, val, s) } } -// observablID is a comparable unique identifier of an observable. -type observablID[N int64 | float64] struct { +// observableID is a comparable unique identifier of an observable. +type observableID[N int64 | float64] struct { name string description string kind InstrumentKind @@ -287,7 +304,7 @@ func newInt64Observable(m *meter, kind InstrumentKind, name, desc, u string) int type observable[N int64 | float64] struct { metric.Observable - observablID[N] + observableID[N] meter *meter measures measures[N] @@ -296,7 +313,7 @@ type observable[N int64 | float64] struct { func newObservable[N int64 | float64](m *meter, kind InstrumentKind, name, desc, u string) *observable[N] { return &observable[N]{ - observablID: observablID[N]{ + observableID: observableID[N]{ name: name, description: desc, kind: kind, diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/aggregate.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/aggregate.go index b18ee719bd19a..fde2193338960 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/aggregate.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/aggregate.go @@ -8,7 +8,6 @@ import ( "time" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) @@ -38,8 +37,8 @@ type Builder[N int64 | float64] struct { // create new exemplar reservoirs for a new seen attribute set. // // If this is not provided a default factory function that returns an - // exemplar.Drop reservoir will be used. - ReservoirFunc func() exemplar.FilteredReservoir[N] + // dropReservoir reservoir will be used. + ReservoirFunc func(attribute.Set) FilteredExemplarReservoir[N] // AggregationLimit is the cardinality limit of measurement attributes. Any // measurement for new attributes once the limit has been reached will be // aggregated into a single aggregate for the "otel.metric.overflow" @@ -50,12 +49,12 @@ type Builder[N int64 | float64] struct { AggregationLimit int } -func (b Builder[N]) resFunc() func() exemplar.FilteredReservoir[N] { +func (b Builder[N]) resFunc() func(attribute.Set) FilteredExemplarReservoir[N] { if b.ReservoirFunc != nil { return b.ReservoirFunc } - return exemplar.Drop + return dropReservoir } type fltrMeasure[N int64 | float64] func(ctx context.Context, value N, fltrAttr attribute.Set, droppedAttr []attribute.KeyValue) diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/drop.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/drop.go new file mode 100644 index 0000000000000..8396faaa4aec0 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/drop.go @@ -0,0 +1,27 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package aggregate // import "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" + +import ( + "context" + + "go.opentelemetry.io/otel/attribute" + "go.opentelemetry.io/otel/sdk/metric/exemplar" +) + +// dropReservoir returns a [FilteredReservoir] that drops all measurements it is offered. +func dropReservoir[N int64 | float64](attribute.Set) FilteredExemplarReservoir[N] { + return &dropRes[N]{} +} + +type dropRes[N int64 | float64] struct{} + +// Offer does nothing, all measurements offered will be dropped. +func (r *dropRes[N]) Offer(context.Context, N, []attribute.KeyValue) {} + +// Collect resets dest. No exemplars will ever be returned. +func (r *dropRes[N]) Collect(dest *[]exemplar.Exemplar) { + clear(*dest) // Erase elements to let GC collect objects + *dest = (*dest)[:0] +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exemplar.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exemplar.go index 170ae8e58e2a2..25d709948e9c9 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exemplar.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exemplar.go @@ -6,7 +6,7 @@ package aggregate // import "go.opentelemetry.io/otel/sdk/metric/internal/aggreg import ( "sync" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" + "go.opentelemetry.io/otel/sdk/metric/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) @@ -17,6 +17,7 @@ var exemplarPool = sync.Pool{ func collectExemplars[N int64 | float64](out *[]metricdata.Exemplar[N], f func(*[]exemplar.Exemplar)) { dest := exemplarPool.Get().(*[]exemplar.Exemplar) defer func() { + clear(*dest) // Erase elements to let GC collect objects. *dest = (*dest)[:0] exemplarPool.Put(dest) }() diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exponential_histogram.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exponential_histogram.go index 707342408acd2..336ea91d1bf4c 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exponential_histogram.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exponential_histogram.go @@ -12,7 +12,6 @@ import ( "go.opentelemetry.io/otel" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) @@ -31,7 +30,7 @@ const ( // expoHistogramDataPoint is a single data point in an exponential histogram. type expoHistogramDataPoint[N int64 | float64] struct { attrs attribute.Set - res exemplar.FilteredReservoir[N] + res FilteredExemplarReservoir[N] count uint64 min N @@ -51,16 +50,16 @@ type expoHistogramDataPoint[N int64 | float64] struct { func newExpoHistogramDataPoint[N int64 | float64](attrs attribute.Set, maxSize int, maxScale int32, noMinMax, noSum bool) *expoHistogramDataPoint[N] { f := math.MaxFloat64 - max := N(f) // if N is int64, max will overflow to -9223372036854775808 - min := N(-f) + ma := N(f) // if N is int64, max will overflow to -9223372036854775808 + mi := N(-f) if N(maxInt64) > N(f) { - max = N(maxInt64) - min = N(minInt64) + ma = N(maxInt64) + mi = N(minInt64) } return &expoHistogramDataPoint[N]{ attrs: attrs, - min: max, - max: min, + min: ma, + max: mi, maxSize: maxSize, noMinMax: noMinMax, noSum: noSum, @@ -284,7 +283,7 @@ func (b *expoBuckets) downscale(delta int32) { // newExponentialHistogram returns an Aggregator that summarizes a set of // measurements as an exponential histogram. Each histogram is scoped by attributes // and the aggregation cycle the measurements were made in. -func newExponentialHistogram[N int64 | float64](maxSize, maxScale int32, noMinMax, noSum bool, limit int, r func() exemplar.FilteredReservoir[N]) *expoHistogram[N] { +func newExponentialHistogram[N int64 | float64](maxSize, maxScale int32, noMinMax, noSum bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *expoHistogram[N] { return &expoHistogram[N]{ noSum: noSum, noMinMax: noMinMax, @@ -307,7 +306,7 @@ type expoHistogram[N int64 | float64] struct { maxSize int maxScale int32 - newRes func() exemplar.FilteredReservoir[N] + newRes func(attribute.Set) FilteredExemplarReservoir[N] limit limiter[*expoHistogramDataPoint[N]] values map[attribute.Distinct]*expoHistogramDataPoint[N] valuesMu sync.Mutex @@ -328,7 +327,7 @@ func (e *expoHistogram[N]) measure(ctx context.Context, value N, fltrAttr attrib v, ok := e.values[attr.Equivalent()] if !ok { v = newExpoHistogramDataPoint[N](attr, e.maxSize, e.maxScale, e.noMinMax, e.noSum) - v.res = e.newRes() + v.res = e.newRes(attr) e.values[attr.Equivalent()] = v } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/filtered_reservoir.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/filtered_reservoir.go new file mode 100644 index 0000000000000..691a910608d3f --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/filtered_reservoir.go @@ -0,0 +1,50 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package aggregate // import "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" + +import ( + "context" + "time" + + "go.opentelemetry.io/otel/attribute" + "go.opentelemetry.io/otel/sdk/metric/exemplar" +) + +// FilteredExemplarReservoir wraps a [exemplar.Reservoir] with a filter. +type FilteredExemplarReservoir[N int64 | float64] interface { + // Offer accepts the parameters associated with a measurement. The + // parameters will be stored as an exemplar if the filter decides to + // sample the measurement. + // + // The passed ctx needs to contain any baggage or span that were active + // when the measurement was made. This information may be used by the + // Reservoir in making a sampling decision. + Offer(ctx context.Context, val N, attr []attribute.KeyValue) + // Collect returns all the held exemplars in the reservoir. + Collect(dest *[]exemplar.Exemplar) +} + +// filteredExemplarReservoir handles the pre-sampled exemplar of measurements made. +type filteredExemplarReservoir[N int64 | float64] struct { + filter exemplar.Filter + reservoir exemplar.Reservoir +} + +// NewFilteredExemplarReservoir creates a [FilteredExemplarReservoir] which only offers values +// that are allowed by the filter. +func NewFilteredExemplarReservoir[N int64 | float64](f exemplar.Filter, r exemplar.Reservoir) FilteredExemplarReservoir[N] { + return &filteredExemplarReservoir[N]{ + filter: f, + reservoir: r, + } +} + +func (f *filteredExemplarReservoir[N]) Offer(ctx context.Context, val N, attr []attribute.KeyValue) { + if f.filter(ctx) { + // only record the current time if we are sampling this measurement. + f.reservoir.Offer(ctx, time.Now(), exemplar.NewValue(val), attr) + } +} + +func (f *filteredExemplarReservoir[N]) Collect(dest *[]exemplar.Exemplar) { f.reservoir.Collect(dest) } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/histogram.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/histogram.go index ade0941f5f5db..d577ae2c198f4 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/histogram.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/histogram.go @@ -11,13 +11,12 @@ import ( "time" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) type buckets[N int64 | float64] struct { attrs attribute.Set - res exemplar.FilteredReservoir[N] + res FilteredExemplarReservoir[N] counts []uint64 count uint64 @@ -48,13 +47,13 @@ type histValues[N int64 | float64] struct { noSum bool bounds []float64 - newRes func() exemplar.FilteredReservoir[N] + newRes func(attribute.Set) FilteredExemplarReservoir[N] limit limiter[*buckets[N]] values map[attribute.Distinct]*buckets[N] valuesMu sync.Mutex } -func newHistValues[N int64 | float64](bounds []float64, noSum bool, limit int, r func() exemplar.FilteredReservoir[N]) *histValues[N] { +func newHistValues[N int64 | float64](bounds []float64, noSum bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *histValues[N] { // The responsibility of keeping all buckets correctly associated with the // passed boundaries is ultimately this type's responsibility. Make a copy // here so we can always guarantee this. Or, in the case of failure, have @@ -94,7 +93,7 @@ func (s *histValues[N]) measure(ctx context.Context, value N, fltrAttr attribute // // buckets = (-∞, 0], (0, 5.0], (5.0, 10.0], (10.0, +∞) b = newBuckets[N](attr, len(s.bounds)+1) - b.res = s.newRes() + b.res = s.newRes(attr) // Ensure min and max are recorded values (not zero), for new buckets. b.min, b.max = value, value @@ -109,7 +108,7 @@ func (s *histValues[N]) measure(ctx context.Context, value N, fltrAttr attribute // newHistogram returns an Aggregator that summarizes a set of measurements as // an histogram. -func newHistogram[N int64 | float64](boundaries []float64, noMinMax, noSum bool, limit int, r func() exemplar.FilteredReservoir[N]) *histogram[N] { +func newHistogram[N int64 | float64](boundaries []float64, noMinMax, noSum bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *histogram[N] { return &histogram[N]{ histValues: newHistValues[N](boundaries, noSum, limit, r), noMinMax: noMinMax, diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/lastvalue.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/lastvalue.go index c359368403e5b..d3a93f085c94e 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/lastvalue.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/lastvalue.go @@ -9,7 +9,6 @@ import ( "time" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) @@ -17,10 +16,10 @@ import ( type datapoint[N int64 | float64] struct { attrs attribute.Set value N - res exemplar.FilteredReservoir[N] + res FilteredExemplarReservoir[N] } -func newLastValue[N int64 | float64](limit int, r func() exemplar.FilteredReservoir[N]) *lastValue[N] { +func newLastValue[N int64 | float64](limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *lastValue[N] { return &lastValue[N]{ newRes: r, limit: newLimiter[datapoint[N]](limit), @@ -33,7 +32,7 @@ func newLastValue[N int64 | float64](limit int, r func() exemplar.FilteredReserv type lastValue[N int64 | float64] struct { sync.Mutex - newRes func() exemplar.FilteredReservoir[N] + newRes func(attribute.Set) FilteredExemplarReservoir[N] limit limiter[datapoint[N]] values map[attribute.Distinct]datapoint[N] start time.Time @@ -46,7 +45,7 @@ func (s *lastValue[N]) measure(ctx context.Context, value N, fltrAttr attribute. attr := s.limit.Attributes(fltrAttr, s.values) d, ok := s.values[attr.Equivalent()] if !ok { - d.res = s.newRes() + d.res = s.newRes(attr) } d.attrs = attr @@ -115,7 +114,7 @@ func (s *lastValue[N]) copyDpts(dest *[]metricdata.DataPoint[N], t time.Time) in // newPrecomputedLastValue returns an aggregator that summarizes a set of // observations as the last one made. -func newPrecomputedLastValue[N int64 | float64](limit int, r func() exemplar.FilteredReservoir[N]) *precomputedLastValue[N] { +func newPrecomputedLastValue[N int64 | float64](limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *precomputedLastValue[N] { return &precomputedLastValue[N]{lastValue: newLastValue[N](limit, r)} } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/sum.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/sum.go index 891366922600e..8e132ad6181b7 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/sum.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/sum.go @@ -9,25 +9,24 @@ import ( "time" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) type sumValue[N int64 | float64] struct { n N - res exemplar.FilteredReservoir[N] + res FilteredExemplarReservoir[N] attrs attribute.Set } // valueMap is the storage for sums. type valueMap[N int64 | float64] struct { sync.Mutex - newRes func() exemplar.FilteredReservoir[N] + newRes func(attribute.Set) FilteredExemplarReservoir[N] limit limiter[sumValue[N]] values map[attribute.Distinct]sumValue[N] } -func newValueMap[N int64 | float64](limit int, r func() exemplar.FilteredReservoir[N]) *valueMap[N] { +func newValueMap[N int64 | float64](limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *valueMap[N] { return &valueMap[N]{ newRes: r, limit: newLimiter[sumValue[N]](limit), @@ -42,7 +41,7 @@ func (s *valueMap[N]) measure(ctx context.Context, value N, fltrAttr attribute.S attr := s.limit.Attributes(fltrAttr, s.values) v, ok := s.values[attr.Equivalent()] if !ok { - v.res = s.newRes() + v.res = s.newRes(attr) } v.attrs = attr @@ -55,7 +54,7 @@ func (s *valueMap[N]) measure(ctx context.Context, value N, fltrAttr attribute.S // newSum returns an aggregator that summarizes a set of measurements as their // arithmetic sum. Each sum is scoped by attributes and the aggregation cycle // the measurements were made in. -func newSum[N int64 | float64](monotonic bool, limit int, r func() exemplar.FilteredReservoir[N]) *sum[N] { +func newSum[N int64 | float64](monotonic bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *sum[N] { return &sum[N]{ valueMap: newValueMap[N](limit, r), monotonic: monotonic, @@ -142,9 +141,9 @@ func (s *sum[N]) cumulative(dest *metricdata.Aggregation) int { } // newPrecomputedSum returns an aggregator that summarizes a set of -// observatrions as their arithmetic sum. Each sum is scoped by attributes and +// observations as their arithmetic sum. Each sum is scoped by attributes and // the aggregation cycle the measurements were made in. -func newPrecomputedSum[N int64 | float64](monotonic bool, limit int, r func() exemplar.FilteredReservoir[N]) *precomputedSum[N] { +func newPrecomputedSum[N int64 | float64](monotonic bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *precomputedSum[N] { return &precomputedSum[N]{ valueMap: newValueMap[N](limit, r), monotonic: monotonic, @@ -152,7 +151,7 @@ func newPrecomputedSum[N int64 | float64](monotonic bool, limit int, r func() ex } } -// precomputedSum summarizes a set of observatrions as their arithmetic sum. +// precomputedSum summarizes a set of observations as their arithmetic sum. type precomputedSum[N int64 | float64] struct { *valueMap[N] diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/drop.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/drop.go deleted file mode 100644 index 5a0f39ae14784..0000000000000 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/drop.go +++ /dev/null @@ -1,23 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" - -import ( - "context" - - "go.opentelemetry.io/otel/attribute" -) - -// Drop returns a [FilteredReservoir] that drops all measurements it is offered. -func Drop[N int64 | float64]() FilteredReservoir[N] { return &dropRes[N]{} } - -type dropRes[N int64 | float64] struct{} - -// Offer does nothing, all measurements offered will be dropped. -func (r *dropRes[N]) Offer(context.Context, N, []attribute.KeyValue) {} - -// Collect resets dest. No exemplars will ever be returned. -func (r *dropRes[N]) Collect(dest *[]Exemplar) { - *dest = (*dest)[:0] -} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filtered_reservoir.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filtered_reservoir.go deleted file mode 100644 index 9fedfa4be680d..0000000000000 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filtered_reservoir.go +++ /dev/null @@ -1,49 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" - -import ( - "context" - "time" - - "go.opentelemetry.io/otel/attribute" -) - -// FilteredReservoir wraps a [Reservoir] with a filter. -type FilteredReservoir[N int64 | float64] interface { - // Offer accepts the parameters associated with a measurement. The - // parameters will be stored as an exemplar if the filter decides to - // sample the measurement. - // - // The passed ctx needs to contain any baggage or span that were active - // when the measurement was made. This information may be used by the - // Reservoir in making a sampling decision. - Offer(ctx context.Context, val N, attr []attribute.KeyValue) - // Collect returns all the held exemplars in the reservoir. - Collect(dest *[]Exemplar) -} - -// filteredReservoir handles the pre-sampled exemplar of measurements made. -type filteredReservoir[N int64 | float64] struct { - filter Filter - reservoir Reservoir -} - -// NewFilteredReservoir creates a [FilteredReservoir] which only offers values -// that are allowed by the filter. -func NewFilteredReservoir[N int64 | float64](f Filter, r Reservoir) FilteredReservoir[N] { - return &filteredReservoir[N]{ - filter: f, - reservoir: r, - } -} - -func (f *filteredReservoir[N]) Offer(ctx context.Context, val N, attr []attribute.KeyValue) { - if f.filter(ctx) { - // only record the current time if we are sampling this measurment. - f.reservoir.Offer(ctx, time.Now(), NewValue(val), attr) - } -} - -func (f *filteredReservoir[N]) Collect(dest *[]Exemplar) { f.reservoir.Collect(dest) } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/hist.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/hist.go deleted file mode 100644 index a6ff86d027146..0000000000000 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/hist.go +++ /dev/null @@ -1,46 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" - -import ( - "context" - "slices" - "sort" - "time" - - "go.opentelemetry.io/otel/attribute" -) - -// Histogram returns a [Reservoir] that samples the last measurement that falls -// within a histogram bucket. The histogram bucket upper-boundaries are define -// by bounds. -// -// The passed bounds will be sorted by this function. -func Histogram(bounds []float64) Reservoir { - slices.Sort(bounds) - return &histRes{ - bounds: bounds, - storage: newStorage(len(bounds) + 1), - } -} - -type histRes struct { - *storage - - // bounds are bucket bounds in ascending order. - bounds []float64 -} - -func (r *histRes) Offer(ctx context.Context, t time.Time, v Value, a []attribute.KeyValue) { - var x float64 - switch v.Type() { - case Int64ValueType: - x = float64(v.Int64()) - case Float64ValueType: - x = v.Float64() - default: - panic("unknown value type") - } - r.store[sort.SearchFloat64s(r.bounds, x)] = newMeasurement(ctx, t, v, a) -} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/README.md b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/README.md index aba69d6547150..59f736b733f19 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/README.md +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/README.md @@ -10,6 +10,7 @@ See the [Compatibility and Stability](#compatibility-and-stability) section for - [Cardinality Limit](#cardinality-limit) - [Exemplars](#exemplars) +- [Instrument Enabled](#instrument-enabled) ### Cardinality Limit @@ -102,6 +103,24 @@ Revert to the default exemplar filter (`"trace_based"`) unset OTEL_METRICS_EXEMPLAR_FILTER ``` +### Instrument Enabled + +To help users avoid performing computationally expensive operations when recording measurements, synchronous instruments provide an `Enabled` method. + +#### Examples + +The following code shows an example of how to check if an instrument implements the `EnabledInstrument` interface before using the `Enabled` function to avoid doing an expensive computation: + +```go +type enabledInstrument interface { Enabled(context.Context) bool } + +ctr, err := m.Int64Counter("expensive-counter") +c, ok := ctr.(enabledInstrument) +if !ok || c.Enabled(context.Background()) { + c.Add(expensiveComputation()) +} +``` + ## Compatibility and Stability Experimental features do not fall within the scope of the OpenTelemetry Go versioning and stability [policy](../../../../VERSIONING.md). diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/x.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/x.go index 8cd2f37417bb2..a98606238ad28 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/x.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/x.go @@ -8,41 +8,26 @@ package x // import "go.opentelemetry.io/otel/sdk/metric/internal/x" import ( + "context" "os" "strconv" - "strings" ) -var ( - // Exemplars is an experimental feature flag that defines if exemplars - // should be recorded for metric data-points. - // - // To enable this feature set the OTEL_GO_X_EXEMPLAR environment variable - // to the case-insensitive string value of "true" (i.e. "True" and "TRUE" - // will also enable this). - Exemplars = newFeature("EXEMPLAR", func(v string) (string, bool) { - if strings.ToLower(v) == "true" { - return v, true - } - return "", false - }) - - // CardinalityLimit is an experimental feature flag that defines if - // cardinality limits should be applied to the recorded metric data-points. - // - // To enable this feature set the OTEL_GO_X_CARDINALITY_LIMIT environment - // variable to the integer limit value you want to use. - // - // Setting OTEL_GO_X_CARDINALITY_LIMIT to a value less than or equal to 0 - // will disable the cardinality limits. - CardinalityLimit = newFeature("CARDINALITY_LIMIT", func(v string) (int, bool) { - n, err := strconv.Atoi(v) - if err != nil { - return 0, false - } - return n, true - }) -) +// CardinalityLimit is an experimental feature flag that defines if +// cardinality limits should be applied to the recorded metric data-points. +// +// To enable this feature set the OTEL_GO_X_CARDINALITY_LIMIT environment +// variable to the integer limit value you want to use. +// +// Setting OTEL_GO_X_CARDINALITY_LIMIT to a value less than or equal to 0 +// will disable the cardinality limits. +var CardinalityLimit = newFeature("CARDINALITY_LIMIT", func(v string) (int, bool) { + n, err := strconv.Atoi(v) + if err != nil { + return 0, false + } + return n, true +}) // Feature is an experimental feature control flag. It provides a uniform way // to interact with these feature flags and parse their values. @@ -83,3 +68,14 @@ func (f Feature[T]) Enabled() bool { _, ok := f.Lookup() return ok } + +// EnabledInstrument informs whether the instrument is enabled. +// +// EnabledInstrument interface is implemented by synchronous instruments. +type EnabledInstrument interface { + // Enabled returns whether the instrument will process measurements for the given context. + // + // This function can be used in places where measuring an instrument + // would result in computationally expensive operations. + Enabled(context.Context) bool +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/manual_reader.go b/vendor/go.opentelemetry.io/otel/sdk/metric/manual_reader.go index e0fd86ca78daf..c495985bc28cc 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/manual_reader.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/manual_reader.go @@ -113,18 +113,17 @@ func (mr *ManualReader) Collect(ctx context.Context, rm *metricdata.ResourceMetr if err != nil { return err } - var errs []error for _, producer := range mr.externalProducers.Load().([]Producer) { - externalMetrics, err := producer.Produce(ctx) - if err != nil { - errs = append(errs, err) + externalMetrics, e := producer.Produce(ctx) + if e != nil { + err = errors.Join(err, e) } rm.ScopeMetrics = append(rm.ScopeMetrics, externalMetrics...) } global.Debug("ManualReader collection", "Data", rm) - return unifyErrors(errs) + return err } // MarshalLog returns logging data about the ManualReader. diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/meter.go b/vendor/go.opentelemetry.io/otel/sdk/metric/meter.go index 2309e5b2b0f8e..a6ccd117b80dc 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/meter.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/meter.go @@ -150,6 +150,11 @@ func (m *meter) int64ObservableInstrument(id Instrument, callbacks []metric.Int6 continue } inst.appendMeasures(in) + + // Add the measures to the pipeline. It is required to maintain + // measures per pipeline to avoid calling the measure that + // is not part of the pipeline. + insert.pipeline.addInt64Measure(inst.observableID, in) for _, cback := range callbacks { inst := int64Observer{measures: in} fn := cback @@ -309,6 +314,11 @@ func (m *meter) float64ObservableInstrument(id Instrument, callbacks []metric.Fl continue } inst.appendMeasures(in) + + // Add the measures to the pipeline. It is required to maintain + // measures per pipeline to avoid calling the measure that + // is not part of the pipeline. + insert.pipeline.addFloat64Measure(inst.observableID, in) for _, cback := range callbacks { inst := float64Observer{measures: in} fn := cback @@ -441,73 +451,80 @@ func (m *meter) RegisterCallback(f metric.Callback, insts ...metric.Observable) return noopRegister{}, nil } - reg := newObserver() - var errs multierror + var err error + validInstruments := make([]metric.Observable, 0, len(insts)) for _, inst := range insts { - // Unwrap any global. - if u, ok := inst.(interface { - Unwrap() metric.Observable - }); ok { - inst = u.Unwrap() - } - switch o := inst.(type) { case int64Observable: - if err := o.registerable(m); err != nil { - if !errors.Is(err, errEmptyAgg) { - errs.append(err) + if e := o.registerable(m); e != nil { + if !errors.Is(e, errEmptyAgg) { + err = errors.Join(err, e) } continue } - reg.registerInt64(o.observablID) + + validInstruments = append(validInstruments, inst) case float64Observable: - if err := o.registerable(m); err != nil { - if !errors.Is(err, errEmptyAgg) { - errs.append(err) + if e := o.registerable(m); e != nil { + if !errors.Is(e, errEmptyAgg) { + err = errors.Join(err, e) } continue } - reg.registerFloat64(o.observablID) + + validInstruments = append(validInstruments, inst) default: // Instrument external to the SDK. - return nil, fmt.Errorf("invalid observable: from different implementation") + return nil, errors.New("invalid observable: from different implementation") } } - err := errs.errorOrNil() - if reg.len() == 0 { + if len(validInstruments) == 0 { // All insts use drop aggregation or are invalid. return noopRegister{}, err } - // Some or all instruments were valid. - cback := func(ctx context.Context) error { return f(ctx, reg) } - return m.pipes.registerMultiCallback(cback), err + unregs := make([]func(), len(m.pipes)) + for ix, pipe := range m.pipes { + reg := newObserver(pipe) + for _, inst := range validInstruments { + switch o := inst.(type) { + case int64Observable: + reg.registerInt64(o.observableID) + case float64Observable: + reg.registerFloat64(o.observableID) + } + } + + // Some or all instruments were valid. + cBack := func(ctx context.Context) error { return f(ctx, reg) } + unregs[ix] = pipe.addMultiCallback(cBack) + } + + return unregisterFuncs{f: unregs}, err } type observer struct { embedded.Observer - float64 map[observablID[float64]]struct{} - int64 map[observablID[int64]]struct{} + pipe *pipeline + float64 map[observableID[float64]]struct{} + int64 map[observableID[int64]]struct{} } -func newObserver() observer { +func newObserver(p *pipeline) observer { return observer{ - float64: make(map[observablID[float64]]struct{}), - int64: make(map[observablID[int64]]struct{}), + pipe: p, + float64: make(map[observableID[float64]]struct{}), + int64: make(map[observableID[int64]]struct{}), } } -func (r observer) len() int { - return len(r.float64) + len(r.int64) -} - -func (r observer) registerFloat64(id observablID[float64]) { +func (r observer) registerFloat64(id observableID[float64]) { r.float64[id] = struct{}{} } -func (r observer) registerInt64(id observablID[int64]) { +func (r observer) registerInt64(id observableID[int64]) { r.int64[id] = struct{}{} } @@ -521,22 +538,12 @@ func (r observer) ObserveFloat64(o metric.Float64Observable, v float64, opts ... switch conv := o.(type) { case float64Observable: oImpl = conv - case interface { - Unwrap() metric.Observable - }: - // Unwrap any global. - async := conv.Unwrap() - var ok bool - if oImpl, ok = async.(float64Observable); !ok { - global.Error(errUnknownObserver, "failed to record asynchronous") - return - } default: global.Error(errUnknownObserver, "failed to record") return } - if _, registered := r.float64[oImpl.observablID]; !registered { + if _, registered := r.float64[oImpl.observableID]; !registered { if !oImpl.dropAggregation { global.Error(errUnregObserver, "failed to record", "name", oImpl.name, @@ -548,7 +555,12 @@ func (r observer) ObserveFloat64(o metric.Float64Observable, v float64, opts ... return } c := metric.NewObserveConfig(opts) - oImpl.observe(v, c.Attributes()) + // Access to r.pipe.float64Measure is already guarded by a lock in pipeline.produce. + // TODO (#5946): Refactor pipeline and observable measures. + measures := r.pipe.float64Measures[oImpl.observableID] + for _, m := range measures { + m(context.Background(), v, c.Attributes()) + } } func (r observer) ObserveInt64(o metric.Int64Observable, v int64, opts ...metric.ObserveOption) { @@ -556,22 +568,12 @@ func (r observer) ObserveInt64(o metric.Int64Observable, v int64, opts ...metric switch conv := o.(type) { case int64Observable: oImpl = conv - case interface { - Unwrap() metric.Observable - }: - // Unwrap any global. - async := conv.Unwrap() - var ok bool - if oImpl, ok = async.(int64Observable); !ok { - global.Error(errUnknownObserver, "failed to record asynchronous") - return - } default: global.Error(errUnknownObserver, "failed to record") return } - if _, registered := r.int64[oImpl.observablID]; !registered { + if _, registered := r.int64[oImpl.observableID]; !registered { if !oImpl.dropAggregation { global.Error(errUnregObserver, "failed to record", "name", oImpl.name, @@ -583,7 +585,12 @@ func (r observer) ObserveInt64(o metric.Int64Observable, v int64, opts ...metric return } c := metric.NewObserveConfig(opts) - oImpl.observe(v, c.Attributes()) + // Access to r.pipe.int64Measures is already guarded b a lock in pipeline.produce. + // TODO (#5946): Refactor pipeline and observable measures. + measures := r.pipe.int64Measures[oImpl.observableID] + for _, m := range measures { + m(context.Background(), v, c.Attributes()) + } } type noopRegister struct{ embedded.Registration } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/periodic_reader.go b/vendor/go.opentelemetry.io/otel/sdk/metric/periodic_reader.go index 67ee1b11a2e52..dcd2182d9a159 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/periodic_reader.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/periodic_reader.go @@ -251,18 +251,17 @@ func (r *PeriodicReader) collect(ctx context.Context, p interface{}, rm *metricd if err != nil { return err } - var errs []error for _, producer := range r.externalProducers.Load().([]Producer) { - externalMetrics, err := producer.Produce(ctx) - if err != nil { - errs = append(errs, err) + externalMetrics, e := producer.Produce(ctx) + if e != nil { + err = errors.Join(err, e) } rm.ScopeMetrics = append(rm.ScopeMetrics, externalMetrics...) } global.Debug("PeriodicReader collection", "Data", rm) - return unifyErrors(errs) + return err } // export exports metric data m using r's exporter. diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/pipeline.go b/vendor/go.opentelemetry.io/otel/sdk/metric/pipeline.go index 823bf2fe3d276..775e2452619ad 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/pipeline.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/pipeline.go @@ -8,14 +8,13 @@ import ( "context" "errors" "fmt" - "strings" "sync" "sync/atomic" "go.opentelemetry.io/otel/internal/global" - "go.opentelemetry.io/otel/metric" "go.opentelemetry.io/otel/metric/embedded" "go.opentelemetry.io/otel/sdk/instrumentation" + "go.opentelemetry.io/otel/sdk/metric/exemplar" "go.opentelemetry.io/otel/sdk/metric/internal" "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" "go.opentelemetry.io/otel/sdk/metric/internal/x" @@ -38,14 +37,17 @@ type instrumentSync struct { compAgg aggregate.ComputeAggregation } -func newPipeline(res *resource.Resource, reader Reader, views []View) *pipeline { +func newPipeline(res *resource.Resource, reader Reader, views []View, exemplarFilter exemplar.Filter) *pipeline { if res == nil { res = resource.Empty() } return &pipeline{ - resource: res, - reader: reader, - views: views, + resource: res, + reader: reader, + views: views, + int64Measures: map[observableID[int64]][]aggregate.Measure[int64]{}, + float64Measures: map[observableID[float64]][]aggregate.Measure[float64]{}, + exemplarFilter: exemplarFilter, // aggregations is lazy allocated when needed. } } @@ -63,9 +65,26 @@ type pipeline struct { views []View sync.Mutex - aggregations map[instrumentation.Scope][]instrumentSync - callbacks []func(context.Context) error - multiCallbacks list.List + int64Measures map[observableID[int64]][]aggregate.Measure[int64] + float64Measures map[observableID[float64]][]aggregate.Measure[float64] + aggregations map[instrumentation.Scope][]instrumentSync + callbacks []func(context.Context) error + multiCallbacks list.List + exemplarFilter exemplar.Filter +} + +// addInt64Measure adds a new int64 measure to the pipeline for each observer. +func (p *pipeline) addInt64Measure(id observableID[int64], m []aggregate.Measure[int64]) { + p.Lock() + defer p.Unlock() + p.int64Measures[id] = m +} + +// addFloat64Measure adds a new float64 measure to the pipeline for each observer. +func (p *pipeline) addFloat64Measure(id observableID[float64], m []aggregate.Measure[float64]) { + p.Lock() + defer p.Unlock() + p.float64Measures[id] = m } // addSync adds the instrumentSync to pipeline p with scope. This method is not @@ -105,14 +124,15 @@ func (p *pipeline) produce(ctx context.Context, rm *metricdata.ResourceMetrics) p.Lock() defer p.Unlock() - var errs multierror + var err error for _, c := range p.callbacks { // TODO make the callbacks parallel. ( #3034 ) - if err := c(ctx); err != nil { - errs.append(err) + if e := c(ctx); e != nil { + err = errors.Join(err, e) } if err := ctx.Err(); err != nil { rm.Resource = nil + clear(rm.ScopeMetrics) // Erase elements to let GC collect objects. rm.ScopeMetrics = rm.ScopeMetrics[:0] return err } @@ -120,12 +140,13 @@ func (p *pipeline) produce(ctx context.Context, rm *metricdata.ResourceMetrics) for e := p.multiCallbacks.Front(); e != nil; e = e.Next() { // TODO make the callbacks parallel. ( #3034 ) f := e.Value.(multiCallback) - if err := f(ctx); err != nil { - errs.append(err) + if e := f(ctx); e != nil { + err = errors.Join(err, e) } if err := ctx.Err(); err != nil { // This means the context expired before we finished running callbacks. rm.Resource = nil + clear(rm.ScopeMetrics) // Erase elements to let GC collect objects. rm.ScopeMetrics = rm.ScopeMetrics[:0] return err } @@ -157,7 +178,7 @@ func (p *pipeline) produce(ctx context.Context, rm *metricdata.ResourceMetrics) rm.ScopeMetrics = rm.ScopeMetrics[:i] - return errs.errorOrNil() + return err } // inserter facilitates inserting of new instruments from a single scope into a @@ -219,7 +240,7 @@ func (i *inserter[N]) Instrument(inst Instrument, readerAggregation Aggregation) measures []aggregate.Measure[N] ) - errs := &multierror{wrapped: errCreatingAggregators} + var err error seen := make(map[uint64]struct{}) for _, v := range i.pipeline.views { stream, match := v(inst) @@ -227,9 +248,9 @@ func (i *inserter[N]) Instrument(inst Instrument, readerAggregation Aggregation) continue } matched = true - in, id, err := i.cachedAggregator(inst.Scope, inst.Kind, stream, readerAggregation) - if err != nil { - errs.append(err) + in, id, e := i.cachedAggregator(inst.Scope, inst.Kind, stream, readerAggregation) + if e != nil { + err = errors.Join(err, e) } if in == nil { // Drop aggregation. continue @@ -242,8 +263,12 @@ func (i *inserter[N]) Instrument(inst Instrument, readerAggregation Aggregation) measures = append(measures, in) } + if err != nil { + err = errors.Join(errCreatingAggregators, err) + } + if matched { - return measures, errs.errorOrNil() + return measures, err } // Apply implicit default view if no explicit matched. @@ -252,15 +277,18 @@ func (i *inserter[N]) Instrument(inst Instrument, readerAggregation Aggregation) Description: inst.Description, Unit: inst.Unit, } - in, _, err := i.cachedAggregator(inst.Scope, inst.Kind, stream, readerAggregation) - if err != nil { - errs.append(err) + in, _, e := i.cachedAggregator(inst.Scope, inst.Kind, stream, readerAggregation) + if e != nil { + if err == nil { + err = errCreatingAggregators + } + err = errors.Join(err, e) } if in != nil { // Ensured to have not seen given matched was false. measures = append(measures, in) } - return measures, errs.errorOrNil() + return measures, err } // addCallback registers a single instrument callback to be run when @@ -329,6 +357,9 @@ func (i *inserter[N]) cachedAggregator(scope instrumentation.Scope, kind Instrum // The view explicitly requested the default aggregation. stream.Aggregation = DefaultAggregationSelector(kind) } + if stream.ExemplarReservoirProviderSelector == nil { + stream.ExemplarReservoirProviderSelector = DefaultExemplarReservoirProviderSelector + } if err := isAggregatorCompatible(kind, stream.Aggregation); err != nil { return nil, 0, fmt.Errorf( @@ -349,7 +380,7 @@ func (i *inserter[N]) cachedAggregator(scope instrumentation.Scope, kind Instrum cv := i.aggregators.Lookup(normID, func() aggVal[N] { b := aggregate.Builder[N]{ Temporality: i.pipeline.reader.temporality(kind), - ReservoirFunc: reservoirFunc[N](stream.Aggregation), + ReservoirFunc: reservoirFunc[N](stream.ExemplarReservoirProviderSelector(stream.Aggregation), i.pipeline.exemplarFilter), } b.Filter = stream.AttributeFilter // A value less than or equal to zero will disable the aggregation @@ -552,24 +583,16 @@ func isAggregatorCompatible(kind InstrumentKind, agg Aggregation) error { // measurement. type pipelines []*pipeline -func newPipelines(res *resource.Resource, readers []Reader, views []View) pipelines { +func newPipelines(res *resource.Resource, readers []Reader, views []View, exemplarFilter exemplar.Filter) pipelines { pipes := make([]*pipeline, 0, len(readers)) for _, r := range readers { - p := newPipeline(res, r, views) + p := newPipeline(res, r, views, exemplarFilter) r.register(p) pipes = append(pipes, p) } return pipes } -func (p pipelines) registerMultiCallback(c multiCallback) metric.Registration { - unregs := make([]func(), len(p)) - for i, pipe := range p { - unregs[i] = pipe.addMultiCallback(c) - } - return unregisterFuncs{f: unregs} -} - type unregisterFuncs struct { embedded.Registration f []func() @@ -602,15 +625,15 @@ func newResolver[N int64 | float64](p pipelines, vc *cache[string, instID]) reso func (r resolver[N]) Aggregators(id Instrument) ([]aggregate.Measure[N], error) { var measures []aggregate.Measure[N] - errs := &multierror{} + var err error for _, i := range r.inserters { - in, err := i.Instrument(id, i.readerDefaultAggregation(id.Kind)) - if err != nil { - errs.append(err) + in, e := i.Instrument(id, i.readerDefaultAggregation(id.Kind)) + if e != nil { + err = errors.Join(err, e) } measures = append(measures, in...) } - return measures, errs.errorOrNil() + return measures, err } // HistogramAggregators returns the histogram Aggregators that must be updated by the instrument @@ -619,37 +642,18 @@ func (r resolver[N]) Aggregators(id Instrument) ([]aggregate.Measure[N], error) func (r resolver[N]) HistogramAggregators(id Instrument, boundaries []float64) ([]aggregate.Measure[N], error) { var measures []aggregate.Measure[N] - errs := &multierror{} + var err error for _, i := range r.inserters { agg := i.readerDefaultAggregation(id.Kind) if histAgg, ok := agg.(AggregationExplicitBucketHistogram); ok && len(boundaries) > 0 { histAgg.Boundaries = boundaries agg = histAgg } - in, err := i.Instrument(id, agg) - if err != nil { - errs.append(err) + in, e := i.Instrument(id, agg) + if e != nil { + err = errors.Join(err, e) } measures = append(measures, in...) } - return measures, errs.errorOrNil() -} - -type multierror struct { - wrapped error - errors []string -} - -func (m *multierror) errorOrNil() error { - if len(m.errors) == 0 { - return nil - } - if m.wrapped == nil { - return errors.New(strings.Join(m.errors, "; ")) - } - return fmt.Errorf("%w: %s", m.wrapped, strings.Join(m.errors, "; ")) -} - -func (m *multierror) append(err error) { - m.errors = append(m.errors, err.Error()) + return measures, err } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/provider.go b/vendor/go.opentelemetry.io/otel/sdk/metric/provider.go index a82af538e67c6..2fca89e5a8e5e 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/provider.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/provider.go @@ -42,7 +42,7 @@ func NewMeterProvider(options ...Option) *MeterProvider { flush, sdown := conf.readerSignals() mp := &MeterProvider{ - pipes: newPipelines(conf.res, conf.readers, conf.views), + pipes: newPipelines(conf.res, conf.readers, conf.views, conf.exemplarFilter), forceFlush: flush, shutdown: sdown, } @@ -76,15 +76,17 @@ func (mp *MeterProvider) Meter(name string, options ...metric.MeterOption) metri c := metric.NewMeterConfig(options...) s := instrumentation.Scope{ - Name: name, - Version: c.InstrumentationVersion(), - SchemaURL: c.SchemaURL(), + Name: name, + Version: c.InstrumentationVersion(), + SchemaURL: c.SchemaURL(), + Attributes: c.InstrumentationAttributes(), } global.Info("Meter created", "Name", s.Name, "Version", s.Version, "SchemaURL", s.SchemaURL, + "Attributes", s.Attributes, ) return mp.meters.Lookup(s, func() *meter { diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/reader.go b/vendor/go.opentelemetry.io/otel/sdk/metric/reader.go index d94bdee75b731..d13a7069788ed 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/reader.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/reader.go @@ -5,26 +5,26 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" import ( "context" - "fmt" + "errors" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) // errDuplicateRegister is logged by a Reader when an attempt to registered it // more than once occurs. -var errDuplicateRegister = fmt.Errorf("duplicate reader registration") +var errDuplicateRegister = errors.New("duplicate reader registration") // ErrReaderNotRegistered is returned if Collect or Shutdown are called before // the reader is registered with a MeterProvider. -var ErrReaderNotRegistered = fmt.Errorf("reader is not registered") +var ErrReaderNotRegistered = errors.New("reader is not registered") // ErrReaderShutdown is returned if Collect or Shutdown are called after a // reader has been Shutdown once. -var ErrReaderShutdown = fmt.Errorf("reader is shutdown") +var ErrReaderShutdown = errors.New("reader is shutdown") // errNonPositiveDuration is logged when an environmental variable // has non-positive value. -var errNonPositiveDuration = fmt.Errorf("non-positive duration") +var errNonPositiveDuration = errors.New("non-positive duration") // Reader is the interface used between the SDK and an // exporter. Control flow is bi-directional through the @@ -60,8 +60,8 @@ type Reader interface { aggregation(InstrumentKind) Aggregation // nolint:revive // import-shadow for method scoped by type. // Collect gathers and returns all metric data related to the Reader from - // the SDK and stores it in out. An error is returned if this is called - // after Shutdown or if out is nil. + // the SDK and stores it in rm. An error is returned if this is called + // after Shutdown or if rm is nil. // // This method needs to be concurrent safe, and the cancellation of the // passed context is expected to be honored. diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/version.go b/vendor/go.opentelemetry.io/otel/sdk/metric/version.go index 44316caa11bba..1cd181626d353 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/version.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/version.go @@ -5,5 +5,5 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" // version is the current release version of the metric SDK in use. func version() string { - return "1.29.0" + return "1.33.0" } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/view.go b/vendor/go.opentelemetry.io/otel/sdk/metric/view.go index cd08c673248af..630890f426314 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/view.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/view.go @@ -96,11 +96,12 @@ func NewView(criteria Instrument, mask Stream) View { return func(i Instrument) (Stream, bool) { if matchFunc(i) { return Stream{ - Name: nonZero(mask.Name, i.Name), - Description: nonZero(mask.Description, i.Description), - Unit: nonZero(mask.Unit, i.Unit), - Aggregation: agg, - AttributeFilter: mask.AttributeFilter, + Name: nonZero(mask.Name, i.Name), + Description: nonZero(mask.Description, i.Description), + Unit: nonZero(mask.Unit, i.Unit), + Aggregation: agg, + AttributeFilter: mask.AttributeFilter, + ExemplarReservoirProviderSelector: mask.ExemplarReservoirProviderSelector, }, true } return Stream{}, false diff --git a/vendor/go.opentelemetry.io/otel/sdk/resource/auto.go b/vendor/go.opentelemetry.io/otel/sdk/resource/auto.go index 95a61d61d49c3..c02aeefdde531 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/resource/auto.go +++ b/vendor/go.opentelemetry.io/otel/sdk/resource/auto.go @@ -7,7 +7,6 @@ import ( "context" "errors" "fmt" - "strings" ) // ErrPartialResource is returned by a detector when complete source @@ -57,62 +56,37 @@ func Detect(ctx context.Context, detectors ...Detector) (*Resource, error) { // these errors will be returned. Otherwise, nil is returned. func detect(ctx context.Context, res *Resource, detectors []Detector) error { var ( - r *Resource - errs detectErrs - err error + r *Resource + err error + e error ) for _, detector := range detectors { if detector == nil { continue } - r, err = detector.Detect(ctx) - if err != nil { - errs = append(errs, err) - if !errors.Is(err, ErrPartialResource) { + r, e = detector.Detect(ctx) + if e != nil { + err = errors.Join(err, e) + if !errors.Is(e, ErrPartialResource) { continue } } - r, err = Merge(res, r) - if err != nil { - errs = append(errs, err) + r, e = Merge(res, r) + if e != nil { + err = errors.Join(err, e) } *res = *r } - if len(errs) == 0 { - return nil - } - if errors.Is(errs, ErrSchemaURLConflict) { - // If there has been a merge conflict, ensure the resource has no - // schema URL. - res.schemaURL = "" - } - return errs -} - -type detectErrs []error - -func (e detectErrs) Error() string { - errStr := make([]string, len(e)) - for i, err := range e { - errStr[i] = fmt.Sprintf("* %s", err) - } - - format := "%d errors occurred detecting resource:\n\t%s" - return fmt.Sprintf(format, len(e), strings.Join(errStr, "\n\t")) -} + if err != nil { + if errors.Is(err, ErrSchemaURLConflict) { + // If there has been a merge conflict, ensure the resource has no + // schema URL. + res.schemaURL = "" + } -func (e detectErrs) Unwrap() error { - switch len(e) { - case 0: - return nil - case 1: - return e[0] + err = fmt.Errorf("error detecting resource: %w", err) } - return e[1:] -} - -func (e detectErrs) Is(target error) bool { - return len(e) != 0 && errors.Is(e[0], target) + return err } diff --git a/vendor/go.opentelemetry.io/otel/sdk/resource/builtin.go b/vendor/go.opentelemetry.io/otel/sdk/resource/builtin.go index 6ac1cdbf7b456..cf3c88e15cd6a 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/resource/builtin.go +++ b/vendor/go.opentelemetry.io/otel/sdk/resource/builtin.go @@ -20,15 +20,13 @@ type ( // telemetrySDK is a Detector that provides information about // the OpenTelemetry SDK used. This Detector is included as a // builtin. If these resource attributes are not wanted, use - // the WithTelemetrySDK(nil) or WithoutBuiltin() options to - // explicitly disable them. + // resource.New() to explicitly disable them. telemetrySDK struct{} // host is a Detector that provides information about the host // being run on. This Detector is included as a builtin. If // these resource attributes are not wanted, use the - // WithHost(nil) or WithoutBuiltin() options to explicitly - // disable them. + // resource.New() to explicitly disable them. host struct{} stringDetector struct { diff --git a/vendor/go.opentelemetry.io/otel/sdk/resource/host_id_windows.go b/vendor/go.opentelemetry.io/otel/sdk/resource/host_id_windows.go index 71386e2da4c76..3677c83d7da33 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/resource/host_id_windows.go +++ b/vendor/go.opentelemetry.io/otel/sdk/resource/host_id_windows.go @@ -10,17 +10,16 @@ import ( "golang.org/x/sys/windows/registry" ) -// implements hostIDReader +// implements hostIDReader. type hostIDReaderWindows struct{} -// read reads MachineGuid from the windows registry key: -// SOFTWARE\Microsoft\Cryptography +// read reads MachineGuid from the Windows registry key: +// SOFTWARE\Microsoft\Cryptography. func (*hostIDReaderWindows) read() (string, error) { k, err := registry.OpenKey( registry.LOCAL_MACHINE, `SOFTWARE\Microsoft\Cryptography`, registry.QUERY_VALUE|registry.WOW64_64KEY, ) - if err != nil { return "", err } diff --git a/vendor/go.opentelemetry.io/otel/sdk/resource/os_windows.go b/vendor/go.opentelemetry.io/otel/sdk/resource/os_windows.go index 5e3d199d7856a..a6a5a53c0ea7a 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/resource/os_windows.go +++ b/vendor/go.opentelemetry.io/otel/sdk/resource/os_windows.go @@ -17,7 +17,6 @@ import ( func platformOSDescription() (string, error) { k, err := registry.OpenKey( registry.LOCAL_MACHINE, `SOFTWARE\Microsoft\Windows NT\CurrentVersion`, registry.QUERY_VALUE) - if err != nil { return "", err } diff --git a/vendor/go.opentelemetry.io/otel/sdk/version.go b/vendor/go.opentelemetry.io/otel/sdk/version.go index b7cede891c4c6..ba7db4889505a 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/version.go +++ b/vendor/go.opentelemetry.io/otel/sdk/version.go @@ -5,5 +5,5 @@ package sdk // import "go.opentelemetry.io/otel/sdk" // Version is the current release version of the OpenTelemetry SDK in use. func Version() string { - return "1.29.0" + return "1.33.0" } diff --git a/vendor/google.golang.org/api/cloudresourcemanager/v1/cloudresourcemanager-gen.go b/vendor/google.golang.org/api/cloudresourcemanager/v1/cloudresourcemanager-gen.go index a896306a036a2..ace3ea34d8385 100644 --- a/vendor/google.golang.org/api/cloudresourcemanager/v1/cloudresourcemanager-gen.go +++ b/vendor/google.golang.org/api/cloudresourcemanager/v1/cloudresourcemanager-gen.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC. +// Copyright 2025 Google LLC. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. diff --git a/vendor/google.golang.org/api/compute/v1/compute-gen.go b/vendor/google.golang.org/api/compute/v1/compute-gen.go index 13c64502d8401..d097ac480c8ff 100644 --- a/vendor/google.golang.org/api/compute/v1/compute-gen.go +++ b/vendor/google.golang.org/api/compute/v1/compute-gen.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC. +// Copyright 2025 Google LLC. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. diff --git a/vendor/google.golang.org/api/compute/v1/compute2-gen.go b/vendor/google.golang.org/api/compute/v1/compute2-gen.go index 7b25c7a8bfadd..370ae7ee2e45b 100644 --- a/vendor/google.golang.org/api/compute/v1/compute2-gen.go +++ b/vendor/google.golang.org/api/compute/v1/compute2-gen.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC. +// Copyright 2025 Google LLC. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. diff --git a/vendor/google.golang.org/api/compute/v1/compute3-gen.go b/vendor/google.golang.org/api/compute/v1/compute3-gen.go index 4777c61d8a0d0..5a5a0d4eb746a 100644 --- a/vendor/google.golang.org/api/compute/v1/compute3-gen.go +++ b/vendor/google.golang.org/api/compute/v1/compute3-gen.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC. +// Copyright 2025 Google LLC. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. diff --git a/vendor/google.golang.org/api/iamcredentials/v1/iamcredentials-gen.go b/vendor/google.golang.org/api/iamcredentials/v1/iamcredentials-gen.go index 85ba75d08f521..559cab1385b61 100644 --- a/vendor/google.golang.org/api/iamcredentials/v1/iamcredentials-gen.go +++ b/vendor/google.golang.org/api/iamcredentials/v1/iamcredentials-gen.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC. +// Copyright 2025 Google LLC. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. diff --git a/vendor/google.golang.org/api/internal/version.go b/vendor/google.golang.org/api/internal/version.go index 551a90770eb83..63449651ff8df 100644 --- a/vendor/google.golang.org/api/internal/version.go +++ b/vendor/google.golang.org/api/internal/version.go @@ -5,4 +5,4 @@ package internal // Version is the current tagged release of the library. -const Version = "0.214.0" +const Version = "0.215.0" diff --git a/vendor/google.golang.org/api/storage/v1/storage-gen.go b/vendor/google.golang.org/api/storage/v1/storage-gen.go index 474fbb49846f1..89f08a8d98b26 100644 --- a/vendor/google.golang.org/api/storage/v1/storage-gen.go +++ b/vendor/google.golang.org/api/storage/v1/storage-gen.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC. +// Copyright 2025 Google LLC. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go index aa69fb4d509ff..4a9fce53c444f 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go @@ -180,6 +180,8 @@ type CommonLanguageSettings struct { ReferenceDocsUri string `protobuf:"bytes,1,opt,name=reference_docs_uri,json=referenceDocsUri,proto3" json:"reference_docs_uri,omitempty"` // The destination where API teams want this client library to be published. Destinations []ClientLibraryDestination `protobuf:"varint,2,rep,packed,name=destinations,proto3,enum=google.api.ClientLibraryDestination" json:"destinations,omitempty"` + // Configuration for which RPCs should be generated in the GAPIC client. + SelectiveGapicGeneration *SelectiveGapicGeneration `protobuf:"bytes,3,opt,name=selective_gapic_generation,json=selectiveGapicGeneration,proto3" json:"selective_gapic_generation,omitempty"` } func (x *CommonLanguageSettings) Reset() { @@ -229,6 +231,13 @@ func (x *CommonLanguageSettings) GetDestinations() []ClientLibraryDestination { return nil } +func (x *CommonLanguageSettings) GetSelectiveGapicGeneration() *SelectiveGapicGeneration { + if x != nil { + return x.SelectiveGapicGeneration + } + return nil +} + // Details about how and where to publish client libraries. type ClientLibrarySettings struct { state protoimpl.MessageState @@ -984,6 +993,16 @@ type GoSettings struct { // Some settings. Common *CommonLanguageSettings `protobuf:"bytes,1,opt,name=common,proto3" json:"common,omitempty"` + // Map of service names to renamed services. Keys are the package relative + // service names and values are the name to be used for the service client + // and call options. + // + // publishing: + // + // go_settings: + // renamed_services: + // Publisher: TopicAdmin + RenamedServices map[string]string `protobuf:"bytes,2,rep,name=renamed_services,json=renamedServices,proto3" json:"renamed_services,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` } func (x *GoSettings) Reset() { @@ -1025,6 +1044,13 @@ func (x *GoSettings) GetCommon() *CommonLanguageSettings { return nil } +func (x *GoSettings) GetRenamedServices() map[string]string { + if x != nil { + return x.RenamedServices + } + return nil +} + // Describes the generator configuration for a method. type MethodSettings struct { state protoimpl.MessageState @@ -1123,6 +1149,57 @@ func (x *MethodSettings) GetAutoPopulatedFields() []string { return nil } +// This message is used to configure the generation of a subset of the RPCs in +// a service for client libraries. +type SelectiveGapicGeneration struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // An allowlist of the fully qualified names of RPCs that should be included + // on public client surfaces. + Methods []string `protobuf:"bytes,1,rep,name=methods,proto3" json:"methods,omitempty"` +} + +func (x *SelectiveGapicGeneration) Reset() { + *x = SelectiveGapicGeneration{} + if protoimpl.UnsafeEnabled { + mi := &file_google_api_client_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *SelectiveGapicGeneration) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*SelectiveGapicGeneration) ProtoMessage() {} + +func (x *SelectiveGapicGeneration) ProtoReflect() protoreflect.Message { + mi := &file_google_api_client_proto_msgTypes[12] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use SelectiveGapicGeneration.ProtoReflect.Descriptor instead. +func (*SelectiveGapicGeneration) Descriptor() ([]byte, []int) { + return file_google_api_client_proto_rawDescGZIP(), []int{12} +} + +func (x *SelectiveGapicGeneration) GetMethods() []string { + if x != nil { + return x.Methods + } + return nil +} + // Experimental features to be included during client library generation. // These fields will be deprecated once the feature graduates and is enabled // by default. @@ -1136,12 +1213,17 @@ type PythonSettings_ExperimentalFeatures struct { // This feature will be enabled by default 1 month after launching the // feature in preview packages. RestAsyncIoEnabled bool `protobuf:"varint,1,opt,name=rest_async_io_enabled,json=restAsyncIoEnabled,proto3" json:"rest_async_io_enabled,omitempty"` + // Enables generation of protobuf code using new types that are more + // Pythonic which are included in `protobuf>=5.29.x`. This feature will be + // enabled by default 1 month after launching the feature in preview + // packages. + ProtobufPythonicTypesEnabled bool `protobuf:"varint,2,opt,name=protobuf_pythonic_types_enabled,json=protobufPythonicTypesEnabled,proto3" json:"protobuf_pythonic_types_enabled,omitempty"` } func (x *PythonSettings_ExperimentalFeatures) Reset() { *x = PythonSettings_ExperimentalFeatures{} if protoimpl.UnsafeEnabled { - mi := &file_google_api_client_proto_msgTypes[13] + mi := &file_google_api_client_proto_msgTypes[14] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1154,7 +1236,7 @@ func (x *PythonSettings_ExperimentalFeatures) String() string { func (*PythonSettings_ExperimentalFeatures) ProtoMessage() {} func (x *PythonSettings_ExperimentalFeatures) ProtoReflect() protoreflect.Message { - mi := &file_google_api_client_proto_msgTypes[13] + mi := &file_google_api_client_proto_msgTypes[14] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1177,6 +1259,13 @@ func (x *PythonSettings_ExperimentalFeatures) GetRestAsyncIoEnabled() bool { return false } +func (x *PythonSettings_ExperimentalFeatures) GetProtobufPythonicTypesEnabled() bool { + if x != nil { + return x.ProtobufPythonicTypesEnabled + } + return false +} + // Describes settings to use when generating API methods that use the // long-running operation pattern. // All default values below are from those used in the client library @@ -1205,7 +1294,7 @@ type MethodSettings_LongRunning struct { func (x *MethodSettings_LongRunning) Reset() { *x = MethodSettings_LongRunning{} if protoimpl.UnsafeEnabled { - mi := &file_google_api_client_proto_msgTypes[16] + mi := &file_google_api_client_proto_msgTypes[18] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1218,7 +1307,7 @@ func (x *MethodSettings_LongRunning) String() string { func (*MethodSettings_LongRunning) ProtoMessage() {} func (x *MethodSettings_LongRunning) ProtoReflect() protoreflect.Message { - mi := &file_google_api_client_proto_msgTypes[16] + mi := &file_google_api_client_proto_msgTypes[18] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1406,7 +1495,7 @@ var file_google_api_client_proto_rawDesc = []byte{ 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x94, 0x01, 0x0a, 0x16, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xf8, 0x01, 0x0a, 0x16, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x30, 0x0a, 0x12, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, 0x63, 0x73, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x02, 0x18, @@ -1415,251 +1504,275 @@ var file_google_api_client_proto_rawDesc = []byte{ 0x6f, 0x6e, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x44, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x0c, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x93, 0x05, - 0x0a, 0x15, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x76, 0x65, 0x72, 0x73, 0x69, - 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, - 0x6e, 0x12, 0x3a, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, 0x65, - 0x52, 0x0b, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, 0x65, 0x12, 0x2c, 0x0a, - 0x12, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x6e, 0x75, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x65, 0x6e, - 0x75, 0x6d, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x10, 0x72, 0x65, 0x73, 0x74, 0x4e, - 0x75, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x45, 0x6e, 0x75, 0x6d, 0x73, 0x12, 0x3d, 0x0a, 0x0d, 0x6a, - 0x61, 0x76, 0x61, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x15, 0x20, 0x01, + 0x0c, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x62, 0x0a, + 0x1a, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x67, 0x61, 0x70, 0x69, 0x63, + 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x53, + 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x47, 0x61, 0x70, 0x69, 0x63, 0x47, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x18, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, + 0x76, 0x65, 0x47, 0x61, 0x70, 0x69, 0x63, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x22, 0x93, 0x05, 0x0a, 0x15, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, + 0x61, 0x72, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x76, + 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x76, 0x65, + 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x3a, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, + 0x73, 0x74, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, + 0x74, 0x61, 0x67, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, + 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x6e, 0x75, 0x6d, 0x65, 0x72, 0x69, + 0x63, 0x5f, 0x65, 0x6e, 0x75, 0x6d, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x10, 0x72, + 0x65, 0x73, 0x74, 0x4e, 0x75, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x45, 0x6e, 0x75, 0x6d, 0x73, 0x12, + 0x3d, 0x0a, 0x0d, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x52, 0x0c, 0x6a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, + 0x0a, 0x0c, 0x63, 0x70, 0x70, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x16, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x43, 0x70, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0b, 0x63, + 0x70, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x70, 0x68, + 0x70, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x17, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x68, + 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0b, 0x70, 0x68, 0x70, 0x53, 0x65, + 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x43, 0x0a, 0x0f, 0x70, 0x79, 0x74, 0x68, 0x6f, 0x6e, + 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x18, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x79, 0x74, + 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x70, 0x79, 0x74, + 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3d, 0x0a, 0x0d, 0x6e, + 0x6f, 0x64, 0x65, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x19, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x4a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0c, 0x6a, 0x61, - 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x63, 0x70, - 0x70, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x70, - 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0b, 0x63, 0x70, 0x70, 0x53, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x70, 0x68, 0x70, 0x5f, 0x73, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x17, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x68, 0x70, 0x53, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0b, 0x70, 0x68, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, - 0x67, 0x73, 0x12, 0x43, 0x0a, 0x0f, 0x70, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x5f, 0x73, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x18, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x70, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3d, 0x0a, 0x0d, 0x6e, 0x6f, 0x64, 0x65, 0x5f, - 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x19, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4e, 0x6f, 0x64, 0x65, - 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0c, 0x6e, 0x6f, 0x64, 0x65, 0x53, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x43, 0x0a, 0x0f, 0x64, 0x6f, 0x74, 0x6e, 0x65, 0x74, - 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1a, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, - 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x64, 0x6f, 0x74, - 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3d, 0x0a, 0x0d, 0x72, - 0x75, 0x62, 0x79, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1b, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x52, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0c, 0x72, 0x75, - 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x37, 0x0a, 0x0b, 0x67, 0x6f, - 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1c, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x47, 0x6f, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0a, 0x67, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, - 0x6e, 0x67, 0x73, 0x22, 0xf4, 0x04, 0x0a, 0x0a, 0x50, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x69, - 0x6e, 0x67, 0x12, 0x43, 0x0a, 0x0f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x73, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x22, 0x0a, 0x0d, 0x6e, 0x65, 0x77, 0x5f, 0x69, - 0x73, 0x73, 0x75, 0x65, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x65, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, - 0x6e, 0x65, 0x77, 0x49, 0x73, 0x73, 0x75, 0x65, 0x55, 0x72, 0x69, 0x12, 0x2b, 0x0a, 0x11, 0x64, - 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x75, 0x72, 0x69, - 0x18, 0x66, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x12, 0x24, 0x0a, 0x0e, 0x61, 0x70, 0x69, 0x5f, - 0x73, 0x68, 0x6f, 0x72, 0x74, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x67, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x0c, 0x61, 0x70, 0x69, 0x53, 0x68, 0x6f, 0x72, 0x74, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x21, - 0x0a, 0x0c, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x18, 0x68, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x4c, 0x61, 0x62, 0x65, - 0x6c, 0x12, 0x34, 0x0a, 0x16, 0x63, 0x6f, 0x64, 0x65, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x5f, 0x67, - 0x69, 0x74, 0x68, 0x75, 0x62, 0x5f, 0x74, 0x65, 0x61, 0x6d, 0x73, 0x18, 0x69, 0x20, 0x03, 0x28, - 0x09, 0x52, 0x14, 0x63, 0x6f, 0x64, 0x65, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x47, 0x69, 0x74, 0x68, - 0x75, 0x62, 0x54, 0x65, 0x61, 0x6d, 0x73, 0x12, 0x24, 0x0a, 0x0e, 0x64, 0x6f, 0x63, 0x5f, 0x74, - 0x61, 0x67, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x6a, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x0c, 0x64, 0x6f, 0x63, 0x54, 0x61, 0x67, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x49, 0x0a, - 0x0c, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x6b, 0x20, - 0x01, 0x28, 0x0e, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, - 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x4f, 0x72, - 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x6f, 0x72, 0x67, 0x61, - 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4c, 0x0a, 0x10, 0x6c, 0x69, 0x62, 0x72, - 0x61, 0x72, 0x79, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x6d, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x53, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0f, 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x53, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x49, 0x0a, 0x21, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x5f, - 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, - 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x6e, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x1e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, - 0x65, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, - 0x69, 0x12, 0x47, 0x0a, 0x20, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, - 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x6f, 0x20, 0x01, 0x28, 0x09, 0x52, 0x1d, 0x72, 0x65, 0x73, - 0x74, 0x52, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, - 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x22, 0x9a, 0x02, 0x0a, 0x0c, 0x4a, - 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x27, 0x0a, 0x0f, 0x6c, - 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x50, 0x61, 0x63, - 0x6b, 0x61, 0x67, 0x65, 0x12, 0x5f, 0x0a, 0x13, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, - 0x63, 0x6c, 0x61, 0x73, 0x73, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4a, - 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x52, 0x11, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, - 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, + 0x4e, 0x6f, 0x64, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0c, 0x6e, 0x6f, + 0x64, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x43, 0x0a, 0x0f, 0x64, 0x6f, + 0x74, 0x6e, 0x65, 0x74, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1a, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, + 0x0e, 0x64, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, + 0x3d, 0x0a, 0x0d, 0x72, 0x75, 0x62, 0x79, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x18, 0x1b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x52, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x52, 0x0c, 0x72, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x37, + 0x0a, 0x0b, 0x67, 0x6f, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1c, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0a, 0x67, 0x6f, 0x53, + 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x22, 0xf4, 0x04, 0x0a, 0x0a, 0x50, 0x75, 0x62, 0x6c, + 0x69, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x12, 0x43, 0x0a, 0x0f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, + 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x6d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x22, 0x0a, 0x0d, 0x6e, + 0x65, 0x77, 0x5f, 0x69, 0x73, 0x73, 0x75, 0x65, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x65, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x0b, 0x6e, 0x65, 0x77, 0x49, 0x73, 0x73, 0x75, 0x65, 0x55, 0x72, 0x69, 0x12, + 0x2b, 0x0a, 0x11, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x75, 0x72, 0x69, 0x18, 0x66, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x64, 0x6f, 0x63, 0x75, + 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x12, 0x24, 0x0a, 0x0e, + 0x61, 0x70, 0x69, 0x5f, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x67, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x61, 0x70, 0x69, 0x53, 0x68, 0x6f, 0x72, 0x74, 0x4e, 0x61, + 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x5f, 0x6c, 0x61, 0x62, + 0x65, 0x6c, 0x18, 0x68, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, + 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x34, 0x0a, 0x16, 0x63, 0x6f, 0x64, 0x65, 0x6f, 0x77, 0x6e, + 0x65, 0x72, 0x5f, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x5f, 0x74, 0x65, 0x61, 0x6d, 0x73, 0x18, + 0x69, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x63, 0x6f, 0x64, 0x65, 0x6f, 0x77, 0x6e, 0x65, 0x72, + 0x47, 0x69, 0x74, 0x68, 0x75, 0x62, 0x54, 0x65, 0x61, 0x6d, 0x73, 0x12, 0x24, 0x0a, 0x0e, 0x64, + 0x6f, 0x63, 0x5f, 0x74, 0x61, 0x67, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x6a, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0c, 0x64, 0x6f, 0x63, 0x54, 0x61, 0x67, 0x50, 0x72, 0x65, 0x66, 0x69, + 0x78, 0x12, 0x49, 0x0a, 0x0c, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x18, 0x6b, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, + 0x72, 0x79, 0x4f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, + 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4c, 0x0a, 0x10, + 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x18, 0x6d, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, + 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0f, 0x6c, 0x69, 0x62, 0x72, 0x61, + 0x72, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x49, 0x0a, 0x21, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x5f, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, + 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x75, 0x72, 0x69, 0x18, + 0x6e, 0x20, 0x01, 0x28, 0x09, 0x52, 0x1e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x65, 0x66, 0x65, + 0x72, 0x65, 0x6e, 0x63, 0x65, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x12, 0x47, 0x0a, 0x20, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x72, 0x65, + 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x6f, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x1d, 0x72, 0x65, 0x73, 0x74, 0x52, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x44, 0x6f, + 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x22, 0x9a, + 0x02, 0x0a, 0x0c, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, + 0x27, 0x0a, 0x0f, 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, + 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, + 0x79, 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x5f, 0x0a, 0x13, 0x73, 0x65, 0x72, 0x76, + 0x69, 0x63, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x18, + 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, + 0x70, 0x69, 0x2e, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, + 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x4e, 0x61, 0x6d, 0x65, + 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x11, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, + 0x6c, 0x61, 0x73, 0x73, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, + 0x6d, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, + 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x1a, 0x44, 0x0a, 0x16, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, + 0x43, 0x6c, 0x61, 0x73, 0x73, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, + 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, + 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x49, 0x0a, 0x0b, 0x43, + 0x70, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, + 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, + 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, + 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0x49, 0x0a, 0x0b, 0x50, 0x68, 0x70, 0x53, 0x65, 0x74, + 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x1a, 0x44, 0x0a, 0x16, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, 0x6c, 0x61, 0x73, - 0x73, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, - 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x49, 0x0a, 0x0b, 0x43, 0x70, 0x70, 0x53, 0x65, + 0x6e, 0x22, 0xc5, 0x02, 0x0a, 0x0e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, + 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, + 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, + 0x12, 0x64, 0x0a, 0x15, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, + 0x5f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x79, 0x74, + 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x45, 0x78, 0x70, 0x65, + 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, + 0x52, 0x14, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, + 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x1a, 0x90, 0x01, 0x0a, 0x14, 0x45, 0x78, 0x70, 0x65, 0x72, + 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, + 0x31, 0x0a, 0x15, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x61, 0x73, 0x79, 0x6e, 0x63, 0x5f, 0x69, 0x6f, + 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, + 0x72, 0x65, 0x73, 0x74, 0x41, 0x73, 0x79, 0x6e, 0x63, 0x49, 0x6f, 0x45, 0x6e, 0x61, 0x62, 0x6c, + 0x65, 0x64, 0x12, 0x45, 0x0a, 0x1f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x5f, 0x70, + 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x69, 0x63, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x5f, 0x65, 0x6e, + 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x1c, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x69, 0x63, 0x54, 0x79, 0x70, + 0x65, 0x73, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x22, 0x4a, 0x0a, 0x0c, 0x4e, 0x6f, 0x64, + 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, + 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, + 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xae, 0x04, 0x0a, 0x0e, 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, + 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, + 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, + 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, + 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x5a, 0x0a, 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, + 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, 0x6e, + 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, 0x6d, + 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, + 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, + 0x12, 0x5d, 0x0a, 0x11, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, + 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, + 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x10, 0x72, + 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x12, + 0x2b, 0x0a, 0x11, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x09, 0x52, 0x10, 0x69, 0x67, 0x6e, 0x6f, + 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x12, 0x38, 0x0a, 0x18, + 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, + 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x52, 0x16, + 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x41, + 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x16, 0x68, 0x61, 0x6e, 0x64, 0x77, 0x72, + 0x69, 0x74, 0x74, 0x65, 0x6e, 0x5f, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, + 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x15, 0x68, 0x61, 0x6e, 0x64, 0x77, 0x72, 0x69, 0x74, + 0x74, 0x65, 0x6e, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x1a, 0x42, 0x0a, + 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, + 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, + 0x01, 0x1a, 0x43, 0x0a, 0x15, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, + 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x4a, 0x0a, 0x0c, 0x52, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x22, 0x49, 0x0a, 0x0b, 0x50, 0x68, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, + 0x6f, 0x6e, 0x22, 0xe4, 0x01, 0x0a, 0x0a, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xfd, 0x01, - 0x0a, 0x0e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, - 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, - 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x64, 0x0a, 0x15, - 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x5f, 0x66, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x45, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, - 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x52, 0x14, 0x65, 0x78, - 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x73, 0x1a, 0x49, 0x0a, 0x14, 0x45, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, - 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x31, 0x0a, 0x15, 0x72, 0x65, - 0x73, 0x74, 0x5f, 0x61, 0x73, 0x79, 0x6e, 0x63, 0x5f, 0x69, 0x6f, 0x5f, 0x65, 0x6e, 0x61, 0x62, - 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, 0x72, 0x65, 0x73, 0x74, 0x41, - 0x73, 0x79, 0x6e, 0x63, 0x49, 0x6f, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x22, 0x4a, 0x0a, - 0x0c, 0x4e, 0x6f, 0x64, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, - 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, - 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xae, 0x04, 0x0a, 0x0e, 0x44, 0x6f, - 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, - 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, - 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x5a, 0x0a, 0x10, 0x72, 0x65, 0x6e, 0x61, - 0x6d, 0x65, 0x64, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, - 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, - 0x74, 0x72, 0x79, 0x52, 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x73, 0x12, 0x5d, 0x0a, 0x11, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, - 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x30, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, - 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, - 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, - 0x79, 0x52, 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x73, 0x12, 0x2b, 0x0a, 0x11, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x09, 0x52, 0x10, - 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, - 0x12, 0x38, 0x0a, 0x18, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, - 0x70, 0x61, 0x63, 0x65, 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x18, 0x05, 0x20, 0x03, - 0x28, 0x09, 0x52, 0x16, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, - 0x61, 0x63, 0x65, 0x41, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x16, 0x68, 0x61, - 0x6e, 0x64, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x5f, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x15, 0x68, 0x61, 0x6e, 0x64, - 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x73, 0x1a, 0x42, 0x0a, 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x3a, 0x02, 0x38, 0x01, 0x1a, 0x43, 0x0a, 0x15, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, - 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, - 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, - 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x4a, 0x0a, 0x0c, 0x52, 0x75, - 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, - 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, - 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0x48, 0x0a, 0x0a, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, - 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, - 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, - 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x22, 0xc2, 0x03, 0x0a, 0x0e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, - 0x6e, 0x67, 0x73, 0x12, 0x1a, 0x0a, 0x08, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, - 0x49, 0x0a, 0x0c, 0x6c, 0x6f, 0x6e, 0x67, 0x5f, 0x72, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, - 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, - 0x73, 0x2e, 0x4c, 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x52, 0x0b, 0x6c, - 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x32, 0x0a, 0x15, 0x61, 0x75, - 0x74, 0x6f, 0x5f, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, 0x69, 0x65, - 0x6c, 0x64, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x09, 0x52, 0x13, 0x61, 0x75, 0x74, 0x6f, 0x50, - 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x1a, 0x94, - 0x02, 0x0a, 0x0b, 0x4c, 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x47, - 0x0a, 0x12, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, - 0x65, 0x6c, 0x61, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x50, 0x6f, - 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0x32, 0x0a, 0x15, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, - 0x64, 0x65, 0x6c, 0x61, 0x79, 0x5f, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x02, 0x52, 0x13, 0x70, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, - 0x79, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x0e, 0x6d, - 0x61, 0x78, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x03, 0x20, + 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x56, 0x0a, + 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, + 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, + 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, + 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, + 0x76, 0x69, 0x63, 0x65, 0x73, 0x1a, 0x42, 0x0a, 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, + 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, + 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, + 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0xc2, 0x03, 0x0a, 0x0e, 0x4d, 0x65, + 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x1a, 0x0a, 0x08, + 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, + 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, 0x49, 0x0a, 0x0c, 0x6c, 0x6f, 0x6e, 0x67, + 0x5f, 0x72, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x68, + 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x4c, 0x6f, 0x6e, 0x67, 0x52, + 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x52, 0x0b, 0x6c, 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, + 0x69, 0x6e, 0x67, 0x12, 0x32, 0x0a, 0x15, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x70, 0x6f, 0x70, 0x75, + 0x6c, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x18, 0x03, 0x20, 0x03, + 0x28, 0x09, 0x52, 0x13, 0x61, 0x75, 0x74, 0x6f, 0x50, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, + 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x1a, 0x94, 0x02, 0x0a, 0x0b, 0x4c, 0x6f, 0x6e, 0x67, + 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x47, 0x0a, 0x12, 0x69, 0x6e, 0x69, 0x74, 0x69, + 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, - 0x6d, 0x61, 0x78, 0x50, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0x47, 0x0a, 0x12, - 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, - 0x75, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x54, 0x69, - 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x2a, 0xa3, 0x01, 0x0a, 0x19, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x4f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x12, 0x2b, 0x0a, 0x27, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, 0x5f, 0x4c, 0x49, - 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x4f, 0x52, 0x47, 0x41, 0x4e, 0x49, 0x5a, 0x41, 0x54, 0x49, - 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, - 0x12, 0x09, 0x0a, 0x05, 0x43, 0x4c, 0x4f, 0x55, 0x44, 0x10, 0x01, 0x12, 0x07, 0x0a, 0x03, 0x41, - 0x44, 0x53, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x50, 0x48, 0x4f, 0x54, 0x4f, 0x53, 0x10, 0x03, - 0x12, 0x0f, 0x0a, 0x0b, 0x53, 0x54, 0x52, 0x45, 0x45, 0x54, 0x5f, 0x56, 0x49, 0x45, 0x57, 0x10, - 0x04, 0x12, 0x0c, 0x0a, 0x08, 0x53, 0x48, 0x4f, 0x50, 0x50, 0x49, 0x4e, 0x47, 0x10, 0x05, 0x12, - 0x07, 0x0a, 0x03, 0x47, 0x45, 0x4f, 0x10, 0x06, 0x12, 0x11, 0x0a, 0x0d, 0x47, 0x45, 0x4e, 0x45, - 0x52, 0x41, 0x54, 0x49, 0x56, 0x45, 0x5f, 0x41, 0x49, 0x10, 0x07, 0x2a, 0x67, 0x0a, 0x18, 0x43, - 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x44, 0x65, 0x73, 0x74, - 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2a, 0x0a, 0x26, 0x43, 0x4c, 0x49, 0x45, 0x4e, - 0x54, 0x5f, 0x4c, 0x49, 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x44, 0x45, 0x53, 0x54, 0x49, 0x4e, - 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, - 0x44, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x47, 0x49, 0x54, 0x48, 0x55, 0x42, 0x10, 0x0a, 0x12, - 0x13, 0x0a, 0x0f, 0x50, 0x41, 0x43, 0x4b, 0x41, 0x47, 0x45, 0x5f, 0x4d, 0x41, 0x4e, 0x41, 0x47, - 0x45, 0x52, 0x10, 0x14, 0x3a, 0x4a, 0x0a, 0x10, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x73, - 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x12, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, - 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9b, 0x08, 0x20, 0x03, 0x28, 0x09, 0x52, - 0x0f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x3a, 0x43, 0x0a, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x68, 0x6f, 0x73, 0x74, - 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x18, 0x99, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, - 0x74, 0x48, 0x6f, 0x73, 0x74, 0x3a, 0x43, 0x0a, 0x0c, 0x6f, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x73, - 0x63, 0x6f, 0x70, 0x65, 0x73, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9a, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6f, - 0x61, 0x75, 0x74, 0x68, 0x53, 0x63, 0x6f, 0x70, 0x65, 0x73, 0x3a, 0x44, 0x0a, 0x0b, 0x61, 0x70, - 0x69, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0xc1, 0xba, 0xab, 0xfa, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x61, 0x70, 0x69, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, - 0x42, 0x69, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, - 0x70, 0x69, 0x42, 0x0b, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, - 0x01, 0x5a, 0x41, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, - 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x61, 0x6e, 0x6e, - 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x33, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, + 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, + 0x12, 0x32, 0x0a, 0x15, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x5f, 0x6d, + 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x02, 0x52, + 0x13, 0x70, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, + 0x6c, 0x69, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x0e, 0x6d, 0x61, 0x78, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, + 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, + 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x6d, 0x61, 0x78, 0x50, 0x6f, 0x6c, 0x6c, + 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0x47, 0x0a, 0x12, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, + 0x6f, 0x6c, 0x6c, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x74, 0x6f, + 0x74, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x22, 0x34, + 0x0a, 0x18, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x47, 0x61, 0x70, 0x69, 0x63, + 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, + 0x74, 0x68, 0x6f, 0x64, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x73, 0x2a, 0xa3, 0x01, 0x0a, 0x19, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, + 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x4f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x12, 0x2b, 0x0a, 0x27, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, 0x5f, 0x4c, 0x49, 0x42, + 0x52, 0x41, 0x52, 0x59, 0x5f, 0x4f, 0x52, 0x47, 0x41, 0x4e, 0x49, 0x5a, 0x41, 0x54, 0x49, 0x4f, + 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, + 0x09, 0x0a, 0x05, 0x43, 0x4c, 0x4f, 0x55, 0x44, 0x10, 0x01, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x44, + 0x53, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x50, 0x48, 0x4f, 0x54, 0x4f, 0x53, 0x10, 0x03, 0x12, + 0x0f, 0x0a, 0x0b, 0x53, 0x54, 0x52, 0x45, 0x45, 0x54, 0x5f, 0x56, 0x49, 0x45, 0x57, 0x10, 0x04, + 0x12, 0x0c, 0x0a, 0x08, 0x53, 0x48, 0x4f, 0x50, 0x50, 0x49, 0x4e, 0x47, 0x10, 0x05, 0x12, 0x07, + 0x0a, 0x03, 0x47, 0x45, 0x4f, 0x10, 0x06, 0x12, 0x11, 0x0a, 0x0d, 0x47, 0x45, 0x4e, 0x45, 0x52, + 0x41, 0x54, 0x49, 0x56, 0x45, 0x5f, 0x41, 0x49, 0x10, 0x07, 0x2a, 0x67, 0x0a, 0x18, 0x43, 0x6c, + 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x44, 0x65, 0x73, 0x74, 0x69, + 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2a, 0x0a, 0x26, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, + 0x5f, 0x4c, 0x49, 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x44, 0x45, 0x53, 0x54, 0x49, 0x4e, 0x41, + 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, + 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x47, 0x49, 0x54, 0x48, 0x55, 0x42, 0x10, 0x0a, 0x12, 0x13, + 0x0a, 0x0f, 0x50, 0x41, 0x43, 0x4b, 0x41, 0x47, 0x45, 0x5f, 0x4d, 0x41, 0x4e, 0x41, 0x47, 0x45, + 0x52, 0x10, 0x14, 0x3a, 0x4a, 0x0a, 0x10, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x73, 0x69, + 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x12, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9b, 0x08, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0f, + 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x3a, + 0x43, 0x0a, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x12, + 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x18, 0x99, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, + 0x48, 0x6f, 0x73, 0x74, 0x3a, 0x43, 0x0a, 0x0c, 0x6f, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x73, 0x63, + 0x6f, 0x70, 0x65, 0x73, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9a, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6f, 0x61, + 0x75, 0x74, 0x68, 0x53, 0x63, 0x6f, 0x70, 0x65, 0x73, 0x3a, 0x44, 0x0a, 0x0b, 0x61, 0x70, 0x69, + 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0xc1, 0xba, 0xab, 0xfa, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0a, 0x61, 0x70, 0x69, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x42, + 0x69, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, + 0x69, 0x42, 0x0b, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, + 0x5a, 0x41, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, + 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x61, 0x6e, 0x6e, 0x6f, + 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x33, } var ( @@ -1675,7 +1788,7 @@ func file_google_api_client_proto_rawDescGZIP() []byte { } var file_google_api_client_proto_enumTypes = make([]protoimpl.EnumInfo, 2) -var file_google_api_client_proto_msgTypes = make([]protoimpl.MessageInfo, 17) +var file_google_api_client_proto_msgTypes = make([]protoimpl.MessageInfo, 19) var file_google_api_client_proto_goTypes = []interface{}{ (ClientLibraryOrganization)(0), // 0: google.api.ClientLibraryOrganization (ClientLibraryDestination)(0), // 1: google.api.ClientLibraryDestination @@ -1691,55 +1804,59 @@ var file_google_api_client_proto_goTypes = []interface{}{ (*RubySettings)(nil), // 11: google.api.RubySettings (*GoSettings)(nil), // 12: google.api.GoSettings (*MethodSettings)(nil), // 13: google.api.MethodSettings - nil, // 14: google.api.JavaSettings.ServiceClassNamesEntry - (*PythonSettings_ExperimentalFeatures)(nil), // 15: google.api.PythonSettings.ExperimentalFeatures - nil, // 16: google.api.DotnetSettings.RenamedServicesEntry - nil, // 17: google.api.DotnetSettings.RenamedResourcesEntry - (*MethodSettings_LongRunning)(nil), // 18: google.api.MethodSettings.LongRunning - (api.LaunchStage)(0), // 19: google.api.LaunchStage - (*durationpb.Duration)(nil), // 20: google.protobuf.Duration - (*descriptorpb.MethodOptions)(nil), // 21: google.protobuf.MethodOptions - (*descriptorpb.ServiceOptions)(nil), // 22: google.protobuf.ServiceOptions + (*SelectiveGapicGeneration)(nil), // 14: google.api.SelectiveGapicGeneration + nil, // 15: google.api.JavaSettings.ServiceClassNamesEntry + (*PythonSettings_ExperimentalFeatures)(nil), // 16: google.api.PythonSettings.ExperimentalFeatures + nil, // 17: google.api.DotnetSettings.RenamedServicesEntry + nil, // 18: google.api.DotnetSettings.RenamedResourcesEntry + nil, // 19: google.api.GoSettings.RenamedServicesEntry + (*MethodSettings_LongRunning)(nil), // 20: google.api.MethodSettings.LongRunning + (api.LaunchStage)(0), // 21: google.api.LaunchStage + (*durationpb.Duration)(nil), // 22: google.protobuf.Duration + (*descriptorpb.MethodOptions)(nil), // 23: google.protobuf.MethodOptions + (*descriptorpb.ServiceOptions)(nil), // 24: google.protobuf.ServiceOptions } var file_google_api_client_proto_depIdxs = []int32{ 1, // 0: google.api.CommonLanguageSettings.destinations:type_name -> google.api.ClientLibraryDestination - 19, // 1: google.api.ClientLibrarySettings.launch_stage:type_name -> google.api.LaunchStage - 5, // 2: google.api.ClientLibrarySettings.java_settings:type_name -> google.api.JavaSettings - 6, // 3: google.api.ClientLibrarySettings.cpp_settings:type_name -> google.api.CppSettings - 7, // 4: google.api.ClientLibrarySettings.php_settings:type_name -> google.api.PhpSettings - 8, // 5: google.api.ClientLibrarySettings.python_settings:type_name -> google.api.PythonSettings - 9, // 6: google.api.ClientLibrarySettings.node_settings:type_name -> google.api.NodeSettings - 10, // 7: google.api.ClientLibrarySettings.dotnet_settings:type_name -> google.api.DotnetSettings - 11, // 8: google.api.ClientLibrarySettings.ruby_settings:type_name -> google.api.RubySettings - 12, // 9: google.api.ClientLibrarySettings.go_settings:type_name -> google.api.GoSettings - 13, // 10: google.api.Publishing.method_settings:type_name -> google.api.MethodSettings - 0, // 11: google.api.Publishing.organization:type_name -> google.api.ClientLibraryOrganization - 3, // 12: google.api.Publishing.library_settings:type_name -> google.api.ClientLibrarySettings - 14, // 13: google.api.JavaSettings.service_class_names:type_name -> google.api.JavaSettings.ServiceClassNamesEntry - 2, // 14: google.api.JavaSettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 15: google.api.CppSettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 16: google.api.PhpSettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 17: google.api.PythonSettings.common:type_name -> google.api.CommonLanguageSettings - 15, // 18: google.api.PythonSettings.experimental_features:type_name -> google.api.PythonSettings.ExperimentalFeatures - 2, // 19: google.api.NodeSettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 20: google.api.DotnetSettings.common:type_name -> google.api.CommonLanguageSettings - 16, // 21: google.api.DotnetSettings.renamed_services:type_name -> google.api.DotnetSettings.RenamedServicesEntry - 17, // 22: google.api.DotnetSettings.renamed_resources:type_name -> google.api.DotnetSettings.RenamedResourcesEntry - 2, // 23: google.api.RubySettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 24: google.api.GoSettings.common:type_name -> google.api.CommonLanguageSettings - 18, // 25: google.api.MethodSettings.long_running:type_name -> google.api.MethodSettings.LongRunning - 20, // 26: google.api.MethodSettings.LongRunning.initial_poll_delay:type_name -> google.protobuf.Duration - 20, // 27: google.api.MethodSettings.LongRunning.max_poll_delay:type_name -> google.protobuf.Duration - 20, // 28: google.api.MethodSettings.LongRunning.total_poll_timeout:type_name -> google.protobuf.Duration - 21, // 29: google.api.method_signature:extendee -> google.protobuf.MethodOptions - 22, // 30: google.api.default_host:extendee -> google.protobuf.ServiceOptions - 22, // 31: google.api.oauth_scopes:extendee -> google.protobuf.ServiceOptions - 22, // 32: google.api.api_version:extendee -> google.protobuf.ServiceOptions - 33, // [33:33] is the sub-list for method output_type - 33, // [33:33] is the sub-list for method input_type - 33, // [33:33] is the sub-list for extension type_name - 29, // [29:33] is the sub-list for extension extendee - 0, // [0:29] is the sub-list for field type_name + 14, // 1: google.api.CommonLanguageSettings.selective_gapic_generation:type_name -> google.api.SelectiveGapicGeneration + 21, // 2: google.api.ClientLibrarySettings.launch_stage:type_name -> google.api.LaunchStage + 5, // 3: google.api.ClientLibrarySettings.java_settings:type_name -> google.api.JavaSettings + 6, // 4: google.api.ClientLibrarySettings.cpp_settings:type_name -> google.api.CppSettings + 7, // 5: google.api.ClientLibrarySettings.php_settings:type_name -> google.api.PhpSettings + 8, // 6: google.api.ClientLibrarySettings.python_settings:type_name -> google.api.PythonSettings + 9, // 7: google.api.ClientLibrarySettings.node_settings:type_name -> google.api.NodeSettings + 10, // 8: google.api.ClientLibrarySettings.dotnet_settings:type_name -> google.api.DotnetSettings + 11, // 9: google.api.ClientLibrarySettings.ruby_settings:type_name -> google.api.RubySettings + 12, // 10: google.api.ClientLibrarySettings.go_settings:type_name -> google.api.GoSettings + 13, // 11: google.api.Publishing.method_settings:type_name -> google.api.MethodSettings + 0, // 12: google.api.Publishing.organization:type_name -> google.api.ClientLibraryOrganization + 3, // 13: google.api.Publishing.library_settings:type_name -> google.api.ClientLibrarySettings + 15, // 14: google.api.JavaSettings.service_class_names:type_name -> google.api.JavaSettings.ServiceClassNamesEntry + 2, // 15: google.api.JavaSettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 16: google.api.CppSettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 17: google.api.PhpSettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 18: google.api.PythonSettings.common:type_name -> google.api.CommonLanguageSettings + 16, // 19: google.api.PythonSettings.experimental_features:type_name -> google.api.PythonSettings.ExperimentalFeatures + 2, // 20: google.api.NodeSettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 21: google.api.DotnetSettings.common:type_name -> google.api.CommonLanguageSettings + 17, // 22: google.api.DotnetSettings.renamed_services:type_name -> google.api.DotnetSettings.RenamedServicesEntry + 18, // 23: google.api.DotnetSettings.renamed_resources:type_name -> google.api.DotnetSettings.RenamedResourcesEntry + 2, // 24: google.api.RubySettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 25: google.api.GoSettings.common:type_name -> google.api.CommonLanguageSettings + 19, // 26: google.api.GoSettings.renamed_services:type_name -> google.api.GoSettings.RenamedServicesEntry + 20, // 27: google.api.MethodSettings.long_running:type_name -> google.api.MethodSettings.LongRunning + 22, // 28: google.api.MethodSettings.LongRunning.initial_poll_delay:type_name -> google.protobuf.Duration + 22, // 29: google.api.MethodSettings.LongRunning.max_poll_delay:type_name -> google.protobuf.Duration + 22, // 30: google.api.MethodSettings.LongRunning.total_poll_timeout:type_name -> google.protobuf.Duration + 23, // 31: google.api.method_signature:extendee -> google.protobuf.MethodOptions + 24, // 32: google.api.default_host:extendee -> google.protobuf.ServiceOptions + 24, // 33: google.api.oauth_scopes:extendee -> google.protobuf.ServiceOptions + 24, // 34: google.api.api_version:extendee -> google.protobuf.ServiceOptions + 35, // [35:35] is the sub-list for method output_type + 35, // [35:35] is the sub-list for method input_type + 35, // [35:35] is the sub-list for extension type_name + 31, // [31:35] is the sub-list for extension extendee + 0, // [0:31] is the sub-list for field type_name } func init() { file_google_api_client_proto_init() } @@ -1892,7 +2009,19 @@ func file_google_api_client_proto_init() { return nil } } - file_google_api_client_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} { + file_google_api_client_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*SelectiveGapicGeneration); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_google_api_client_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*PythonSettings_ExperimentalFeatures); i { case 0: return &v.state @@ -1904,7 +2033,7 @@ func file_google_api_client_proto_init() { return nil } } - file_google_api_client_proto_msgTypes[16].Exporter = func(v interface{}, i int) interface{} { + file_google_api_client_proto_msgTypes[18].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*MethodSettings_LongRunning); i { case 0: return &v.state @@ -1923,7 +2052,7 @@ func file_google_api_client_proto_init() { GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_api_client_proto_rawDesc, NumEnums: 2, - NumMessages: 17, + NumMessages: 19, NumExtensions: 4, NumServices: 0, }, diff --git a/vendor/google.golang.org/genproto/googleapis/api/metric/metric.pb.go b/vendor/google.golang.org/genproto/googleapis/api/metric/metric.pb.go index d4b89c98d19b7..7f6e006cde312 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/metric/metric.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/metric/metric.pb.go @@ -172,6 +172,63 @@ func (MetricDescriptor_ValueType) EnumDescriptor() ([]byte, []int) { return file_google_api_metric_proto_rawDescGZIP(), []int{0, 1} } +// The resource hierarchy level of the timeseries data of a metric. +type MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel int32 + +const ( + // Do not use this default value. + MetricDescriptor_MetricDescriptorMetadata_TIME_SERIES_RESOURCE_HIERARCHY_LEVEL_UNSPECIFIED MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel = 0 + // Scopes a metric to a project. + MetricDescriptor_MetricDescriptorMetadata_PROJECT MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel = 1 + // Scopes a metric to an organization. + MetricDescriptor_MetricDescriptorMetadata_ORGANIZATION MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel = 2 + // Scopes a metric to a folder. + MetricDescriptor_MetricDescriptorMetadata_FOLDER MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel = 3 +) + +// Enum value maps for MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel. +var ( + MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel_name = map[int32]string{ + 0: "TIME_SERIES_RESOURCE_HIERARCHY_LEVEL_UNSPECIFIED", + 1: "PROJECT", + 2: "ORGANIZATION", + 3: "FOLDER", + } + MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel_value = map[string]int32{ + "TIME_SERIES_RESOURCE_HIERARCHY_LEVEL_UNSPECIFIED": 0, + "PROJECT": 1, + "ORGANIZATION": 2, + "FOLDER": 3, + } +) + +func (x MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) Enum() *MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel { + p := new(MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) + *p = x + return p +} + +func (x MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) Descriptor() protoreflect.EnumDescriptor { + return file_google_api_metric_proto_enumTypes[2].Descriptor() +} + +func (MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) Type() protoreflect.EnumType { + return &file_google_api_metric_proto_enumTypes[2] +} + +func (x MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Use MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel.Descriptor instead. +func (MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) EnumDescriptor() ([]byte, []int) { + return file_google_api_metric_proto_rawDescGZIP(), []int{0, 0, 0} +} + // Defines a metric type and its schema. Once a metric descriptor is created, // deleting or altering it stops data collection and makes the metric type's // existing data unusable. @@ -519,6 +576,8 @@ type MetricDescriptor_MetricDescriptorMetadata struct { // age are guaranteed to be ingested and available to be read, excluding // data loss due to errors. IngestDelay *durationpb.Duration `protobuf:"bytes,3,opt,name=ingest_delay,json=ingestDelay,proto3" json:"ingest_delay,omitempty"` + // The scope of the timeseries data of the metric. + TimeSeriesResourceHierarchyLevel []MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel `protobuf:"varint,4,rep,packed,name=time_series_resource_hierarchy_level,json=timeSeriesResourceHierarchyLevel,proto3,enum=google.api.MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel" json:"time_series_resource_hierarchy_level,omitempty"` } func (x *MetricDescriptor_MetricDescriptorMetadata) Reset() { @@ -575,6 +634,13 @@ func (x *MetricDescriptor_MetricDescriptorMetadata) GetIngestDelay() *durationpb return nil } +func (x *MetricDescriptor_MetricDescriptorMetadata) GetTimeSeriesResourceHierarchyLevel() []MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel { + if x != nil { + return x.TimeSeriesResourceHierarchyLevel + } + return nil +} + var File_google_api_metric_proto protoreflect.FileDescriptor var file_google_api_metric_proto_rawDesc = []byte{ @@ -585,7 +651,7 @@ var file_google_api_metric_proto_rawDesc = []byte{ 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xc1, 0x07, 0x0a, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xf0, 0x09, 0x0a, 0x10, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x08, 0x20, @@ -620,7 +686,7 @@ var file_google_api_metric_proto_rawDesc = []byte{ 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x18, 0x0d, 0x20, 0x03, 0x28, 0x09, 0x52, 0x16, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, - 0x73, 0x1a, 0xd8, 0x01, 0x0a, 0x18, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, + 0x73, 0x1a, 0x87, 0x04, 0x0a, 0x18, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x3e, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, @@ -633,35 +699,54 @@ var file_google_api_metric_proto_rawDesc = []byte{ 0x0a, 0x0c, 0x69, 0x6e, 0x67, 0x65, 0x73, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x0b, 0x69, 0x6e, 0x67, 0x65, 0x73, 0x74, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x22, 0x4f, 0x0a, 0x0a, - 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x12, 0x1b, 0x0a, 0x17, 0x4d, 0x45, - 0x54, 0x52, 0x49, 0x43, 0x5f, 0x4b, 0x49, 0x4e, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, - 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x47, 0x41, 0x55, 0x47, 0x45, - 0x10, 0x01, 0x12, 0x09, 0x0a, 0x05, 0x44, 0x45, 0x4c, 0x54, 0x41, 0x10, 0x02, 0x12, 0x0e, 0x0a, - 0x0a, 0x43, 0x55, 0x4d, 0x55, 0x4c, 0x41, 0x54, 0x49, 0x56, 0x45, 0x10, 0x03, 0x22, 0x71, 0x0a, - 0x09, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x56, 0x41, - 0x4c, 0x55, 0x45, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, - 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x42, 0x4f, 0x4f, 0x4c, 0x10, 0x01, - 0x12, 0x09, 0x0a, 0x05, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x44, - 0x4f, 0x55, 0x42, 0x4c, 0x45, 0x10, 0x03, 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, - 0x47, 0x10, 0x04, 0x12, 0x10, 0x0a, 0x0c, 0x44, 0x49, 0x53, 0x54, 0x52, 0x49, 0x42, 0x55, 0x54, - 0x49, 0x4f, 0x4e, 0x10, 0x05, 0x12, 0x09, 0x0a, 0x05, 0x4d, 0x4f, 0x4e, 0x45, 0x59, 0x10, 0x06, - 0x22, 0x8f, 0x01, 0x0a, 0x06, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x12, 0x12, 0x0a, 0x04, 0x74, - 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, - 0x36, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, - 0x72, 0x69, 0x63, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, - 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, - 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, - 0x38, 0x01, 0x42, 0x5f, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x61, 0x70, 0x69, 0x42, 0x0b, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x50, 0x01, 0x5a, 0x37, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, - 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6d, - 0x65, 0x74, 0x72, 0x69, 0x63, 0x3b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0xa2, 0x02, 0x04, 0x47, - 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x0b, 0x69, 0x6e, 0x67, 0x65, 0x73, 0x74, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0xa6, 0x01, 0x0a, + 0x24, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x5f, 0x72, 0x65, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x68, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x79, 0x5f, + 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x56, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, + 0x74, 0x61, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x79, 0x4c, 0x65, + 0x76, 0x65, 0x6c, 0x52, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, + 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x79, + 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x22, 0x83, 0x01, 0x0a, 0x20, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, + 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x69, 0x65, 0x72, + 0x61, 0x72, 0x63, 0x68, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x34, 0x0a, 0x30, 0x54, 0x49, + 0x4d, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x49, 0x45, 0x53, 0x5f, 0x52, 0x45, 0x53, 0x4f, 0x55, 0x52, + 0x43, 0x45, 0x5f, 0x48, 0x49, 0x45, 0x52, 0x41, 0x52, 0x43, 0x48, 0x59, 0x5f, 0x4c, 0x45, 0x56, + 0x45, 0x4c, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, + 0x12, 0x0b, 0x0a, 0x07, 0x50, 0x52, 0x4f, 0x4a, 0x45, 0x43, 0x54, 0x10, 0x01, 0x12, 0x10, 0x0a, + 0x0c, 0x4f, 0x52, 0x47, 0x41, 0x4e, 0x49, 0x5a, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x10, 0x02, 0x12, + 0x0a, 0x0a, 0x06, 0x46, 0x4f, 0x4c, 0x44, 0x45, 0x52, 0x10, 0x03, 0x22, 0x4f, 0x0a, 0x0a, 0x4d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x12, 0x1b, 0x0a, 0x17, 0x4d, 0x45, 0x54, + 0x52, 0x49, 0x43, 0x5f, 0x4b, 0x49, 0x4e, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, + 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x47, 0x41, 0x55, 0x47, 0x45, 0x10, + 0x01, 0x12, 0x09, 0x0a, 0x05, 0x44, 0x45, 0x4c, 0x54, 0x41, 0x10, 0x02, 0x12, 0x0e, 0x0a, 0x0a, + 0x43, 0x55, 0x4d, 0x55, 0x4c, 0x41, 0x54, 0x49, 0x56, 0x45, 0x10, 0x03, 0x22, 0x71, 0x0a, 0x09, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x56, 0x41, 0x4c, + 0x55, 0x45, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, + 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x42, 0x4f, 0x4f, 0x4c, 0x10, 0x01, 0x12, + 0x09, 0x0a, 0x05, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x44, 0x4f, + 0x55, 0x42, 0x4c, 0x45, 0x10, 0x03, 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, + 0x10, 0x04, 0x12, 0x10, 0x0a, 0x0c, 0x44, 0x49, 0x53, 0x54, 0x52, 0x49, 0x42, 0x55, 0x54, 0x49, + 0x4f, 0x4e, 0x10, 0x05, 0x12, 0x09, 0x0a, 0x05, 0x4d, 0x4f, 0x4e, 0x45, 0x59, 0x10, 0x06, 0x22, + 0x8f, 0x01, 0x0a, 0x06, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, + 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x36, + 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1e, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x06, + 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, + 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, + 0x01, 0x42, 0x5f, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x42, 0x0b, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, + 0x50, 0x01, 0x5a, 0x37, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, + 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6d, 0x65, + 0x74, 0x72, 0x69, 0x63, 0x3b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0xa2, 0x02, 0x04, 0x47, 0x41, + 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -676,34 +761,36 @@ func file_google_api_metric_proto_rawDescGZIP() []byte { return file_google_api_metric_proto_rawDescData } -var file_google_api_metric_proto_enumTypes = make([]protoimpl.EnumInfo, 2) +var file_google_api_metric_proto_enumTypes = make([]protoimpl.EnumInfo, 3) var file_google_api_metric_proto_msgTypes = make([]protoimpl.MessageInfo, 4) var file_google_api_metric_proto_goTypes = []interface{}{ - (MetricDescriptor_MetricKind)(0), // 0: google.api.MetricDescriptor.MetricKind - (MetricDescriptor_ValueType)(0), // 1: google.api.MetricDescriptor.ValueType - (*MetricDescriptor)(nil), // 2: google.api.MetricDescriptor - (*Metric)(nil), // 3: google.api.Metric - (*MetricDescriptor_MetricDescriptorMetadata)(nil), // 4: google.api.MetricDescriptor.MetricDescriptorMetadata - nil, // 5: google.api.Metric.LabelsEntry - (*label.LabelDescriptor)(nil), // 6: google.api.LabelDescriptor - (api.LaunchStage)(0), // 7: google.api.LaunchStage - (*durationpb.Duration)(nil), // 8: google.protobuf.Duration + (MetricDescriptor_MetricKind)(0), // 0: google.api.MetricDescriptor.MetricKind + (MetricDescriptor_ValueType)(0), // 1: google.api.MetricDescriptor.ValueType + (MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel)(0), // 2: google.api.MetricDescriptor.MetricDescriptorMetadata.TimeSeriesResourceHierarchyLevel + (*MetricDescriptor)(nil), // 3: google.api.MetricDescriptor + (*Metric)(nil), // 4: google.api.Metric + (*MetricDescriptor_MetricDescriptorMetadata)(nil), // 5: google.api.MetricDescriptor.MetricDescriptorMetadata + nil, // 6: google.api.Metric.LabelsEntry + (*label.LabelDescriptor)(nil), // 7: google.api.LabelDescriptor + (api.LaunchStage)(0), // 8: google.api.LaunchStage + (*durationpb.Duration)(nil), // 9: google.protobuf.Duration } var file_google_api_metric_proto_depIdxs = []int32{ - 6, // 0: google.api.MetricDescriptor.labels:type_name -> google.api.LabelDescriptor - 0, // 1: google.api.MetricDescriptor.metric_kind:type_name -> google.api.MetricDescriptor.MetricKind - 1, // 2: google.api.MetricDescriptor.value_type:type_name -> google.api.MetricDescriptor.ValueType - 4, // 3: google.api.MetricDescriptor.metadata:type_name -> google.api.MetricDescriptor.MetricDescriptorMetadata - 7, // 4: google.api.MetricDescriptor.launch_stage:type_name -> google.api.LaunchStage - 5, // 5: google.api.Metric.labels:type_name -> google.api.Metric.LabelsEntry - 7, // 6: google.api.MetricDescriptor.MetricDescriptorMetadata.launch_stage:type_name -> google.api.LaunchStage - 8, // 7: google.api.MetricDescriptor.MetricDescriptorMetadata.sample_period:type_name -> google.protobuf.Duration - 8, // 8: google.api.MetricDescriptor.MetricDescriptorMetadata.ingest_delay:type_name -> google.protobuf.Duration - 9, // [9:9] is the sub-list for method output_type - 9, // [9:9] is the sub-list for method input_type - 9, // [9:9] is the sub-list for extension type_name - 9, // [9:9] is the sub-list for extension extendee - 0, // [0:9] is the sub-list for field type_name + 7, // 0: google.api.MetricDescriptor.labels:type_name -> google.api.LabelDescriptor + 0, // 1: google.api.MetricDescriptor.metric_kind:type_name -> google.api.MetricDescriptor.MetricKind + 1, // 2: google.api.MetricDescriptor.value_type:type_name -> google.api.MetricDescriptor.ValueType + 5, // 3: google.api.MetricDescriptor.metadata:type_name -> google.api.MetricDescriptor.MetricDescriptorMetadata + 8, // 4: google.api.MetricDescriptor.launch_stage:type_name -> google.api.LaunchStage + 6, // 5: google.api.Metric.labels:type_name -> google.api.Metric.LabelsEntry + 8, // 6: google.api.MetricDescriptor.MetricDescriptorMetadata.launch_stage:type_name -> google.api.LaunchStage + 9, // 7: google.api.MetricDescriptor.MetricDescriptorMetadata.sample_period:type_name -> google.protobuf.Duration + 9, // 8: google.api.MetricDescriptor.MetricDescriptorMetadata.ingest_delay:type_name -> google.protobuf.Duration + 2, // 9: google.api.MetricDescriptor.MetricDescriptorMetadata.time_series_resource_hierarchy_level:type_name -> google.api.MetricDescriptor.MetricDescriptorMetadata.TimeSeriesResourceHierarchyLevel + 10, // [10:10] is the sub-list for method output_type + 10, // [10:10] is the sub-list for method input_type + 10, // [10:10] is the sub-list for extension type_name + 10, // [10:10] is the sub-list for extension extendee + 0, // [0:10] is the sub-list for field type_name } func init() { file_google_api_metric_proto_init() } @@ -754,7 +841,7 @@ func file_google_api_metric_proto_init() { File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_api_metric_proto_rawDesc, - NumEnums: 2, + NumEnums: 3, NumMessages: 4, NumExtensions: 0, NumServices: 0, diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go index 3e5621827921e..3cd9a5bb8e62b 100644 --- a/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go @@ -80,11 +80,12 @@ type ErrorInfo struct { Domain string `protobuf:"bytes,2,opt,name=domain,proto3" json:"domain,omitempty"` // Additional structured details about this error. // - // Keys should match /[a-zA-Z0-9-_]/ and be limited to 64 characters in + // Keys must match a regular expression of `[a-z][a-zA-Z0-9-_]+` but should + // ideally be lowerCamelCase. Also, they must be limited to 64 characters in // length. When identifying the current value of an exceeded limit, the units // should be contained in the key, not the value. For example, rather than - // {"instanceLimit": "100/request"}, should be returned as, - // {"instanceLimitPerRequest": "100"}, if the client exceeds the number of + // `{"instanceLimit": "100/request"}`, should be returned as, + // `{"instanceLimitPerRequest": "100"}`, if the client exceeds the number of // instances that can be created in a single (batch) request. Metadata map[string]string `protobuf:"bytes,3,rep,name=metadata,proto3" json:"metadata,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` } @@ -870,6 +871,16 @@ type BadRequest_FieldViolation struct { Field string `protobuf:"bytes,1,opt,name=field,proto3" json:"field,omitempty"` // A description of why the request element is bad. Description string `protobuf:"bytes,2,opt,name=description,proto3" json:"description,omitempty"` + // The reason of the field-level error. This is a constant value that + // identifies the proximate cause of the field-level error. It should + // uniquely identify the type of the FieldViolation within the scope of the + // google.rpc.ErrorInfo.domain. This should be at most 63 + // characters and match a regular expression of `[A-Z][A-Z0-9_]+[A-Z0-9]`, + // which represents UPPER_SNAKE_CASE. + Reason string `protobuf:"bytes,3,opt,name=reason,proto3" json:"reason,omitempty"` + // Provides a localized error message for field-level errors that is safe to + // return to the API consumer. + LocalizedMessage *LocalizedMessage `protobuf:"bytes,4,opt,name=localized_message,json=localizedMessage,proto3" json:"localized_message,omitempty"` } func (x *BadRequest_FieldViolation) Reset() { @@ -918,6 +929,20 @@ func (x *BadRequest_FieldViolation) GetDescription() string { return "" } +func (x *BadRequest_FieldViolation) GetReason() string { + if x != nil { + return x.Reason + } + return "" +} + +func (x *BadRequest_FieldViolation) GetLocalizedMessage() *LocalizedMessage { + if x != nil { + return x.LocalizedMessage + } + return nil +} + // Describes a URL link. type Help_Link struct { state protoimpl.MessageState @@ -1026,51 +1051,57 @@ var file_google_rpc_error_details_proto_rawDesc = []byte{ 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xa8, 0x01, 0x0a, 0x0a, 0x42, 0x61, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x02, 0x0a, 0x0a, 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x50, 0x0a, 0x10, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x66, 0x69, 0x65, 0x6c, 0x64, - 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x48, 0x0a, 0x0e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, - 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x66, 0x69, 0x65, - 0x6c, 0x64, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x4f, 0x0a, 0x0b, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x49, - 0x6e, 0x66, 0x6f, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x69, - 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x49, 0x64, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, - 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, - 0x67, 0x44, 0x61, 0x74, 0x61, 0x22, 0x90, 0x01, 0x0a, 0x0c, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x72, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, - 0x12, 0x14, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x6f, 0x0a, 0x04, 0x48, 0x65, 0x6c, 0x70, - 0x12, 0x2b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x48, 0x65, 0x6c, - 0x70, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x1a, 0x3a, 0x0a, - 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x75, 0x72, 0x6c, 0x18, 0x02, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, 0x22, 0x44, 0x0a, 0x10, 0x4c, 0x6f, 0x63, - 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x16, 0x0a, - 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x6c, - 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x42, - 0x6c, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, - 0x63, 0x42, 0x11, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x44, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, - 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x72, 0x70, - 0x63, 0x2f, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x3b, 0x65, 0x72, 0x72, - 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0xa2, 0x02, 0x03, 0x52, 0x50, 0x43, 0x62, 0x06, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0xab, 0x01, 0x0a, 0x0e, 0x46, + 0x69, 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, + 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x66, 0x69, + 0x65, 0x6c, 0x64, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x12, 0x49, 0x0a, + 0x11, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, + 0x67, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, + 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x52, 0x10, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, + 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0x4f, 0x0a, 0x0b, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x72, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x49, 0x64, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, + 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x73, 0x65, + 0x72, 0x76, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x22, 0x90, 0x01, 0x0a, 0x0c, 0x52, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, + 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x6f, 0x0a, 0x04, + 0x48, 0x65, 0x6c, 0x70, 0x12, 0x2b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, 0x01, 0x20, + 0x03, 0x28, 0x0b, 0x32, 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, + 0x2e, 0x48, 0x65, 0x6c, 0x70, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, + 0x73, 0x1a, 0x3a, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x75, + 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, 0x22, 0x44, 0x0a, + 0x10, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, + 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, + 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, + 0x61, 0x67, 0x65, 0x42, 0x6c, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x72, 0x70, 0x63, 0x42, 0x11, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x44, 0x65, 0x74, 0x61, + 0x69, 0x6c, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, + 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, + 0x73, 0x2f, 0x72, 0x70, 0x63, 0x2f, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, + 0x3b, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0xa2, 0x02, 0x03, 0x52, 0x50, + 0x43, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1111,11 +1142,12 @@ var file_google_rpc_error_details_proto_depIdxs = []int32{ 12, // 3: google.rpc.PreconditionFailure.violations:type_name -> google.rpc.PreconditionFailure.Violation 13, // 4: google.rpc.BadRequest.field_violations:type_name -> google.rpc.BadRequest.FieldViolation 14, // 5: google.rpc.Help.links:type_name -> google.rpc.Help.Link - 6, // [6:6] is the sub-list for method output_type - 6, // [6:6] is the sub-list for method input_type - 6, // [6:6] is the sub-list for extension type_name - 6, // [6:6] is the sub-list for extension extendee - 0, // [0:6] is the sub-list for field type_name + 9, // 6: google.rpc.BadRequest.FieldViolation.localized_message:type_name -> google.rpc.LocalizedMessage + 7, // [7:7] is the sub-list for method output_type + 7, // [7:7] is the sub-list for method input_type + 7, // [7:7] is the sub-list for extension type_name + 7, // [7:7] is the sub-list for extension extendee + 0, // [0:7] is the sub-list for field type_name } func init() { file_google_rpc_error_details_proto_init() } diff --git a/vendor/google.golang.org/genproto/googleapis/type/timeofday/timeofday.pb.go b/vendor/google.golang.org/genproto/googleapis/type/timeofday/timeofday.pb.go new file mode 100644 index 0000000000000..a8a3108a0592d --- /dev/null +++ b/vendor/google.golang.org/genproto/googleapis/type/timeofday/timeofday.pb.go @@ -0,0 +1,202 @@ +// Copyright 2024 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// Code generated by protoc-gen-go. DO NOT EDIT. +// versions: +// protoc-gen-go v1.26.0 +// protoc v4.24.4 +// source: google/type/timeofday.proto + +package timeofday + +import ( + reflect "reflect" + sync "sync" + + protoreflect "google.golang.org/protobuf/reflect/protoreflect" + protoimpl "google.golang.org/protobuf/runtime/protoimpl" +) + +const ( + // Verify that this generated code is sufficiently up-to-date. + _ = protoimpl.EnforceVersion(20 - protoimpl.MinVersion) + // Verify that runtime/protoimpl is sufficiently up-to-date. + _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) +) + +// Represents a time of day. The date and time zone are either not significant +// or are specified elsewhere. An API may choose to allow leap seconds. Related +// types are [google.type.Date][google.type.Date] and +// `google.protobuf.Timestamp`. +type TimeOfDay struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Hours of day in 24 hour format. Should be from 0 to 23. An API may choose + // to allow the value "24:00:00" for scenarios like business closing time. + Hours int32 `protobuf:"varint,1,opt,name=hours,proto3" json:"hours,omitempty"` + // Minutes of hour of day. Must be from 0 to 59. + Minutes int32 `protobuf:"varint,2,opt,name=minutes,proto3" json:"minutes,omitempty"` + // Seconds of minutes of the time. Must normally be from 0 to 59. An API may + // allow the value 60 if it allows leap-seconds. + Seconds int32 `protobuf:"varint,3,opt,name=seconds,proto3" json:"seconds,omitempty"` + // Fractions of seconds in nanoseconds. Must be from 0 to 999,999,999. + Nanos int32 `protobuf:"varint,4,opt,name=nanos,proto3" json:"nanos,omitempty"` +} + +func (x *TimeOfDay) Reset() { + *x = TimeOfDay{} + if protoimpl.UnsafeEnabled { + mi := &file_google_type_timeofday_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *TimeOfDay) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*TimeOfDay) ProtoMessage() {} + +func (x *TimeOfDay) ProtoReflect() protoreflect.Message { + mi := &file_google_type_timeofday_proto_msgTypes[0] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use TimeOfDay.ProtoReflect.Descriptor instead. +func (*TimeOfDay) Descriptor() ([]byte, []int) { + return file_google_type_timeofday_proto_rawDescGZIP(), []int{0} +} + +func (x *TimeOfDay) GetHours() int32 { + if x != nil { + return x.Hours + } + return 0 +} + +func (x *TimeOfDay) GetMinutes() int32 { + if x != nil { + return x.Minutes + } + return 0 +} + +func (x *TimeOfDay) GetSeconds() int32 { + if x != nil { + return x.Seconds + } + return 0 +} + +func (x *TimeOfDay) GetNanos() int32 { + if x != nil { + return x.Nanos + } + return 0 +} + +var File_google_type_timeofday_proto protoreflect.FileDescriptor + +var file_google_type_timeofday_proto_rawDesc = []byte{ + 0x0a, 0x1b, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x2f, 0x74, 0x69, + 0x6d, 0x65, 0x6f, 0x66, 0x64, 0x61, 0x79, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x0b, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x22, 0x6b, 0x0a, 0x09, 0x54, 0x69, + 0x6d, 0x65, 0x4f, 0x66, 0x44, 0x61, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x68, 0x6f, 0x75, 0x72, 0x73, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x68, 0x6f, 0x75, 0x72, 0x73, 0x12, 0x18, 0x0a, + 0x07, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x07, + 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x73, 0x65, 0x63, 0x6f, 0x6e, + 0x64, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x07, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, + 0x73, 0x12, 0x14, 0x0a, 0x05, 0x6e, 0x61, 0x6e, 0x6f, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, + 0x52, 0x05, 0x6e, 0x61, 0x6e, 0x6f, 0x73, 0x42, 0x6c, 0x0a, 0x0f, 0x63, 0x6f, 0x6d, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x42, 0x0e, 0x54, 0x69, 0x6d, 0x65, + 0x4f, 0x66, 0x44, 0x61, 0x79, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, + 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x66, 0x64, + 0x61, 0x79, 0x3b, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x66, 0x64, 0x61, 0x79, 0xf8, 0x01, 0x01, 0xa2, + 0x02, 0x03, 0x47, 0x54, 0x50, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, +} + +var ( + file_google_type_timeofday_proto_rawDescOnce sync.Once + file_google_type_timeofday_proto_rawDescData = file_google_type_timeofday_proto_rawDesc +) + +func file_google_type_timeofday_proto_rawDescGZIP() []byte { + file_google_type_timeofday_proto_rawDescOnce.Do(func() { + file_google_type_timeofday_proto_rawDescData = protoimpl.X.CompressGZIP(file_google_type_timeofday_proto_rawDescData) + }) + return file_google_type_timeofday_proto_rawDescData +} + +var file_google_type_timeofday_proto_msgTypes = make([]protoimpl.MessageInfo, 1) +var file_google_type_timeofday_proto_goTypes = []interface{}{ + (*TimeOfDay)(nil), // 0: google.type.TimeOfDay +} +var file_google_type_timeofday_proto_depIdxs = []int32{ + 0, // [0:0] is the sub-list for method output_type + 0, // [0:0] is the sub-list for method input_type + 0, // [0:0] is the sub-list for extension type_name + 0, // [0:0] is the sub-list for extension extendee + 0, // [0:0] is the sub-list for field type_name +} + +func init() { file_google_type_timeofday_proto_init() } +func file_google_type_timeofday_proto_init() { + if File_google_type_timeofday_proto != nil { + return + } + if !protoimpl.UnsafeEnabled { + file_google_type_timeofday_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*TimeOfDay); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + } + type x struct{} + out := protoimpl.TypeBuilder{ + File: protoimpl.DescBuilder{ + GoPackagePath: reflect.TypeOf(x{}).PkgPath(), + RawDescriptor: file_google_type_timeofday_proto_rawDesc, + NumEnums: 0, + NumMessages: 1, + NumExtensions: 0, + NumServices: 0, + }, + GoTypes: file_google_type_timeofday_proto_goTypes, + DependencyIndexes: file_google_type_timeofday_proto_depIdxs, + MessageInfos: file_google_type_timeofday_proto_msgTypes, + }.Build() + File_google_type_timeofday_proto = out.File + file_google_type_timeofday_proto_rawDesc = nil + file_google_type_timeofday_proto_goTypes = nil + file_google_type_timeofday_proto_depIdxs = nil +} diff --git a/vendor/modules.txt b/vendor/modules.txt index bf14fd4052559..fd20b975e6312 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,5 +1,5 @@ -# cel.dev/expr v0.16.1 -## explicit; go 1.18 +# cel.dev/expr v0.19.1 +## explicit; go 1.21.1 cel.dev/expr # cloud.google.com/go v0.117.0 ## explicit; go 1.21 @@ -50,7 +50,7 @@ cloud.google.com/go/iam/apiv1/iampb cloud.google.com/go/longrunning cloud.google.com/go/longrunning/autogen cloud.google.com/go/longrunning/autogen/longrunningpb -# cloud.google.com/go/monitoring v1.21.2 +# cloud.google.com/go/monitoring v1.22.1 ## explicit; go 1.21 cloud.google.com/go/monitoring/apiv3/v2 cloud.google.com/go/monitoring/apiv3/v2/monitoringpb @@ -63,8 +63,8 @@ cloud.google.com/go/pubsub/apiv1/pubsubpb cloud.google.com/go/pubsub/internal cloud.google.com/go/pubsub/internal/distribution cloud.google.com/go/pubsub/internal/scheduler -# cloud.google.com/go/storage v1.49.0 -## explicit; go 1.21 +# cloud.google.com/go/storage v1.50.0 +## explicit; go 1.22 cloud.google.com/go/storage cloud.google.com/go/storage/experimental cloud.google.com/go/storage/internal @@ -212,11 +212,11 @@ github.com/DmitriyVTitov/size # github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp v1.25.0 ## explicit; go 1.21 github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp -# github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.48.1 -## explicit; go 1.21 +# github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.49.0 +## explicit; go 1.22 github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric -# github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.48.1 -## explicit; go 1.21 +# github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.49.0 +## explicit; go 1.22 github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping # github.com/IBM/go-sdk-core/v5 v5.18.3 ## explicit; go 1.21 @@ -523,7 +523,7 @@ github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1 # github.com/cespare/xxhash/v2 v2.3.0 ## explicit; go 1.11 github.com/cespare/xxhash/v2 -# github.com/cncf/xds/go v0.0.0-20240905190251-b4127c9b8d78 +# github.com/cncf/xds/go v0.0.0-20241223141626-cff3c89139a3 ## explicit; go 1.19 github.com/cncf/xds/go/udpa/annotations github.com/cncf/xds/go/udpa/type/v1 @@ -747,8 +747,8 @@ github.com/fluent/fluent-bit-go/output ## explicit; go 1.17 github.com/fsnotify/fsnotify github.com/fsnotify/fsnotify/internal -# github.com/fsouza/fake-gcs-server v1.50.2 -## explicit; go 1.22 +# github.com/fsouza/fake-gcs-server v1.52.1 +## explicit; go 1.22.9 github.com/fsouza/fake-gcs-server/fakestorage github.com/fsouza/fake-gcs-server/internal/backend github.com/fsouza/fake-gcs-server/internal/checksum @@ -839,7 +839,7 @@ github.com/go-redsync/redsync/v4/redis/goredis/v9 # github.com/go-zookeeper/zk v1.0.3 ## explicit; go 1.13 github.com/go-zookeeper/zk -# github.com/goccy/go-json v0.10.3 +# github.com/goccy/go-json v0.10.4 ## explicit; go 1.19 github.com/goccy/go-json github.com/goccy/go-json/internal/decoder @@ -951,7 +951,7 @@ github.com/google/uuid ## explicit; go 1.19 github.com/googleapis/enterprise-certificate-proxy/client github.com/googleapis/enterprise-certificate-proxy/client/util -# github.com/googleapis/gax-go/v2 v2.14.0 +# github.com/googleapis/gax-go/v2 v2.14.1 ## explicit; go 1.21 github.com/googleapis/gax-go/v2 github.com/googleapis/gax-go/v2/apierror @@ -1215,8 +1215,8 @@ github.com/klauspost/compress/snappy github.com/klauspost/compress/zlib github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.2.8 -## explicit; go 1.15 +# github.com/klauspost/cpuid/v2 v2.2.9 +## explicit; go 1.20 github.com/klauspost/cpuid/v2 # github.com/klauspost/pgzip v1.2.6 ## explicit @@ -1273,7 +1273,7 @@ github.com/miekg/dns # github.com/minio/md5-simd v1.1.2 ## explicit; go 1.14 github.com/minio/md5-simd -# github.com/minio/minio-go/v7 v7.0.82 +# github.com/minio/minio-go/v7 v7.0.83 ## explicit; go 1.22 github.com/minio/minio-go/v7 github.com/minio/minio-go/v7/pkg/cors @@ -1803,15 +1803,15 @@ go.opentelemetry.io/collector/pdata/pmetric/pmetricotlp # go.opentelemetry.io/collector/semconv v0.108.1 ## explicit; go 1.22.0 go.opentelemetry.io/collector/semconv/v1.6.1 -# go.opentelemetry.io/contrib/detectors/gcp v1.29.0 -## explicit; go 1.21 +# go.opentelemetry.io/contrib/detectors/gcp v1.33.0 +## explicit; go 1.22.0 go.opentelemetry.io/contrib/detectors/gcp -# go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.54.0 -## explicit; go 1.21 +# go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.58.0 +## explicit; go 1.22.7 go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal -# go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.54.0 -## explicit; go 1.21 +# go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.58.0 +## explicit; go 1.22.0 go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv @@ -1838,18 +1838,18 @@ go.opentelemetry.io/otel/semconv/v1.26.0 go.opentelemetry.io/otel/metric go.opentelemetry.io/otel/metric/embedded go.opentelemetry.io/otel/metric/noop -# go.opentelemetry.io/otel/sdk v1.29.0 -## explicit; go 1.21 +# go.opentelemetry.io/otel/sdk v1.33.0 +## explicit; go 1.22.0 go.opentelemetry.io/otel/sdk go.opentelemetry.io/otel/sdk/instrumentation go.opentelemetry.io/otel/sdk/internal/x go.opentelemetry.io/otel/sdk/resource -# go.opentelemetry.io/otel/sdk/metric v1.29.0 -## explicit; go 1.21 +# go.opentelemetry.io/otel/sdk/metric v1.33.0 +## explicit; go 1.22.0 go.opentelemetry.io/otel/sdk/metric +go.opentelemetry.io/otel/sdk/metric/exemplar go.opentelemetry.io/otel/sdk/metric/internal go.opentelemetry.io/otel/sdk/metric/internal/aggregate -go.opentelemetry.io/otel/sdk/metric/internal/exemplar go.opentelemetry.io/otel/sdk/metric/internal/x go.opentelemetry.io/otel/sdk/metric/metricdata # go.opentelemetry.io/otel/trace v1.33.0 @@ -2005,7 +2005,7 @@ golang.org/x/tools/internal/stdlib golang.org/x/tools/internal/typeparams golang.org/x/tools/internal/typesinternal golang.org/x/tools/internal/versions -# google.golang.org/api v0.214.0 +# google.golang.org/api v0.215.0 ## explicit; go 1.21 google.golang.org/api/cloudresourcemanager/v1 google.golang.org/api/compute/v1 @@ -2030,9 +2030,10 @@ google.golang.org/api/transport/http google.golang.org/genproto/googleapis/type/calendarperiod google.golang.org/genproto/googleapis/type/date google.golang.org/genproto/googleapis/type/expr +google.golang.org/genproto/googleapis/type/timeofday google.golang.org/genproto/protobuf/api -# google.golang.org/genproto/googleapis/api v0.0.0-20241118233622-e639e219e697 -## explicit; go 1.21 +# google.golang.org/genproto/googleapis/api v0.0.0-20250102185135-69823020774d +## explicit; go 1.22 google.golang.org/genproto/googleapis/api google.golang.org/genproto/googleapis/api/annotations google.golang.org/genproto/googleapis/api/distribution @@ -2040,8 +2041,8 @@ google.golang.org/genproto/googleapis/api/expr/v1alpha1 google.golang.org/genproto/googleapis/api/label google.golang.org/genproto/googleapis/api/metric google.golang.org/genproto/googleapis/api/monitoredres -# google.golang.org/genproto/googleapis/rpc v0.0.0-20241209162323-e6fa225c2576 -## explicit; go 1.21 +# google.golang.org/genproto/googleapis/rpc v0.0.0-20250102185135-69823020774d +## explicit; go 1.22 google.golang.org/genproto/googleapis/rpc/code google.golang.org/genproto/googleapis/rpc/errdetails google.golang.org/genproto/googleapis/rpc/status @@ -2180,8 +2181,8 @@ google.golang.org/grpc/xds/internal/xdsclient/xdslbregistry google.golang.org/grpc/xds/internal/xdsclient/xdslbregistry/converter google.golang.org/grpc/xds/internal/xdsclient/xdsresource google.golang.org/grpc/xds/internal/xdsclient/xdsresource/version -# google.golang.org/grpc/stats/opentelemetry v0.0.0-20240907200651-3ffb98b2c93a -## explicit; go 1.21 +# google.golang.org/grpc/stats/opentelemetry v0.0.0-20241028142157-ada6787961b3 +## explicit; go 1.22.7 google.golang.org/grpc/stats/opentelemetry google.golang.org/grpc/stats/opentelemetry/internal # google.golang.org/protobuf v1.36.2